HHsearch alignment for GI: 254780218 and conserved domain: PRK00698

>PRK00698 tmk thymidylate kinase; Validated.
Probab=100.00  E-value=0  Score=403.67  Aligned_cols=204  Identities=39%  Similarity=0.664  Sum_probs=192.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
T Consensus         1 mkG~fIviEGiDGsGKsTq~~~L~~~L~~~g~~v~~t~eP~~t~~g~~ir~~~~~~~-~~~~~~~~~lLf~adR~~~~~~   79 (204)
T PRK00698          1 MRGMFITIEGIDGAGKSTQIELLAERLEEQGRDVVFTREPGGTPLGEKLRELLLDPN-EPMDDKTELLLFLAARAQHLEE   79 (204)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCC-CCCCHHHHHHHHHHHHHHHHHH
T ss_conf             983199998899998999999999999967997899869999806999999982777-6799899999999999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             56554234525872354243100010034442457765444203889841156652034877644321111100000000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDY  161 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~  161 (225)
T Consensus        80 ~I~p~L~~g~iVI~DRy~~S~~aYqg~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~~~~Ri~~R~~------~dr  153 (204)
T PRK00698         80 VIKPALARGKWVISDRFIDSSLAYQGGGRGLDIDLLAALNRFALGGFRPDLTLYLDVPPEVGLARIAARGE------LDR  153 (204)
T ss_pred             HHHHHHHCCCEEEEECCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCC------CCC
T ss_conf             99988836998998364050999998607999999999998872799998589981799999999983798------642


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             211288999999999999999789949998189788999999999999999
Q gi|254780218|r  162 FERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV  212 (225)
Q Consensus       162 ~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l  212 (225)
T Consensus       154 ~e~~~~~~~~kv~~~Y~~l~~~~~~~~~~IDa~~~~eeV~~~I~~~i~~~l  204 (204)
T PRK00698        154 IEQEGLDFFERVREGYLELAAADPERIVVIDASQSLEEVHEDILAVLKAWL  204 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             015009999999999999998588968998499999999999999999649