Query         gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 225
No_of_seqs    127 out of 2416
Neff          7.7 
Searched_HMMs 39220
Date          Mon May 23 20:18:17 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780218.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK13973 thymidylate kinase; P 100.0       0       0  432.0  21.2  213    2-217     1-213 (216)
  2 PRK00698 tmk thymidylate kinas 100.0       0       0  403.7  20.6  204    2-212     1-204 (204)
  3 PRK13974 thymidylate kinase; P 100.0       0       0  401.3  19.7  204    2-214     1-210 (212)
  4 COG0125 Tmk Thymidylate kinase 100.0       0       0  395.9  20.5  207    2-214     1-207 (208)
  5 PRK13976 thymidylate kinase; P 100.0       0       0  386.1  20.4  193    5-210     1-198 (202)
  6 TIGR00041 DTMP_kinase thymidyl 100.0       0       0  388.6  17.5  199    3-204     1-211 (211)
  7 PRK07933 thymidylate kinase; V 100.0       0       0  383.8  19.1  203    5-209     1-212 (213)
  8 cd01672 TMPK Thymidine monopho 100.0       0       0  359.4  20.2  199    5-209     1-199 (200)
  9 PRK13975 thymidylate kinase; P 100.0       0       0  351.1  18.2  188    4-214     2-196 (198)
 10 pfam02223 Thymidylate_kin Thym 100.0       0       0  347.4  16.7  186    9-204     1-186 (186)
 11 KOG3327 consensus              100.0   2E-41       0  267.5  12.7  199    1-216     2-201 (208)
 12 cd01673 dNK Deoxyribonucleosid 100.0 1.8E-28 4.7E-33  190.1  15.8  174    6-195     1-186 (193)
 13 cd02030 NDUO42 NADH:Ubiquinone  99.9 2.3E-20 5.9E-25  141.8  16.2  188    6-206     1-217 (219)
 14 COG1428 Deoxynucleoside kinase  99.7 1.1E-15 2.7E-20  114.0  14.6  191    1-212     1-210 (216)
 15 PRK02496 adk adenylate kinase;  99.7 2.7E-15 6.8E-20  111.6  13.4  172    1-209     1-183 (185)
 16 PRK00279 adk adenylate kinase;  99.6   3E-14 7.7E-19  105.3  14.3  176    5-210     1-214 (215)
 17 TIGR01359 UMP_CMP_kin_fam UMP-  99.5 1.9E-13 4.8E-18  100.5   9.9  165    9-208     4-188 (189)
 18 KOG3877 consensus               99.5   1E-12 2.6E-17   96.2  13.5  190    3-205    70-292 (393)
 19 TIGR01351 adk adenylate kinase  99.4 2.6E-12 6.6E-17   93.8  11.8  182    7-208     2-231 (232)
 20 PRK13808 adenylate kinase; Pro  99.4 1.6E-11 4.1E-16   89.0  15.3  178    5-212     1-195 (297)
 21 TIGR03574 selen_PSTK L-seryl-t  99.4 2.1E-11 5.4E-16   88.3  14.2  161    6-208     1-167 (249)
 22 cd01428 ADK Adenylate kinase (  99.4 1.3E-11 3.3E-16   89.6  11.5  163    7-200     2-194 (194)
 23 PRK00889 adenylylsulfate kinas  99.4 1.1E-10 2.8E-15   84.0  16.2  159    1-210     1-170 (175)
 24 PRK00131 aroK shikimate kinase  99.3   2E-11   5E-16   88.5  11.5  174    1-214     1-175 (175)
 25 KOG3079 consensus               99.3 5.2E-11 1.3E-15   86.0  12.9  179    2-210     6-193 (195)
 26 TIGR02173 cyt_kin_arch cytidyl  99.3 1.3E-11 3.3E-16   89.6   9.5  157    5-208     1-172 (173)
 27 PRK06217 hypothetical protein;  99.3 1.4E-10 3.5E-15   83.4  14.3  158    1-210     1-179 (185)
 28 PRK06761 hypothetical protein;  99.3 1.2E-09   3E-14   77.9  17.4  202    1-210     1-277 (281)
 29 pfam03976 PPK2 Polyphosphate k  99.3 1.8E-10 4.7E-15   82.7  13.0  169    2-198    29-208 (229)
 30 PRK05541 adenylylsulfate kinas  99.3 3.9E-10   1E-14   80.7  14.7  159    1-211     3-173 (176)
 31 TIGR01360 aden_kin_iso1 adenyl  99.2 1.6E-10   4E-15   83.1  11.8  175    5-210     4-190 (191)
 32 PRK03839 putative kinase; Prov  99.2 4.3E-10 1.1E-14   80.5  13.3  155    5-214     1-157 (180)
 33 PRK04182 cytidylate kinase; Pr  99.2 4.8E-10 1.2E-14   80.2  13.3  170    5-215     1-177 (178)
 34 PRK05480 uridine kinase; Provi  99.2 3.2E-10 8.1E-15   81.3  11.9  198    1-214     3-208 (209)
 35 COG4088 Predicted nucleotide k  99.2 3.6E-10 9.1E-15   81.0  12.0  155    5-200     2-167 (261)
 36 PRK08356 hypothetical protein;  99.2 4.7E-09 1.2E-13   74.3  16.6  169    1-211     3-193 (195)
 37 PRK01184 hypothetical protein;  99.2   2E-09 5.1E-14   76.5  14.7  170    5-215     2-182 (183)
 38 PRK03731 aroL shikimate kinase  99.2 4.8E-10 1.2E-14   80.2  11.5  168    1-211     1-171 (172)
 39 PTZ00088 adenylate kinase 1; P  99.2 1.2E-09 3.1E-14   77.8  13.1  118    5-151     1-127 (225)
 40 pfam01712 dNK Deoxynucleoside   99.1   6E-10 1.5E-14   79.6  10.4  131   69-211     3-145 (146)
 41 COG1102 Cmk Cytidylate kinase   99.1   1E-09 2.6E-14   78.2  11.3  168    5-214     1-176 (179)
 42 PRK03846 adenylylsulfate kinas  99.1 6.7E-09 1.7E-13   73.4  15.4  160    2-210    22-192 (198)
 43 pfam08433 KTI12 Chromatin asso  99.1 3.6E-09 9.1E-14   75.0  13.9  120    6-153     1-120 (266)
 44 PRK05057 aroK shikimate kinase  99.1 1.2E-08 3.1E-13   71.9  15.6  170    1-210     1-171 (172)
 45 PRK06696 uridine kinase; Valid  99.1 2.3E-09   6E-14   76.1  11.7  177    3-196    25-216 (227)
 46 PRK13946 shikimate kinase; Pro  99.1 2.8E-09 7.1E-14   75.7  11.7  171    4-215    20-191 (195)
 47 COG0563 Adk Adenylate kinase a  99.1 4.9E-09 1.3E-13   74.2  12.6  168    5-208     1-177 (178)
 48 PRK08233 hypothetical protein;  99.1 2.7E-08 6.9E-13   69.8  15.9  169    2-210     1-177 (182)
 49 PRK09825 idnK D-gluconate kina  99.0 1.6E-08 4.2E-13   71.1  14.2  160    3-213     2-171 (176)
 50 PRK13947 shikimate kinase; Pro  99.0 7.9E-09   2E-13   72.9  12.0  167    1-211     1-168 (171)
 51 COG0194 Gmk Guanylate kinase [  99.0 4.8E-09 1.2E-13   74.2  10.5  172    1-210     1-182 (191)
