HHsearch alignment for GI: 254780218 and conserved domain: PRK09435

>PRK09435 arginine/ornithine transport system ATPase; Provisional.
Probab=97.30  E-value=0.00059  Score=43.85  Aligned_cols=49  Identities=31%  Similarity=0.475  Sum_probs=38.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCC-----CCCCCCHHH
Q ss_conf             886899867888797999999999999779819998-7788-----984410011
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPG-----GTPAAEAAR   51 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~-----~t~~ge~ir   51 (225)
T Consensus        48 ~a~~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDPsS~~sgGaiLGDr~R  102 (325)
T PRK09435         48 NALRIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDPSSTRTGGSILGDKTR  102 (325)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHH
T ss_conf             8259974279998688999999999996798589999789999888610103888