HHsearch alignment for GI: 254780218 and conserved domain: PRK11174

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed.
Probab=95.90  E-value=0.0064  Score=37.71  Aligned_cols=32  Identities=31%  Similarity=0.506  Sum_probs=26.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             98886899867888797999999999999779
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
T Consensus       373 i~~Ge~vaIVG~SGsGKSTl~~LL~g~~p~~G  404 (588)
T PRK11174        373 LPAGQRVALVGPSGAGKTSLLNALLGFLPYQG  404 (588)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC
T ss_conf             74997899989998649999999987289883