HHsearch alignment for GI: 254780218 and conserved domain: PRK12374

>PRK12374 putative dithiobiotin synthetase; Provisional.
Probab=95.57  E-value=0.029  Score=33.81  Aligned_cols=38  Identities=29%  Similarity=0.386  Sum_probs=32.5

Q ss_pred             CCCCCEEEEECCC-CCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9888689986788-8797999999999999779819998778
Q gi|254780218|r    1 MNSGLFISFEGIE-GAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         1 M~~g~~I~iEGiD-GsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
T Consensus         1 Mmk~~FIT--GTDTdVGKT~vsaaL~~~l~~~G~~v~~~K-P   39 (231)
T PRK12374          1 MLKRFFIT--GTDTSVGKTVVSRALLQALASQGKSVAGYK-P   39 (231)
T ss_pred             CCCCEEEE--ECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-E
T ss_conf             99647998--789995399999999999997899488885-6