HHsearch alignment for GI: 254780218 and conserved domain: PRK06731

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=97.50  E-value=0.0011  Score=42.34  Aligned_cols=37  Identities=24%  Similarity=0.254  Sum_probs=32.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8868998678887979999999999997798199987
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
T Consensus        74 ~~~vI~lvG~~G~GKTTT~AKLA~~~~~~~~kV~lia  110 (270)
T PRK06731         74 EVQTIALIGPTGVGKTTTLAKMAWQFHGKKKTVGFIT  110 (270)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9818999888989889999999999986799089998