 52 pfam01583 APS_kinase Adenylyls  99.0 1.1E-08 2.8E-13   72.1  12.3  112    3-146     1-116 (157)
 53 PRK00300 gmk guanylate kinase;  99.0 4.4E-09 1.1E-13   74.5   9.8  172    1-209     4-186 (208)
 54 KOG4235 consensus               99.0 9.4E-09 2.4E-13   72.5  11.4  180    3-200    20-223 (244)
 55 COG1936 Predicted nucleotide k  99.0   2E-08 5.1E-13   70.6  12.6  155    5-210     1-156 (180)
 56 pfam00406 ADK Adenylate kinase  99.0 5.2E-09 1.3E-13   74.0   9.2  117   10-152     2-124 (186)
 57 PRK13948 shikimate kinase; Pro  99.0 1.8E-08 4.5E-13   70.9  11.8  171    4-215    10-180 (182)
 58 PRK13949 shikimate kinase; Pro  98.9 1.7E-08 4.3E-13   71.0  10.9  163    1-208     1-169 (169)
 59 COG0529 CysC Adenylylsulfate k  98.9 1.1E-07 2.7E-12   66.2  15.0  161    1-210    20-191 (197)
 60 PRK13477 bifunctional pantoate  98.9 1.8E-08 4.5E-13   70.9  10.7  197    1-218   281-511 (512)
 61 PRK00625 shikimate kinase; Pro  98.9 1.3E-07 3.2E-12   65.8  15.0  165    5-213     1-169 (173)
 62 PRK05506 bifunctional sulfate   98.9 1.2E-07   3E-12   66.0  14.8  160    2-210   441-611 (613)
 63 TIGR00455 apsK adenylylsulfate  98.9 2.3E-09 5.8E-14   76.2   5.9  159    2-208    17-187 (187)
 64 PRK08118 topology modulation p  98.9 5.1E-08 1.3E-12   68.1  12.6  144    1-195     1-158 (167)
 65 PRK07667 uridine kinase; Provi  98.9 1.1E-08 2.9E-13   72.0   9.3  140    5-152    15-158 (190)
 66 PRK06762 hypothetical protein;  98.9 6.8E-08 1.7E-12   67.4  13.1  159    5-209     3-163 (166)
 67 PRK05537 bifunctional sulfate   98.9 1.5E-07 3.8E-12   65.3  14.6  160    2-210   390-562 (568)
 68 PRK07261 topology modulation p  98.9 1.5E-07 3.8E-12   65.4  13.6  147    6-199     2-162 (171)
 69 PRK11545 gntK gluconate kinase  98.8 1.9E-07 4.9E-12   64.7  13.6  156    4-210     8-173 (177)
 70 PRK04040 adenylate kinase; Pro  98.8 3.5E-07 8.9E-12   63.1  14.4  179    4-209     2-188 (189)
 71 PRK10078 ribose 1,5-bisphospho  98.8 6.3E-08 1.6E-12   67.6  10.2  168    4-211     2-177 (184)
 72 cd02027 APSK Adenosine 5'-phos  98.8 1.3E-07 3.4E-12   65.7  11.8  109    7-146     2-113 (149)
 73 PRK00023 cmk cytidylate kinase  98.8 6.4E-08 1.6E-12   67.5  10.1   34    1-37      1-34  (225)
 74 PTZ00301 uridine kinase; Provi  98.8 1.5E-07 3.9E-12   65.3  11.5  194    4-213     3-208 (210)
 75 PRK00081 coaE dephospho-CoA ki  98.7 8.2E-07 2.1E-11   60.9  14.2  172    5-214     3-198 (199)
 76 COG0703 AroK Shikimate kinase   98.7 4.1E-07   1E-11   62.7  12.2  164    5-212     3-170 (172)
 77 COG0283 Cmk Cytidylate kinase   98.7 5.2E-08 1.3E-12   68.1   7.4   34    1-37      1-34  (222)
 78 TIGR03263 guanyl_kin guanylate  98.7 1.3E-07 3.3E-12   65.7   9.3  166    4-209     1-179 (180)
 79 pfam01202 SKI Shikimate kinase  98.7 1.9E-07 4.9E-12   64.7  10.1  156   13-208     1-157 (158)
 80 PRK09518 bifunctional cytidyla  98.7 6.7E-07 1.7E-11   61.4  12.2   76  127-213   148-230 (714)
 81 cd02023 UMPK Uridine monophosp  98.7 6.8E-07 1.7E-11   61.4  11.7  171    6-191     1-178 (198)
 82 PRK04220 2-phosphoglycerate ki  98.7 4.4E-06 1.1E-10   56.6  15.7  184    2-214    90-294 (306)
 83 PRK08154 anaerobic benzoate ca  98.6 2.8E-06 7.1E-11   57.8  14.6  167    5-212   134-303 (304)
 84 smart00072 GuKc Guanylate kina  98.6 3.1E-06 7.8E-11   57.5  14.7  171    4-210     2-182 (184)
 85 TIGR03575 selen_PSTK_euk L-ser  98.6 1.8E-07 4.5E-12   64.9   8.0  177    7-218     2-235 (340)
 86 pfam00625 Guanylate_kin Guanyl  98.6 3.9E-06 9.8E-11   56.9  14.6  169    5-209     2-180 (182)
 87 COG2326 Uncharacterized conser  98.6 1.2E-06 3.1E-11   59.9  12.0  166    3-196    73-249 (270)
 88 COG0237 CoaE Dephospho-CoA kin  98.6 2.3E-07 5.9E-12   64.2   8.1  184    5-216     3-198 (201)
 89 PRK09270 frcK putative fructos  98.6 7.1E-07 1.8E-11   61.3   9.9   36    3-38     33-70  (230)
 90 TIGR00064 ftsY signal recognit  98.5 6.7E-07 1.7E-11   61.4   9.0  113    2-137    80-211 (284)
 91 pfam00485 PRK Phosphoribulokin  98.5 8.4E-07 2.1E-11   60.9   8.8  165    6-182     1-177 (196)
 92 cd00464 SK Shikimate kinase (S  98.5   1E-06 2.6E-11   60.4   8.4  149    7-198     2-153 (154)
 93 TIGR01313 therm_gnt_kin carboh  98.5 4.1E-06 1.1E-10   56.7  11.2  162    7-209     1-174 (175)
 94 cd02021 GntK Gluconate kinase   98.4 3.2E-06   8E-11   57.4  10.4  117    6-152     1-120 (150)
 95 pfam06414 Zeta_toxin Zeta toxi  98.4   2E-05 5.2E-10   52.6  14.4  166    2-194    10-183 (191)
 96 PRK06547 hypothetical protein;  98.4 1.2E-06 3.1E-11   59.9   7.4  121    5-152    16-140 (184)
 97 KOG3062 consensus               98.4 1.9E-05 4.8E-10   52.8  13.4  163    6-204     3-174 (281)
 98 COG3265 GntK Gluconate kinase   98.4 8.1E-06 2.1E-10   55.0  11.5  149   11-210     2-159 (161)
 99 PRK13951 bifunctional shikimat  98.4 6.1E-06 1.6E-10   55.7  10.7  113    5-151     1-113 (488)
100 PRK08099 nicotinamide-nucleoti  98.4 5.3E-05 1.3E-09   50.1  15.4  173    7-215   234-409 (411)
101 COG2019 AdkA Archaeal adenylat  98.4 4.3E-05 1.1E-09   50.7  14.5  175    1-209     1-187 (189)
102 TIGR00017 cmk cytidylate kinas  98.3   1E-05 2.6E-10   54.4  11.0   31    3-36      1-31  (223)
103 TIGR02322 phosphon_PhnN phosph  98.3 5.2E-06 1.3E-10   56.1   9.4  170    4-210     1-182 (183)
104 cd02020 CMPK Cytidine monophos  98.3   1E-05 2.6E-10   54.4  10.9  100    6-149     1-102 (147)
105 PRK03333 coaE dephospho-CoA ki  98.3 1.9E-05 4.9E-10   52.7  12.2  168    6-212     3-194 (394)
