>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. This entry represents various SRP subunits.; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.

Probab=96.45 E-value=0.0059 Score=37.92 Aligned_cols=113 Identities=19% Similarity=0.260 Sum_probs=61.4 Q ss_pred CCCCEEEEECCCCCCHHHHHHHHHHH--HHHCCCCEEEEE----CCCC----CCCCCHHHHCCCC-CCCCCCH---HHHH Q ss_conf 88868998678887979999999999--997798199987----7889----8441001100124-4454101---3456 Q gi|254780218|r 2 NSGLFISFEGIEGAGKTTHISLLKRF--LQRKNYDVHVTR----EPGG----TPAAEAARHVLLS-CGVDEFG---AEAE 67 (225) Q Consensus 2 ~~g~~I~iEGiDGsGKsTq~~~L~~~--L~~~g~~v~~~~----eP~~----t~~ge~ir~~l~~-~~~~~~~---~~~~ 67 (225) T Consensus 100 ~~P~vilmvGLQGsGKTTt~gKLA~~ll~kk~~~kvLLva~D~yRPAA~~QL~~Lg~Q~gVpvf~h~~~~-~~p~~Pv~i 178 (439) T TIGR00959 100 KRPTVILMVGLQGSGKTTTAGKLALYLLKKKEGKKVLLVACDLYRPAAIEQLKVLGEQVGVPVFAHLGKG-QSPDDPVEI 178 (439) T ss_pred CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHCCCHHHHHHHHHHHHHCCCCCCCCCCCC-CCCCCHHHH T ss_conf 8683899731378857889999999999986389703403210347899999997675288711004788-898877899 Q ss_pred HHHHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEE Q ss_conf 77788999997763565542-3452587235424310001003444245776544420388984115665 Q gi|254780218|r 68 AIVFAAARLDHVENVIRPAL-MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIIL 136 (225) Q Consensus 68 ~lLfaadr~~~~~~~I~p~L-~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~L 136 (225) T Consensus 179 -----a~~A------l~~Ak~~~~D~vI~DT---------AGRL~ID~~LM~EL~~i-K~~~nP~EiLlV 227 (439) T TIGR00959 179 -----ARQA------LEEAKENGFDVVIVDT---------AGRLQIDEELMEELAEI-KEILNPDEILLV 227 (439) T ss_pred -----HHHH------HHHHHHCCCCEEEEEC---------CCCHHHHHHHHHHHHHH-HHHHCCCEEEEC T ss_conf -----9999------9999974897899726---------75125559999999999-888688705412

HHsearch alignment for GI: 254780218 and conserved domain: TIGR00959