HHsearch alignment for GI: 254780218 and conserved domain: PRK06067

>PRK06067 flagellar accessory protein FlaH; Validated.
Probab=95.34  E-value=0.047  Score=32.53  Aligned_cols=38  Identities=16%  Similarity=0.052  Sum_probs=29.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             88868998678887979999999999997798199987
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
T Consensus        30 p~g~~~li~G~~G~GKt~~~~~f~~~~~~~g~~~~~~~   67 (241)
T PRK06067         30 PFGSLILIEGENDTGKSVLSQQFVWGALNQGKRGLAIT   67 (241)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             79908999807998879999999999986798299999