106 PRK11860 bifunctional 3-phosph  98.3 7.4E-06 1.9E-10   55.2   9.5   81  127-212   571-657 (662)
107 KOG3354 consensus               98.3 1.4E-05 3.6E-10   53.6  10.9  163    6-211    14-189 (191)
108 pfam01121 CoaE Dephospho-CoA k  98.3 2.1E-06 5.5E-11   58.4   6.3  135    5-155     1-147 (179)
109 PRK07429 phosphoribulokinase;   98.3 1.3E-05 3.3E-10   53.8   9.8  145    2-160     6-155 (331)
110 COG0572 Udk Uridine kinase [Nu  98.2 1.7E-05 4.4E-10   53.0   9.0  163    4-181     8-176 (218)
111 KOG3220 consensus               98.2 1.8E-05 4.5E-10   53.0   8.9  164    6-210     3-194 (225)
112 PRK12269 bifunctional cytidyla  98.1 8.9E-05 2.3E-09   48.8  11.8   30    5-37     35-64  (863)
113 cd02025 PanK Pantothenate kina  98.1 4.2E-05 1.1E-09   50.7   9.7  135    6-152     1-151 (220)
114 PRK12339 2-phosphoglycerate ki  98.0  0.0004   1E-08   44.9  14.0  175    4-209     3-196 (197)
115 cd02028 UMPK_like Uridine mono  98.0 2.7E-05 6.8E-10   51.9   7.9  135    6-152     1-141 (179)
116 COG3172 NadR Predicted ATPase/  98.0 0.00022 5.5E-09   46.5  12.4  170    5-214     9-184 (187)
117 COG3709 Uncharacterized compon  98.0 7.8E-05   2E-09   49.1  10.2  169    3-210     4-182 (192)
118 COG0645 Predicted kinase [Gene  98.0 8.8E-05 2.2E-09   48.8  10.3  120    4-152     1-126 (170)
119 KOG3347 consensus               98.0 0.00013 3.3E-09   47.8  11.1  109    4-152     7-115 (176)
120 KOG0635 consensus               98.0 0.00013 3.2E-09   47.9  10.9  159    2-209    29-199 (207)
121 cd02019 NK Nucleoside/nucleoti  98.0 5.7E-06 1.4E-10   55.9   3.8   31    6-38      1-31  (69)
122 PRK10416 cell division protein  98.0   2E-05 5.2E-10   52.6   6.4   47    2-50    293-339 (499)
123 pfam00693 Herpes_TK Thymidine   98.0 0.00022 5.7E-09   46.4  11.2  162   11-182     1-189 (279)
124 COG0552 FtsY Signal recognitio  97.9 1.1E-05 2.7E-10   54.3   4.2   81    2-96    137-228 (340)
125 pfam07931 CPT Chloramphenicol   97.9 0.00038 9.6E-09   45.0  12.1  166    4-208     1-173 (174)
126 KOG3078 consensus               97.9  0.0002 5.2E-09   46.6  10.6  185    3-219    14-233 (235)
127 cd02026 PRK Phosphoribulokinas  97.9 0.00024   6E-09   46.2  10.8  174    6-198     1-184 (273)
128 cd00227 CPT Chloramphenicol (C  97.9 0.00066 1.7E-08   43.6  13.1  165    3-208     1-174 (175)
129 PRK12338 hypothetical protein;  97.9 0.00089 2.3E-08   42.8  13.7  174    1-206     1-206 (320)
130 KOG0780 consensus               97.8 7.2E-05 1.8E-09   49.3   7.1  115    3-141   100-226 (483)
131 COG2074 2-phosphoglycerate kin  97.8  0.0019 4.9E-08   40.8  14.4  182    1-218    86-295 (299)
132 COG1072 CoaA Panthothenate kin  97.8 0.00022 5.6E-09   46.4   9.2  138    3-154    81-235 (283)
133 PRK00771 signal recognition pa  97.8 0.00012   3E-09   48.0   7.7   37    3-39     96-132 (433)
134 COG4639 Predicted kinase [Gene  97.8 0.00013 3.3E-09   47.8   7.7  116    5-151     3-118 (168)
135 cd02024 NRK1 Nicotinamide ribo  97.8 0.00012   3E-09   48.1   7.1   24    6-29      1-24  (187)
136 TIGR00750 lao LAO/AO transport  97.7 4.6E-05 1.2E-09   50.5   4.9   47    5-51     39-91  (333)
137 cd02022 DPCK Dephospho-coenzym  97.7 2.3E-05 5.9E-10   52.3   3.1  122    6-153     1-145 (179)
138 KOG3308 consensus               97.7  0.0004   1E-08   44.9   9.5  184    1-213     1-207 (225)
139 PRK12726 flagellar biosynthesi  97.7 0.00021 5.5E-09   46.5   8.0   42    2-45    204-245 (407)
140 COG0541 Ffh Signal recognition  97.7 0.00022 5.5E-09   46.5   7.8  112    3-138    99-222 (451)
141 pfam03668 ATP_bind_2 P-loop AT  97.7  0.0047 1.2E-07   38.5  15.7  151    6-209     3-155 (284)
142 PRK10867 signal recognition pa  97.7 0.00021 5.3E-09   46.6   7.2   36    3-38     99-135 (453)
143 COG1618 Predicted nucleotide k  97.7 0.00018 4.6E-09   46.9   6.8  119    4-136     5-137 (179)
144 PRK12337 2-phosphoglycerate ki  97.6  0.0055 1.4E-07   38.1  14.4  178    1-213   259-471 (492)
145 PRK13695 putative NTPase; Prov  97.5 0.00038 9.8E-09   45.0   7.1   32    4-35      3-34  (174)
146 KOG0781 consensus               97.5 0.00043 1.1E-08   44.7   7.2  122    2-136   376-503 (587)
147 COG1703 ArgK Putative periplas  97.5 0.00023   6E-09   46.3   5.7   48    4-51     51-104 (323)
148 PRK06731 flhF flagellar biosyn  97.5  0.0011 2.7E-08   42.3   8.9   37    3-39     74-110 (270)
149 PRK13768 GTPase; Provisional    97.5  0.0013 3.4E-08   41.7   9.3   89    6-97      4-104 (253)
150 TIGR02203 MsbA_lipidA lipid A   97.5 0.00018 4.6E-09   46.9   4.6   89    2-122   386-476 (603)
151 pfam03266 DUF265 Protein of un  97.4 0.00083 2.1E-08   43.0   7.3   29    7-35      2-30  (168)
152 PRK05416 hypothetical protein;  97.4   0.012   3E-07   36.1  14.6  150    5-209     7-160 (292)
153 TIGR00235 udk uridine kinase;   97.4  0.0042 1.1E-07   38.8  10.7  134    4-157    10-166 (220)
154 pfam03308 ArgK ArgK protein. T  97.4 0.00051 1.3E-08   44.2   6.0   50    3-52     28-83  (267)
155 COG1341 Predicted GTPase or GT  97.3  0.0044 1.1E-07   38.6  10.3  119    6-143    75-214 (398)
156 PRK09435 arginine/ornithine tr  97.3 0.00059 1.5E-08   43.9   5.7   49    3-51     48-102 (325)
157 TIGR01526 nadR_NMN_Atrans nico  97.3 0.00053 1.4E-08   44.1   5.1  119    5-139   176-299 (346)
158 COG3911 Predicted ATPase [Gene  97.2  0.0068 1.7E-07   37.5  10.3  168    1-204     6-179 (183)
