HHsearch alignment for GI: 254780218 and conserved domain: TIGR01360

>TIGR01360 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Members of this family are adenylate kinase, 2.7.4.3 from EC. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (IPR006266 from INTERPRO), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in IPR006259 from INTERPRO.; GO: 0004017 adenylate kinase activity, 0005524 ATP binding, 0046034 ATP metabolic process, 0005737 cytoplasm.
Probab=99.25  E-value=1.6e-10  Score=83.14  Aligned_cols=175  Identities=17%  Similarity=0.182  Sum_probs=100.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHH-----HHHHH-HHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677-----78899-9997
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAI-----VFAAA-RLDH   78 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~l-----Lfaad-r~~~   78 (225)
T Consensus         4 kIiFivGGPGSGKGTQC~KiV~KY---GfTHL--------SsGdLLR~Ev~SgS~--rg~~L~aiMe~G~LVp~~~VL~L   70 (191)
T TIGR01360         4 KIIFIVGGPGSGKGTQCEKIVEKY---GFTHL--------SSGDLLREEVASGSE--RGKQLQAIMESGELVPLDVVLDL   70 (191)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHC---CCCCC--------CHHHHHHHHHCCCCC--HHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             568886588888401368988641---88645--------406788987415781--14789999861885550668999


Q ss_pred             HHHHHHHHHCC-CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             76356554234-52587235424310001003444245776544420388984115665203487764432111110000
Q gi|254780218|r   79 VENVIRPALME-GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        79 ~~~~I~p~L~~-g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
T Consensus        71 l~dAm~~~~~~GskGFLID----------GYPRev~Q-----G~eFe~~I~~a~L~Ly~d~s~dTmv~RLL~Ra~~S~vk  135 (191)
T TIGR01360        71 LKDAMLAALGKGSKGFLID----------GYPREVKQ-----GEEFEKRIAPAKLVLYFDCSEDTMVKRLLKRAETSGVK  135 (191)
T ss_pred             HHHHHHHHHCCCCCCCCCC----------CCCCCHHH-----HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             9999998624898631126----------87332011-----24567515996346430004447999999987624799


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHH---HHHHC-C-CCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             0000211288999999999999---99978-9-9499981897889999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLD---IARNQ-P-DRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~---la~~~-~-~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
T Consensus       136 R~DDn~~---TI~kRL~ty~~~t~pvi~yYe~kg~~~~iNAEG~vddvF~~vv~~lD~  190 (191)
T TIGR01360       136 RVDDNEK---TIKKRLETYYKATEPVIAYYESKGKLLKINAEGTVDDVFLQVVAALDK  190 (191)
T ss_pred             CCCCCHH---HHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             8898878---999999998850288998617887157742778775899999997426