HHsearch alignment for GI: 254780218 and conserved domain: cd01882

>cd01882 BMS1 Bms1. Bms1 is an essential, evolutionarily conserved, nucleolar protein. Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits. Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit. The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly. It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=95.31  E-value=0.024  Score=34.30  Aligned_cols=31  Identities=32%  Similarity=0.428  Sum_probs=27.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             8689986788879799999999999977981
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYD   34 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~   34 (225)
T Consensus        39 P~vVavvGPpgvGKtTLiksLvk~ytk~~l~   69 (225)
T cd01882          39 PLVVAVVGPPGVGKTTLIKSLVKNYTKQNIS   69 (225)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9699998989977889999999998544375