HHsearch alignment for GI: 254780218 and conserved domain: PRK08181

>PRK08181 transposase; Validated.
Probab=95.09  E-value=0.14  Score=29.75  Aligned_cols=40  Identities=23%  Similarity=0.278  Sum_probs=33.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             8886899867888797999999999999779819998778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
T Consensus       104 ~~~~Nvil~Gp~GtGKThLA~Alg~~A~~~G~~V~f~~~~  143 (269)
T PRK08181        104 AKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTT  143 (269)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             6487089989999878899999999999879939997899