159 PRK08533 flagellar accessory p  97.2  0.0047 1.2E-07   38.5   9.4   37    3-39     23-59  (230)
160 KOG4238 consensus               97.2  0.0015 3.8E-08   41.5   6.8  117    3-147    49-167 (627)
161 PRK12723 flagellar biosynthesi  97.2  0.0019 4.8E-08   40.9   7.0  115    3-142   173-297 (388)
162 TIGR01425 SRP54_euk signal rec  97.2  0.0019 4.9E-08   40.8   7.0  114    4-140   121-245 (453)
163 cd03114 ArgK-like The function  97.1 0.00087 2.2E-08   42.9   5.1   47    6-52      1-53  (148)
164 pfam07693 KAP_NTPase KAP famil  97.1   0.013 3.3E-07   35.9  11.1   37    2-38     18-54  (301)
165 TIGR00176 mobB molybdopterin-g  97.1 0.00065 1.7E-08   43.6   4.3   36    6-41      1-36  (165)
166 PRK10751 molybdopterin-guanine  97.1  0.0014 3.5E-08   41.7   5.7   35    6-40      4-38  (170)
167 TIGR03015 pepcterm_ATPase puta  97.1   0.011 2.9E-07   36.2  10.4  121    3-142    42-167 (269)
168 pfam03029 ATP_bind_1 Conserved  97.0  0.0054 1.4E-07   38.1   7.9   86   10-97      2-97  (234)
169 CHL00181 cbbX CbbX; Provisiona  96.9  0.0073 1.9E-07   37.4   8.4   30    4-33     59-88  (287)
170 COG1855 ATPase (PilT family) [  96.9  0.0015 3.9E-08   41.4   4.6   48    3-52    264-311 (604)
171 PRK13764 ATPase; Provisional    96.9  0.0016   4E-08   41.3   4.6   45    3-49    260-304 (605)
172 cd03116 MobB Molybdenum is an   96.9  0.0022 5.6E-08   40.5   5.3   36    5-40      2-37  (159)
173 PRK00091 miaA tRNA delta(2)-is  96.8   0.025 6.3E-07   34.2  10.1   81  131-219   191-278 (304)
174 KOG1532 consensus               96.8    0.01 2.5E-07   36.5   7.9   92    2-97     17-123 (366)
175 COG1763 MobB Molybdopterin-gua  96.8  0.0031 7.8E-08   39.6   5.2   37    5-41      3-39  (161)
176 PRK05703 flhF flagellar biosyn  96.7   0.014 3.6E-07   35.7   8.0   82    2-96    208-295 (412)
177 cd03115 SRP The signal recogni  96.6  0.0049 1.3E-07   38.4   5.3   34    6-39      2-35  (173)
178 PRK06851 hypothetical protein;  96.6   0.007 1.8E-07   37.5   5.9   38    5-42     32-69  (368)
179 PRK06851 hypothetical protein;  96.6  0.0054 1.4E-07   38.1   5.4   37    5-41    216-252 (368)
180 PRK05439 pantothenate kinase;   96.6   0.063 1.6E-06   31.8  10.8  187    2-225    84-294 (312)
181 PRK09361 radB DNA repair and r  96.5   0.015 3.7E-07   35.6   7.4   38    2-39     21-58  (224)
182 pfam00448 SRP54 SRP54-type pro  96.5  0.0059 1.5E-07   37.9   5.4   36    4-39      1-36  (196)
183 pfam01591 6PF2K 6-phosphofruct  96.5   0.068 1.7E-06   31.6  14.6  167    5-195    14-197 (223)
184 PRK13342 recombination factor   96.5  0.0031 7.9E-08   39.6   3.9   82    7-95     40-124 (417)
185 COG1120 FepC ABC-type cobalami  96.5  0.0027 6.9E-08   39.9   3.4   30    2-31     26-55  (258)
186 TIGR00959 ffh signal recogniti  96.4  0.0059 1.5E-07   37.9   4.9  113    2-136   100-227 (439)
187 TIGR01846 type_I_sec_HlyB type  96.4  0.0032 8.1E-08   39.5   3.5   27    1-27    488-514 (703)
188 cd03248 ABCC_TAP TAP, the Tran  96.4  0.0019 4.9E-08   40.8   2.4   29    1-29     37-65  (226)
189 PRK13632 cbiO cobalt transport  96.4  0.0029 7.5E-08   39.7   3.2   35    2-36     34-68  (273)
190 cd03249 ABC_MTABC3_MDL1_MDL2 M  96.4  0.0025 6.3E-08   40.2   2.8   29    1-29     26-54  (238)
191 TIGR01186 proV glycine betaine  96.4  0.0028   7E-08   39.9   3.0   28    2-29     17-44  (372)
192 cd03289 ABCC_CFTR2 The CFTR su  96.4  0.0029 7.3E-08   39.8   3.1   32    2-33     28-59  (275)
193 PRK13648 cbiO cobalt transport  96.4   0.004   1E-07   38.9   3.6   29    2-30     33-61  (269)
194 COG1419 FlhF Flagellar GTP-bin  96.3   0.033 8.4E-07   33.4   8.2  117    2-141   201-322 (407)
195 TIGR00763 lon ATP-dependent pr  96.3  0.0064 1.6E-07   37.7   4.6   34    2-38    447-481 (941)
196 PRK13540 cytochrome c biogenes  96.3  0.0034 8.6E-08   39.4   3.1   30    2-31     25-54  (200)
197 cd03247 ABCC_cytochrome_bd The  96.3  0.0044 1.1E-07   38.7   3.7   29    1-29     25-53  (178)
198 KOG1533 consensus               96.3   0.016 4.1E-07   35.3   6.5   87    7-96      5-103 (290)
199 cd03246 ABCC_Protease_Secretio  96.3  0.0039 9.9E-08   39.0   3.3   29    1-29     25-53  (173)
200 PRK11664 ATP-dependent RNA hel  96.3  0.0096 2.4E-07   36.7   5.2   36    3-41     19-56  (812)
201 cd03257 ABC_NikE_OppD_transpor  96.3  0.0042 1.1E-07   38.8   3.4   28    2-29     29-56  (228)
202 cd03237 ABC_RNaseL_inhibitor_d  96.3  0.0042 1.1E-07   38.8   3.4   30    2-31     23-52  (246)
203 PRK13646 cbiO cobalt transport  96.3  0.0041   1E-07   38.8   3.3   30    2-31     31-60  (286)
204 cd03278 ABC_SMC_barmotin Barmo  96.3  0.0059 1.5E-07   37.9   4.1   26    2-28     21-46  (197)
205 PRK13657 cyclic beta-1,2-gluca  96.3  0.0036 9.1E-08   39.2   3.0   28    2-29    359-386 (585)
206 COG4240 Predicted kinase [Gene  96.3  0.0095 2.4E-07   36.7   5.1   37    2-38     48-85  (300)
207 PRK10789 putative multidrug tr  96.3  0.0055 1.4E-07   38.1   3.9   31    1-31    338-368 (569)
208 PRK13826 Dtr system oriT relax  96.3    0.02   5E-07   34.8   6.7   80    4-97    397-476 (1102)
209 cd03253 ABCC_ATM1_transporter   96.2  0.0026 6.7E-08   40.0   2.2   29    1-29     24-52  (236)
210 cd03369 ABCC_NFT1 Domain 2 of   96.2  0.0063 1.6E-07   37.7   4.2   30    2-31     32-61  (207)
211 TIGR01189 ccmA heme ABC export  96.2  0.0039   1E-07   39.0   3.1   35    2-36     24-58  (204)
212 PRK13541 cytochrome c biogenes  96.2  0.0045 1.2E-07   38.6   3.4   29    2-30     24-52  (195)
