HHsearch alignment for GI: 254780218 and conserved domain: cd02023

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=98.66  E-value=6.8e-07  Score=61.42  Aligned_cols=171  Identities=15%  Similarity=0.098  Sum_probs=77.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889-84410011001244454101345677788999997763565
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGG-TPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~-t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
T Consensus         1 iIgI~G~sgsGKTT~a~~L~~~l~~~--~v~~i~~D~yy~~~~~~~~~~~--~~~~fd~p~a~d-------~~~l~~~L~   69 (198)
T cd02023           1 IIGIAGGSGSGKTTVAEEIIEQLGNP--KVVIISQDSYYKDLSHEELEER--KNNNYDHPDAFD-------FDLLISHLQ   69 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCHHHH--CCCCCCCCCHHH-------HHHHHHHHH
T ss_conf             98988999885999999999980999--8589978888879860438784--367878922644-------999999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCC---CHHHHHHHHHHHCCC--CCCCEEEEEEECHHHHHHHHHHHHHHHHCCHH
Q ss_conf             5423452587235424310001003444---245776544420388--98411566520348776443211111000000
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSS---QHLFLDSLQEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSLRESACL  159 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~---~~~~i~~l~~~~~~~--~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~  159 (225)
T Consensus        70 -~L~~g~~i~~p~Yd~~t~~r~~~~~~i~~~~iiIvEGi~~l~~~~lr~~~D~kIfid~~~d~rl~Rri~RD~~eRg~~~  148 (198)
T cd02023          70 -DLKNGKSVEIPVYDFKTHSRLKETVTVYPADVIILEGILALYDKELRDLMDLKIFVDTDADVRLIRRIERDIVERGRDL  148 (198)
T ss_pred             -HHHCCCCCCCCCEECCCCCCCCCCEEECCCCEEEEECHHHCCCHHHHHHHHCEEEEECCHHHHHHHHHHHHHHHHCCCH
T ss_conf             -9864897612310034575467727965886599825343068888867402378617899999999987698858999


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHCCCCE-EEE
Q ss_conf             00211288999999999999999789949-998
Q gi|254780218|r  160 DYFERKDVMIHEKRRQIFLDIARNQPDRC-HIV  191 (225)
Q Consensus       160 d~~E~~~~~~~~kv~~~y~~la~~~~~~~-~~I  191 (225)
T Consensus       149 ~~---v~~~~~~~v~p~~~~~i~P~k~~ADlIi  178 (198)
T cd02023         149 ES---VINQYLKFVKPMHEQFIEPTKRYADVII  178 (198)
T ss_pred             HH---HHHHHHHHHHHHHHHHCCCCHHCCCEEE
T ss_conf             99---9999998607879986524151473897