HHsearch alignment for GI: 254780218 and conserved domain: PRK11248

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional.
Probab=96.18  E-value=0.0045  Score=38.58  Aligned_cols=30  Identities=33%  Similarity=0.562  Sum_probs=26.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
T Consensus        25 ~~Ge~~~lvGpnGaGKSTLl~~i~Gl~~p~   54 (255)
T PRK11248         25 ESGELLVVLGPSGCGKTTLLNLIAGFVPPQ   54 (255)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             699899999999846999999997599889