213 PRK13635 cbiO cobalt transport  96.2  0.0043 1.1E-07   38.7   3.2   29    2-30     31-59  (279)
214 cd00071 GMPK Guanosine monopho  96.2  0.0033 8.3E-08   39.4   2.6   37    6-42      1-39  (137)
215 KOG0730 consensus               96.2   0.026 6.6E-07   34.1   7.2  126    1-150   465-613 (693)
216 TIGR02881 spore_V_K stage V sp  96.2  0.0047 1.2E-07   38.5   3.4   27    7-33     45-71  (261)
217 cd03231 ABC_CcmA_heme_exporter  96.2  0.0048 1.2E-07   38.4   3.4   30    1-30     23-52  (201)
218 cd03235 ABC_Metallic_Cations A  96.2  0.0048 1.2E-07   38.4   3.4   28    2-29     23-50  (213)
219 PRK13633 cobalt transporter AT  96.2  0.0046 1.2E-07   38.5   3.3   29    2-30     35-63  (281)
220 cd03245 ABCC_bacteriocin_expor  96.2  0.0048 1.2E-07   38.5   3.3   28    2-29     28-55  (220)
221 PRK11248 tauB taurine transpor  96.2  0.0045 1.2E-07   38.6   3.2   30    2-31     25-54  (255)
222 PRK13647 cbiO cobalt transport  96.2  0.0047 1.2E-07   38.5   3.2   28    2-29     29-56  (273)
223 TIGR01978 sufC FeS assembly AT  96.2  0.0045 1.1E-07   38.6   3.1   24    2-25     24-47  (248)
224 TIGR01193 bacteriocin_ABC ABC-  96.2  0.0036 9.2E-08   39.2   2.6   27    2-28    498-524 (710)
225 PRK06995 flhF flagellar biosyn  96.2   0.032 8.1E-07   33.5   7.4   38    1-38    173-212 (404)
226 COG3839 MalK ABC-type sugar tr  96.2  0.0053 1.4E-07   38.2   3.4   27    2-28     27-53  (338)
227 pfam07728 AAA_5 AAA domain (dy  96.2  0.0085 2.2E-07   36.9   4.5   41    7-49      2-42  (139)
228 PRK13645 cbiO cobalt transport  96.1  0.0048 1.2E-07   38.5   3.1   30    1-30     34-63  (289)
229 TIGR01188 drrA daunorubicin re  96.1  0.0023 5.9E-08   40.3   1.5  175    2-206    19-222 (343)
230 cd03236 ABC_RNaseL_inhibitor_d  96.1  0.0056 1.4E-07   38.0   3.5   28    2-29     24-51  (255)
231 PRK13640 cbiO cobalt transport  96.1  0.0046 1.2E-07   38.6   3.0   29    2-30     32-60  (283)
232 cd03222 ABC_RNaseL_inhibitor T  96.1  0.0062 1.6E-07   37.8   3.7   28    2-29     23-50  (177)
233 COG3640 CooC CO dehydrogenase   96.1   0.012 3.1E-07   36.0   5.2   35    5-39      1-36  (255)
234 PRK13644 cbiO cobalt transport  96.1  0.0054 1.4E-07   38.1   3.3   30    2-31     26-55  (274)
235 PRK10771 thiQ thiamine transpo  96.1  0.0055 1.4E-07   38.1   3.3   29    2-30     23-51  (233)
236 PRK11264 putative amino-acid A  96.1  0.0056 1.4E-07   38.0   3.4   28    1-28     24-51  (248)
237 cd03293 ABC_NrtD_SsuB_transpor  96.1  0.0052 1.3E-07   38.2   3.2   29    1-29     27-55  (220)
238 PRK13643 cbiO cobalt transport  96.1  0.0051 1.3E-07   38.3   3.1   29    2-30     30-58  (288)
239 COG1136 SalX ABC-type antimicr  96.1  0.0065 1.7E-07   37.6   3.6   28    2-29     29-56  (226)
240 cd03254 ABCC_Glucan_exporter_l  96.1  0.0058 1.5E-07   38.0   3.3   29    1-29     26-54  (229)
241 TIGR03608 L_ocin_972_ABC putat  96.1  0.0057 1.5E-07   38.0   3.3   27    2-28     22-48  (206)
242 PRK11247 ssuB aliphatic sulfon  96.1  0.0056 1.4E-07   38.0   3.3   30    2-31     36-65  (257)
243 TIGR00602 rad24 checkpoint pro  96.1  0.0058 1.5E-07   37.9   3.3   29    4-35    118-146 (670)
244 TIGR02525 plasmid_TraJ plasmid  96.1  0.0078   2E-07   37.2   4.0   34    8-41    153-188 (374)
245 PRK10790 putative multidrug tr  96.1  0.0063 1.6E-07   37.7   3.5   29    1-29    364-392 (593)
246 PRK09984 phosphonate/organopho  96.1  0.0059 1.5E-07   37.9   3.3   29    1-29     27-55  (262)
247 cd01394 radB RadB. The archaea  96.1   0.023 5.9E-07   34.3   6.4   38    2-39     17-54  (218)
248 PRK10247 putative ABC transpor  96.1  0.0062 1.6E-07   37.8   3.4   28    2-29     31-58  (225)
249 PRK07940 DNA polymerase III su  96.1   0.063 1.6E-06   31.8   8.6   26    7-32     42-67  (395)
250 PRK13634 cbiO cobalt transport  96.0   0.005 1.3E-07   38.3   2.9   28    2-29     18-45  (276)
251 cd03251 ABCC_MsbA MsbA is an e  96.0  0.0059 1.5E-07   37.9   3.2   30    1-30     25-54  (234)
252 PRK13652 cbiO cobalt transport  96.0  0.0063 1.6E-07   37.7   3.3   35    2-36     28-62  (277)
253 TIGR02768 TraA_Ti Ti-type conj  96.0    0.02 5.1E-07   34.8   5.9   79    4-96    430-508 (888)
254 cd03292 ABC_FtsE_transporter F  96.0  0.0067 1.7E-07   37.6   3.4   27    2-28     25-51  (214)
255 cd03256 ABC_PhnC_transporter A  96.0   0.006 1.5E-07   37.8   3.2   28    2-29     25-52  (241)
256 PRK12402 replication factor C   96.0   0.042 1.1E-06   32.8   7.5   25    7-31     39-63  (337)
257 PRK13543 cytochrome c biogenes  96.0  0.0066 1.7E-07   37.6   3.4   31    1-31     34-64  (214)
258 PRK11629 lolD lipoprotein tran  96.0  0.0065 1.7E-07   37.6   3.3   28    2-29     33-60  (233)
259 cd03226 ABC_cobalt_CbiO_domain  96.0  0.0075 1.9E-07   37.3   3.6   30    2-31     24-53  (205)
260 COG3842 PotA ABC-type spermidi  96.0  0.0071 1.8E-07   37.4   3.5   28    1-28     28-55  (352)
261 cd03291 ABCC_CFTR1 The CFTR su  96.0  0.0065 1.7E-07   37.7   3.3   29    1-29     60-88  (282)
262 cd03244 ABCC_MRP_domain2 Domai  96.0  0.0071 1.8E-07   37.4   3.4   28    2-29     28-55  (221)
263 TIGR00630 uvra excinuclease AB  96.0  0.0042 1.1E-07   38.8   2.3   29    4-32    665-698 (956)
264 PHA02519 plasmid partition pro  96.0   0.018 4.6E-07   35.0   5.5   39    5-43    107-148 (387)
265 PRK03695 vitamin B12-transport  96.0  0.0042 1.1E-07   38.8   2.3   32    2-33     21-52  (245)
266 cd03250 ABCC_MRP_domain1 Domai  96.0  0.0065 1.7E-07   37.7   3.2   29    1-29     28-56  (204)
