HHsearch alignment for GI: 254780218 and conserved domain: TIGR02768

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA. TraA contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, IPR005053 from INTERPRO) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, IPR014129 from INTERPRO). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer ..
Probab=96.03  E-value=0.02  Score=34.75  Aligned_cols=79  Identities=20%  Similarity=0.214  Sum_probs=52.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
T Consensus       430 ~~iavVvG~AGtGKSt~L~aAR~AWe~~Gy~V~-----G-AALsGKAAegL--e~~sGI~SRTLASle~--aW~~G----  495 (888)
T TIGR02768       430 GDIAVVVGRAGTGKSTMLKAAREAWEAAGYRVI-----G-AALSGKAAEGL--EAESGIESRTLASLEY--AWANG----  495 (888)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEE-----E-HHHHHHHHHHH--HCCCCCCHHHHHHHHH--HHHCC----
T ss_conf             964899748998766789999999987397787-----1-54555898873--0026875047887999--98738----


Q ss_pred             HHHHCCCCEEEEC
Q ss_conf             5542345258723
Q gi|254780218|r   84 RPALMEGKILLCD   96 (225)
Q Consensus        84 ~p~L~~g~iVI~D   96 (225)
T Consensus       496 ~d~L~~~dvLviD  508 (888)
T TIGR02768       496 RDLLEDKDVLVID  508 (888)
T ss_pred             CCCCCCCCEEEEE
T ss_conf             7522477668985