>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.

Probab=95.23  E-value=0.022  Score=34.52  Aligned_cols=30  Identities=30%  Similarity=0.545  Sum_probs=26.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
T Consensus        24 ~~Gei~gllG~NGaGKSTLl~~i~Gl~~p~   53 (208)
T cd03268          24 KKGEIYGFLGPNGAGKTTTMKIILGLIKPD   53 (208)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             698199999999999999999995783789