267 cd03228 ABCC_MRP_Like The MRP   96.0  0.0063 1.6E-07   37.7   3.1   28    2-29     26-53  (171)
268 PRK13341 recombination factor   96.0  0.0022 5.6E-08   40.4   0.8   82    7-95     55-141 (726)
269 PRK13637 cbiO cobalt transport  96.0  0.0058 1.5E-07   37.9   2.9   29    2-30     31-59  (287)
270 cd03234 ABCG_White The White s  96.0  0.0063 1.6E-07   37.7   3.0   30    1-30     30-59  (226)
271 cd02034 CooC The accessory pro  96.0   0.015 3.9E-07   35.4   5.0   33    7-39      2-34  (116)
272 PRK13650 cbiO cobalt transport  96.0  0.0058 1.5E-07   37.9   2.9   34    2-35     28-61  (276)
273 PRK11231 fecE iron-dicitrate t  96.0   0.007 1.8E-07   37.5   3.3   30    2-31     26-55  (255)
274 pfam07015 VirC1 VirC1 protein.  95.9   0.021 5.4E-07   34.6   5.7   36    7-42      4-41  (231)
275 pfam03205 MobB Molybdopterin g  95.9   0.016   4E-07   35.3   5.0   33    6-38      2-34  (122)
276 PRK10744 phosphate transporter  95.9  0.0077   2E-07   37.2   3.4   29    1-29     33-61  (257)
277 PRK13639 cbiO cobalt transport  95.9   0.008   2E-07   37.1   3.5   28    2-29     26-53  (275)
278 PRK13641 cbiO cobalt transport  95.9  0.0067 1.7E-07   37.6   3.1   28    2-29     31-58  (286)
279 pfam08303 tRNA_lig_kinase tRNA  95.9   0.073 1.9E-06   31.4   8.4  143   11-202     6-161 (169)
280 PRK13538 cytochrome c biogenes  95.9  0.0087 2.2E-07   36.9   3.6   28    2-29     25-52  (204)
281 cd03295 ABC_OpuCA_Osmoprotecti  95.9  0.0078   2E-07   37.2   3.4   28    2-29     25-52  (242)
282 PRK09580 sufC cysteine desulfu  95.9  0.0077   2E-07   37.2   3.4   26    1-26     24-49  (248)
283 cd03288 ABCC_SUR2 The SUR doma  95.9  0.0088 2.2E-07   36.9   3.6   29    1-29     44-72  (257)
284 PRK11176 lipid transporter ATP  95.9   0.006 1.5E-07   37.8   2.8   30    1-30    365-394 (581)
285 cd03296 ABC_CysA_sulfate_impor  95.9  0.0081 2.1E-07   37.1   3.4   28    2-29     26-53  (239)
286 TIGR00968 3a0106s01 sulfate AB  95.9  0.0071 1.8E-07   37.4   3.1   26    1-26     23-48  (241)
287 PRK13651 cobalt transporter AT  95.9  0.0089 2.3E-07   36.8   3.6   30    2-31     31-60  (304)
288 PRK13642 cbiO cobalt transport  95.9  0.0077   2E-07   37.2   3.3   30    2-31     31-60  (277)
289 PRK11174 cysteine/glutathione   95.9  0.0064 1.6E-07   37.7   2.8   32    1-32    373-404 (588)
290 KOG0055 consensus               95.9    0.03 7.6E-07   33.7   6.3   27    2-28    377-403 (1228)
291 TIGR01663 PNK-3'Pase polynucle  95.9   0.083 2.1E-06   31.1   8.5   99    6-151   371-469 (526)
292 cd03298 ABC_ThiQ_thiamine_tran  95.9   0.008   2E-07   37.1   3.2   28    2-29     22-49  (211)
293 PRK13636 cbiO cobalt transport  95.9  0.0084 2.1E-07   37.0   3.3   30    2-31     30-59  (285)
294 PRK13546 teichoic acids export  95.9  0.0083 2.1E-07   37.0   3.3   28    2-29     48-75  (264)
295 PRK10584 putative ABC transpor  95.8  0.0083 2.1E-07   37.0   3.3   29    2-30     34-62  (228)
296 PRK13544 consensus              95.8  0.0088 2.2E-07   36.9   3.4   28    2-29     25-52  (208)
297 PRK11831 putative ABC transpor  95.8  0.0081 2.1E-07   37.1   3.2   31    1-31     31-61  (269)
298 PRK12323 DNA polymerase III su  95.8   0.029 7.3E-07   33.8   6.0   38    7-44     41-80  (721)
299 cd03290 ABCC_SUR1_N The SUR do  95.8  0.0088 2.3E-07   36.9   3.3   30    2-31     25-54  (218)
300 PRK11124 artP arginine transpo  95.8  0.0099 2.5E-07   36.6   3.6   27    2-28     26-52  (242)
301 CHL00131 ycf16 sulfate ABC tra  95.8  0.0092 2.3E-07   36.8   3.4   25    2-26     30-54  (252)
302 COG1116 TauB ABC-type nitrate/  95.8  0.0096 2.5E-07   36.6   3.5   36    2-37     27-62  (248)
303 PRK13649 cbiO cobalt transport  95.8  0.0093 2.4E-07   36.7   3.4   28    2-29     31-58  (280)
304 PRK09493 glnQ glutamine ABC tr  95.8    0.01 2.6E-07   36.5   3.5   28    2-29     25-52  (240)
305 COG4619 ABC-type uncharacteriz  95.8  0.0094 2.4E-07   36.7   3.4   26    2-27     27-52  (223)
306 PRK13539 cytochrome c biogenes  95.8   0.012 2.9E-07   36.2   3.8   28    2-29     26-53  (206)
307 COG1121 ZnuC ABC-type Mn/Zn tr  95.8  0.0097 2.5E-07   36.6   3.5   28    2-29     28-55  (254)
308 cd03252 ABCC_Hemolysin The ABC  95.8  0.0084 2.1E-07   37.0   3.1   29    1-29     25-53  (237)
309 PRK09452 potA putrescine/sperm  95.8  0.0097 2.5E-07   36.6   3.4   28    2-29     41-68  (378)
310 cd03232 ABC_PDR_domain2 The pl  95.8  0.0082 2.1E-07   37.1   3.0   25    2-26     31-55  (192)
311 cd03225 ABC_cobalt_CbiO_domain  95.8  0.0097 2.5E-07   36.6   3.4   29    2-30     25-53  (211)
312 cd03255 ABC_MJ0796_Lo1CDE_FtsE  95.8  0.0097 2.5E-07   36.6   3.4   30    2-31     28-57  (218)
313 PRK11160 cysteine/glutathione   95.8  0.0077   2E-07   37.2   2.9   28    2-29    365-392 (575)
314 cd03260 ABC_PstB_phosphate_tra  95.8   0.011 2.8E-07   36.2   3.7   28    2-29     24-51  (227)
315 cd03217 ABC_FeS_Assembly ABC-t  95.8    0.01 2.6E-07   36.5   3.4   25    2-26     24-48  (200)
316 TIGR03375 type_I_sec_LssB type  95.8  0.0078   2E-07   37.2   2.8   29    1-29    488-516 (694)
317 cd03223 ABCD_peroxisomal_ALDP   95.8  0.0097 2.5E-07   36.6   3.3   29    1-29     24-52  (166)
318 cd03220 ABC_KpsT_Wzt ABC_KpsT_  95.8  0.0097 2.5E-07   36.6   3.3   30    1-30     45-74  (224)
319 PRK13548 hmuV hemin importer A  95.8    0.01 2.6E-07   36.5   3.4   28    2-29     26-53  (257)
320 PRK10908 cell division protein  95.7  0.0086 2.2E-07   36.9   3.0   28    2-29     26-53  (222)
