HHsearch alignment for GI: 254780218 and conserved domain: PRK08939

>PRK08939 primosomal protein DnaI; Reviewed.
Probab=94.66  E-value=0.055  Score=32.10  Aligned_cols=47  Identities=21%  Similarity=0.335  Sum_probs=37.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCC
Q ss_conf             8868998678887979999999999997798199987788984410011001
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVL   54 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l   54 (225)
T Consensus       158 kGly--l~G~~G~GKTyL~~aian~La~~g~~v~~v~~p~---~~~~lK~s~  204 (306)
T PRK08939        158 KGLY--LYGDFGVGKTYLLAAIANELAKKGVSSTLVHFPE---FIRELKNAI  204 (306)
T ss_pred             CEEE--EECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH---HHHHHHHHH
T ss_conf             7788--9899999899999999999998699299987599---999999986