HHsearch alignment for GI: 254780218 and conserved domain: PRK04220

>PRK04220 2-phosphoglycerate kinase; Provisional.
Probab=98.66  E-value=4.4e-06  Score=56.60  Aligned_cols=184  Identities=18%  Similarity=0.254  Sum_probs=91.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCC-----CCCH--------HHH--
Q ss_conf             8886899867888797999999999999779819998778898441001100124445-----4101--------345--
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV-----DEFG--------AEA--   66 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~-----~~~~--------~~~--   66 (225)
T Consensus        90 ~~pliILigGtsGvGKSTlA~~LA~rL---gI~~vis----TD~IREVmR~~~~~el~P~Lh~SSy~Awk~l~~~~~~~~  162 (306)
T PRK04220         90 KEPIIILIGGASGVGTSTIAFELASRL---GIRSVIG----TDSIREVMRKIISKELLPTLHESSYTAWKSLRRPPWEEP  162 (306)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHH---CCCEEEC----CHHHHHHHHHCCCCCCCCHHHCCCHHHHHCCCCCCCCCH
T ss_conf             998799985899887899999999970---9883422----216999998524830175132275131002367877865


Q ss_pred             HHHHHHHHHHH----HHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCE-EEEEEEC-H
Q ss_conf             67778899999----7763565542345258723542431000100344424577654442038898411-5665203-4
Q gi|254780218|r   67 EAIVFAAARLD----HVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDC-TIILDLP-V  140 (225)
Q Consensus        67 ~~lLfaadr~~----~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl-~i~Ldv~-~  140 (225)
T Consensus       163 ~~I~Gf~~Q~~~V~~gI~aiI~Ra~~eg~slIIE----------GV-HlvP~-~i---~~~~~--~~~~vi~fll~i~dE  225 (306)
T PRK04220        163 DHILGFERHVEPVLVGVEAVIERALKEGISVIIE----------GV-HIVPG-FI---KEKYL--NMPNVFMFVLTLSDE  225 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE----------EE-CCCHH-HH---HHHHH--CCCCEEEEEEEECCH
T ss_conf             7999999999999999999999999729968998----------43-03778-87---77764--388389999997888


Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             87764432111110000000021128899999999999999978994999818978899999999999999986
Q gi|254780218|r  141 DIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       141 e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
T Consensus       226 e~H~~RF~~Ra~~~~R-~~~rYl~-~f~~IR~IQ~yLv~~A~~~~--vPiI~N~-~id~tv~~i~~~i~~r~~~  294 (306)
T PRK04220        226 ETHKARFYARARVSKR-PAERYLK-HFDEIREIQDYIVEKAKEHG--VPVIENV-SIEETVDKILEIITERLSE  294 (306)
T ss_pred             HHHHHHHHHHCCCCCC-CHHHHHH-HHHHHHHHHHHHHHHHHHHC--CCEECCC-CHHHHHHHHHHHHHHHHHH
T ss_conf             9999999985044789-8789999-79999999999999988809--9810686-6899999999999999999