321 PRK13631 cbiO cobalt transport  95.7    0.01 2.7E-07   36.4   3.4   30    2-31     50-79  (320)
322 PRK10851 sulfate/thiosulfate t  95.7  0.0094 2.4E-07   36.7   3.1   28    2-29     26-53  (352)
323 PRK10522 multidrug transporter  95.7    0.01 2.6E-07   36.5   3.3   28    2-29    347-374 (547)
324 COG1132 MdlB ABC-type multidru  95.7  0.0088 2.2E-07   36.9   3.0   30    1-30    352-381 (567)
325 PRK13889 conjugal transfer rel  95.7   0.054 1.4E-06   32.1   7.0   79    4-97    362-441 (992)
326 smart00763 AAA_PrkA PrkA AAA d  95.7   0.015 3.8E-07   35.5   4.1   28    3-30     77-104 (361)
327 pfam00437 GSPII_E Type II/IV s  95.7   0.013 3.4E-07   35.8   3.8   39    3-41    138-176 (283)
328 smart00382 AAA ATPases associa  95.7   0.019 4.9E-07   34.9   4.6   36    3-38      1-36  (148)
329 cd03229 ABC_Class3 This class   95.7   0.011 2.8E-07   36.3   3.3   27    2-28     24-50  (178)
330 cd03271 ABC_UvrA_II The excisi  95.7   0.011 2.8E-07   36.3   3.3   22    2-23     19-40  (261)
331 cd03299 ABC_ModC_like Archeal   95.7    0.01 2.7E-07   36.4   3.2   28    2-29     23-50  (235)
332 cd03300 ABC_PotA_N PotA is an   95.7   0.011 2.8E-07   36.3   3.3   29    1-29     23-51  (232)
333 PRK09536 btuD corrinoid ABC tr  95.7    0.01 2.6E-07   36.5   3.1   29    2-30     26-54  (409)
334 cd03233 ABC_PDR_domain1 The pl  95.7   0.011 2.9E-07   36.2   3.4   28    2-29     31-58  (202)
335 cd00009 AAA The AAA+ (ATPases   95.7   0.018 4.7E-07   35.0   4.4   37    4-40     19-55  (151)
336 PRK09544 znuC high-affinity zi  95.6   0.012 3.1E-07   36.1   3.4   28    2-29     28-55  (251)
337 TIGR00630 uvra excinuclease AB  95.6   0.008   2E-07   37.1   2.5   19    3-21     21-39  (956)
338 PRK10253 iron-enterobactin tra  95.6  0.0094 2.4E-07   36.7   2.9   28    2-29     31-58  (265)
339 cd03213 ABCG_EPDR ABCG transpo  95.6    0.01 2.5E-07   36.5   3.0   27    2-28     33-59  (194)
340 pfam03215 Rad17 Rad17 cell cyc  95.6   0.026 6.7E-07   34.0   5.1   36    4-42     45-80  (490)
341 TIGR02903 spore_lon_C ATP-depe  95.6   0.011 2.8E-07   36.3   3.2   24    6-29    178-201 (616)
342 cd03216 ABC_Carb_Monos_I This   95.6   0.012 3.1E-07   36.0   3.4   29    1-29     23-51  (163)
343 PRK10619 histidine/lysine/argi  95.6   0.013 3.3E-07   35.9   3.5   26    2-27     29-54  (257)
344 PRK13542 consensus              95.6   0.013 3.2E-07   35.9   3.5   30    2-31     42-71  (224)
345 PRK11000 maltose/maltodextrin   95.6   0.011 2.8E-07   36.3   3.2   28    2-29     27-54  (369)
346 PRK13547 hmuV hemin importer A  95.6   0.011 2.7E-07   36.3   3.1   28    2-29     25-52  (273)
347 COG4133 CcmA ABC-type transpor  95.6   0.015 3.8E-07   35.5   3.8   41    2-42     26-66  (209)
348 PRK13849 putative crown gall t  95.6   0.036 9.1E-07   33.3   5.7   37    7-43      4-42  (231)
349 PRK10575 iron-hydroxamate tran  95.6   0.013 3.4E-07   35.8   3.5   28    2-29     35-62  (265)
350 PRK11614 livF leucine/isoleuci  95.6   0.013 3.2E-07   35.9   3.4   29    2-30     29-57  (237)
351 PRK11432 fbpC ferric transport  95.6    0.01 2.6E-07   36.5   2.9   27    2-28     30-56  (351)
352 cd03262 ABC_HisP_GlnQ_permease  95.6   0.012 3.1E-07   36.0   3.3   27    2-28     24-50  (213)
353 PRK11819 putative ABC transpor  95.6   0.013 3.4E-07   35.8   3.4   26    2-27     31-56  (556)
354 TIGR00150 TIGR00150 conserved   95.6   0.018 4.7E-07   34.9   4.2   39    3-45     27-65  (147)
355 cd01983 Fer4_NifH The Fer4_Nif  95.6   0.027   7E-07   33.9   5.0   34    6-39      1-34  (99)
356 PRK12374 putative dithiobiotin  95.6   0.029 7.3E-07   33.8   5.1   38    1-41      1-39  (231)
357 cd03267 ABC_NatA_like Similar   95.6   0.012 3.1E-07   36.0   3.2   30    2-31     45-74  (236)
358 PRK09111 DNA polymerase III su  95.6   0.044 1.1E-06   32.7   6.1   26    7-32     48-73  (600)
359 cd03259 ABC_Carb_Solutes_like   95.5   0.013 3.3E-07   35.8   3.3   29    1-29     23-51  (213)
360 PRK08116 hypothetical protein;  95.5   0.054 1.4E-06   32.1   6.4   38    4-41    108-145 (262)
361 PRK13638 cbiO cobalt transport  95.5   0.013 3.4E-07   35.8   3.3   35    2-36     25-59  (271)
362 COG3451 VirB4 Type IV secretor  95.5   0.078   2E-06   31.2   7.2   41    1-42    434-474 (796)
363 cd03301 ABC_MalK_N The N-termi  95.5   0.014 3.5E-07   35.7   3.3   28    2-29     24-51  (213)
364 cd03224 ABC_TM1139_LivF_branch  95.5   0.016 4.1E-07   35.3   3.7   30    2-31     24-53  (222)
365 COG4185 Uncharacterized protei  95.5    0.12   3E-06   30.2   8.0   32    1-35      1-32  (187)
366 cd03221 ABCF_EF-3 ABCF_EF-3  E  95.5   0.015 3.9E-07   35.4   3.6   28    2-29     24-51  (144)
367 COG0378 HypB Ni2+-binding GTPa  95.5   0.029 7.3E-07   33.8   4.9   36    2-38     10-46  (202)
368 TIGR01420 pilT_fam twitching m  95.5   0.018 4.6E-07   35.0   3.9   53    2-55    126-198 (350)
369 TIGR02315 ABC_phnC phosphonate  95.5   0.012   3E-07   36.1   2.9   29    1-29     25-53  (253)
370 COG1660 Predicted P-loop-conta  95.5    0.21 5.5E-06   28.6  14.5   27    5-35      2-28  (286)
371 PRK10895 putative ABC transpor  95.5   0.016 4.2E-07   35.3   3.6   30    2-31     27-56  (241)
372 TIGR02769 nickel_nikE nickel i  95.5   0.011 2.9E-07   36.2   2.8   26    1-26     35-60  (267)
373 PRK13537 lipooligosaccharide t  95.5   0.015 3.8E-07   35.5   3.4   36    2-37     29-64  (304)
