HHsearch alignment for GI: 254780218 and conserved domain: TIGR00750

>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=97.75  E-value=4.6e-05  Score=50.47  Aligned_cols=47  Identities=28%  Similarity=0.433  Sum_probs=37.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCCCC-----CCCCHHH
Q ss_conf             6899867888797999999999999779819998-778898-----4410011
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPGGT-----PAAEAAR   51 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~~t-----~~ge~ir   51 (225)
T Consensus        39 ~~vG~TG~PGaGKSTl~~~l~~~lrRrG~~VaViAvDP~SPfTGGsiLGDr~R   91 (333)
T TIGR00750        39 HVVGITGVPGAGKSTLVEKLIMELRRRGLKVAVIAVDPSSPFTGGSILGDRLR   91 (333)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             78766468888577799999899976597689998879759755145456887