>TIGR01351 adk adenylate kinases; InterPro: IPR006259 Most members of this family are known or believed to be adenylate kinase. Adenylate kinase (ADK) 2.7.4.3 from EC converts ATP + AMP to ADP + ADP, that is, it uses ATP as a phosphate donor for AMP. Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). However, some members accept other nucleotide triphosphates as donors, and may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (2.7.4.10 from EC) is Q9UIJ7 from SWISSPROT, a GTP:AMP phosphotransferase that has been identified in bovine heart and human cells and derived from mitrochondrail GTP AMP that is specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate .This family is designated subfamily rather than equivalog for this reason. ADK has also been identified in different bacterial species and in yeast . Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge. ; GO: 0005524 ATP binding, 0016776 phosphotransferase activity phosphate group as acceptor, 0019201 nucleotide kinase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.

Probab=99.43 E-value=2.6e-12 Score=93.75 Aligned_cols=182 Identities=18% Similarity=0.229 Sum_probs=101.5 Q ss_pred EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE----ECC--CCCCCCCHHHHC-CCCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 99867888797999999999999779819998----778--898441001100-12444541013456777889999977 Q gi|254780218|r 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT----REP--GGTPAAEAARHV-LLSCGVDEFGAEAEAIVFAAARLDHV 79 (225) Q Consensus 7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~----~eP--~~t~~ge~ir~~-l~~~~~~~~~~~~~~lLfaadr~~~~ 79 (225) T Consensus 2 ~~~lGpPGsGKGTQa~~i~~~~---gl~HISTGDllR~~~~~~T~LG~~~k~y~y~~~G~LVPD~~v~~l--v~~rl~~~ 76 (232) T TIGR01351 2 LILLGPPGSGKGTQAKRIAEKL---GLPHISTGDLLRAAVKAGTPLGKKAKEYNYMDKGELVPDEIVNQL--VKERLQQN 76 (232) T ss_pred EEEECCCCCCHHHHHHHHHHHC---CCCCCCCHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCHHHHHHH--HHHHHHCC T ss_conf 4675598987667999999860---885020258999998707977898732672003775778999999--99997456 Q ss_pred HHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCH-HHHHHHHHHHCCCCCCCEEEEEEECH-HHHHHHHHHHH------ Q ss_conf 63565542345258723542431000100344424-57765444203889841156652034-87764432111------ Q gi|254780218|r 80 ENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQH-LFLDSLQEISVQEVMPDCTIILDLPV-DIGLKRVQNRY------ 151 (225) Q Consensus 80 ~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~-~~i~~l~~~~~~~~~PDl~i~Ldv~~-e~a~~Ri~~R~------ 151 (225) T Consensus 77 ~~~~~~~~~~G--fILD----------GfPRT~~QAeaL~~~l~--~~g~~~d~V~~L~vp~~e~l~~R~~gR~~cp~cG 142 (232) T TIGR01351 77 PDCVSLKSENG--FILD----------GFPRTLSQAEALDAMLK--ELGLPIDAVIELDVPDLEELVERITGRRICPSCG 142 (232) T ss_pred CCCEEEEECCC--EEEC----------CCCCCHHHHHHHHHHHH--HCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCC T ss_conf 00011010686--2663----------88887899999999998--6189841788853587999999773273306778 Q ss_pred --------HHHHC---CHHH-----HHHHCCHH----HHHHHHHHHHHHH----HHC--CCCEEE-------ECCCCCHH Q ss_conf --------11000---0000-----02112889----9999999999999----978--994999-------81897889 Q gi|254780218|r 152 --------SLRES---ACLD-----YFERKDVM----IHEKRRQIFLDIA----RNQ--PDRCHI-------VDSAHSFQ 198 (225) Q Consensus 152 --------~~~~~---~~~d-----~~E~~~~~----~~~kv~~~y~~la----~~~--~~~~~~-------IDa~~~~e 198 (225) T Consensus 143 ~~Yh~~f~pPk~~gG~~~cD~~~~~~l~qR~DD~~evv~~RL-~~Y~~~t~Pli~yY~~~g~l~~f~~~y~~id~~~~~~ 221 (232) T TIGR01351 143 RVYHIKFNPPKVPGGENLCDDCGGELLIQREDDTEEVVKKRL-EVYKEQTEPLIDYYRKKGILVTFEGIYQTIDGNGPID 221 (232) T ss_pred CEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHH-HHHHHHCCHHHHHHHHCCEEEECCCCEEECCCCCCHH T ss_conf 556102278867876798864457502770699889999999-9988852008999984691365686322003788888 Q ss_pred HHHHHHHHHH Q ss_conf 9999999999 Q gi|254780218|r 199 SVATNILNIV 208 (225) Q Consensus 199 ei~~~I~~~i 208 (225) T Consensus 222 ~v~~~~~~~l 231 (232) T TIGR01351 222 EVWKRILEAL 231 (232) T ss_pred HHHHHHHHHH T ss_conf 8999999972

HHsearch alignment for GI: 254780218 and conserved domain: TIGR01351