HHsearch alignment for GI: 254780218 and conserved domain: PRK06851

>PRK06851 hypothetical protein; Provisional.
Probab=96.56  E-value=0.0054  Score=38.13  Aligned_cols=37  Identities=24%  Similarity=0.350  Sum_probs=33.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             6899867888797999999999999779819998778
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
T Consensus       216 ~~y~ikG~pGtGKstlL~~i~~~A~~~G~dvevyhc~  252 (368)
T PRK06851        216 NRYFLKGRPGTGKSTMLKKVAKAAEERGLDVEVYHCP  252 (368)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             6999818999877999999999999859828998079