HHsearch alignment for GI: 254780218 and conserved domain: TIGR01313

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family; InterPro: IPR006001 This family of proteins includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases (IPR000577 from INTERPRO).; GO: 0016301 kinase activity, 0005975 carbohydrate metabolic process.
Probab=98.46  E-value=4.1e-06  Score=56.73  Aligned_cols=162  Identities=22%  Similarity=0.253  Sum_probs=86.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCHHHHCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9986788879799999999999977981999877889844-1001100124---44541013456777889999977635
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-AEAARHVLLS---CGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~-ge~ir~~l~~---~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
T Consensus         1 ~VlmGvaG~GKs~~a~~l~~~lg~iyPd~~yi-e-GDdLHP~~Ni~KMs~GiPL~DdD-R~pWL~~----------l~~~   67 (175)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHRLGDIYPDAKYI-E-GDDLHPAANIEKMSRGIPLNDDD-RWPWLKN----------LADA   67 (175)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHHHHCCCCCCC-C-CCCCCCHHHHHHHCCCCCCCCCC-CHHHHHH----------HHHH
T ss_conf             96760278628899999999854315788756-8-86667877798731788887012-0437999----------9999


Q ss_pred             HHHHHCCCC----EEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCE-EEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             655423452----58723542431000100344424577654442038898411-5665203487764432111110000
Q gi|254780218|r   83 IRPALMEGK----ILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDC-TIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        83 I~p~L~~g~----iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl-~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
T Consensus        68 ~~~~~~~~~~~~~~~~C-----S---------ALKr~YRD~LR~s-~~~~~~~~~FiyL~~~~~~~~~R~~~RkGHFMk-  131 (175)
T TIGR01313        68 LAQAAAKNKVHLVIITC-----S---------ALKRKYRDILRSS-LEEAEPELHFIYLSGSKEVILKRMKSRKGHFMK-  131 (175)
T ss_pred             HHHHHHCCCCCCEEEEE-----E---------CCHHHHHHHHHHH-HCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCC-
T ss_conf             99998457745447884-----0---------1113555665422-026898437886368989999996107899862-


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHH--HHH-CCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             00002112889999999999999--997-89949998189788999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDI--ARN-QPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~l--a~~-~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
T Consensus       132 ---------a~m~~---SQf~~LE~P~~nDE~d~~~vd~~~~~e~~~~~~~~~v~  174 (175)
T TIGR01313       132 ---------ADMLE---SQFEALEEPTANDETDVVTVDIDQPLEAVEEDCLAVVL  174 (175)
T ss_pred             ---------CHHHH---HHHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH
T ss_conf             ---------04789---99997278888888543786068865789999999982