HHsearch alignment for GI: 254780218 and conserved domain: cd03290

>cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=95.83  E-value=0.0088  Score=36.86  Aligned_cols=30  Identities=20%  Similarity=0.268  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
T Consensus        25 ~~Ge~~~IvG~sGsGKSTLl~~l~g~~~~~   54 (218)
T cd03290          25 PTGQLTMIVGQVGCGKSSLLLAILGEMQTL   54 (218)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             699999999999980999999985556567