374 COG2274 SunT ABC-type bacterio  95.4   0.016   4E-07   35.4   3.4   28    2-29    497-524 (709)
375 TIGR03415 ABC_choXWV_ATP choli  95.4   0.016 4.1E-07   35.3   3.4   27    2-28     48-74  (382)
376 cd00550 ArsA_ATPase Oxyanion-t  95.4    0.04   1E-06   32.9   5.5   37    5-41      1-38  (254)
377 PRK11131 ATP-dependent RNA hel  95.4   0.041   1E-06   32.9   5.5   36    3-41     88-126 (1295)
378 cd03264 ABC_drug_resistance_li  95.4   0.015 3.9E-07   35.4   3.3   28    2-30     24-51  (211)
379 cd03214 ABC_Iron-Siderophores_  95.4   0.018 4.5E-07   35.0   3.6   28    2-29     23-50  (180)
380 PRK09183 transposase/IS protei  95.4     0.1 2.7E-06   30.5   7.5   40    2-41     99-138 (258)
381 cd01122 GP4d_helicase GP4d_hel  95.4   0.044 1.1E-06   32.7   5.6   39    1-39     27-66  (271)
382 cd03265 ABC_DrrA DrrA is the A  95.4   0.017 4.3E-07   35.2   3.5   30    2-31     24-53  (220)
383 cd03238 ABC_UvrA The excision   95.4   0.017 4.4E-07   35.1   3.5   23    2-24     19-41  (176)
384 cd00267 ABC_ATPase ABC (ATP-bi  95.4   0.018 4.6E-07   35.0   3.6   27    2-28     23-49  (157)
385 cd03218 ABC_YhbG The ABC trans  95.4   0.016 4.2E-07   35.3   3.4   31    1-31     23-53  (232)
386 PRK12377 putative replication   95.4    0.14 3.5E-06   29.7   8.1   39    2-40     99-137 (248)
387 PRK11607 potG putrescine trans  95.4   0.014 3.7E-07   35.6   3.0   28    2-29     43-70  (377)
388 cd03263 ABC_subfamily_A The AB  95.4   0.018 4.7E-07   35.0   3.5   29    2-30     26-54  (220)
389 PRK11650 ugpC glycerol-3-phosp  95.3   0.016   4E-07   35.4   3.2   28    2-29     28-55  (358)
390 PRK06067 flagellar accessory p  95.3   0.047 1.2E-06   32.5   5.6   38    2-39     30-67  (241)
391 PRK10636 putative ABC transpor  95.3   0.014 3.6E-07   35.6   2.9   28    2-29     25-52  (638)
392 PRK11300 livG leucine/isoleuci  95.3   0.018 4.6E-07   35.0   3.4   28    2-29     29-56  (255)
393 TIGR03410 urea_trans_UrtE urea  95.3   0.019 4.9E-07   34.8   3.5   30    2-31     24-53  (230)
394 PRK08451 DNA polymerase III su  95.3     0.2   5E-06   28.8   8.7   26    7-32     39-64  (523)
395 cd01882 BMS1 Bms1.  Bms1 is an  95.3   0.024   6E-07   34.3   4.0   31    4-34     39-69  (225)
396 cd03230 ABC_DR_subfamily_A Thi  95.3    0.02 5.1E-07   34.7   3.6   28    2-29     24-51  (173)
397 PRK11147 ABC transporter ATPas  95.3   0.016 4.2E-07   35.2   3.1   27    2-28     27-53  (632)
398 cd03261 ABC_Org_Solvent_Resist  95.3   0.018 4.6E-07   35.0   3.3   28    2-29     24-51  (235)
399 PRK11288 araG L-arabinose tran  95.3   0.019 4.9E-07   34.8   3.5   26    2-27     28-53  (501)
400 pfam01695 IstB IstB-like ATP b  95.3   0.045 1.1E-06   32.6   5.4   40    2-41     45-84  (178)
401 cd03215 ABC_Carb_Monos_II This  95.3   0.012   3E-07   36.1   2.4   28    2-29     24-51  (182)
402 PRK11701 phnK phosphonates tra  95.3   0.021 5.2E-07   34.7   3.6   30    2-31     30-59  (258)
403 PRK13235 nifH nitrogenase redu  95.3   0.038 9.8E-07   33.0   5.0   38    1-41      1-39  (274)
404 PRK10070 glycine betaine trans  95.2   0.018 4.6E-07   35.0   3.2   28    2-29     52-79  (400)
405 PRK13536 nodulation factor exp  95.2   0.021 5.4E-07   34.6   3.5   29    2-30     31-59  (306)
406 cd03268 ABC_BcrA_bacitracin_re  95.2   0.022 5.5E-07   34.5   3.6   30    2-31     24-53  (208)
407 TIGR03258 PhnT 2-aminoethylpho  95.2   0.018 4.6E-07   35.0   3.1   30    2-31     29-58  (362)
408 cd03294 ABC_Pro_Gly_Bertaine T  95.2   0.017 4.4E-07   35.1   3.1   29    1-29     47-75  (269)
409 PRK13230 nitrogenase reductase  95.2   0.043 1.1E-06   32.8   5.1   38    1-41      1-39  (292)
410 COG1126 GlnQ ABC-type polar am  95.2   0.019 4.9E-07   34.8   3.3   25    2-26     26-50  (240)
411 cd01129 PulE-GspE PulE/GspE Th  95.2   0.041   1E-06   32.9   4.9   37    5-41     81-117 (264)
412 KOG2004 consensus               95.2   0.035   9E-07   33.3   4.6   28    3-30    437-464 (906)
413 PRK07952 DNA replication prote  95.2   0.036 9.2E-07   33.2   4.6   35    7-41     99-133 (242)
414 cd03266 ABC_NatA_sodium_export  95.2   0.023 5.8E-07   34.4   3.6   35    2-36     29-63  (218)
415 pfam06745 KaiC KaiC. This fami  95.2   0.056 1.4E-06   32.1   5.5   38    2-39     17-55  (231)
416 cd02029 PRK_like Phosphoribulo  95.2   0.068 1.7E-06   31.6   5.9   87    6-102     1-95  (277)
417 pfam00931 NB-ARC NB-ARC domain  95.1    0.11 2.7E-06   30.4   6.9   35    5-39     20-56  (285)
418 PRK10938 putative molybdenum t  95.1   0.021 5.4E-07   34.6   3.3   28    2-29     27-54  (490)
419 cd00984 DnaB_C DnaB helicase C  95.1   0.066 1.7E-06   31.6   5.8   39    1-39     10-49  (242)
420 cd03269 ABC_putative_ATPase Th  95.1   0.027 6.8E-07   34.0   3.8   36    2-37     24-59  (210)
421 TIGR02324 CP_lyasePhnL phospho  95.1    0.02 5.1E-07   34.7   3.2   31    2-32     32-63  (224)
422 KOG1805 consensus               95.1   0.031 7.9E-07   33.6   4.1   36    6-41    687-722 (1100)
423 PRK13549 xylose transporter AT  95.1   0.021 5.5E-07   34.6   3.3   27    2-28     29-55  (513)
424 TIGR02673 FtsE cell division A  95.1   0.019 4.9E-07   34.8   3.0   28    2-29     26-53  (215)
425 pfam05729 NACHT NACHT domain.   95.1   0.028 7.1E-07   33.9   3.8   25    6-30      2-26  (165)
426 cd03219 ABC_Mj1267_LivG_branch  95.1   0.025 6.4E-07   34.1   3.6   28    2-29     24-51  (236)
427 cd01131 PilT Pilus retraction   95.1   0.042 1.1E-06   32.8   4.8   36    6-41      3-39  (198)
428 PRK08181 transposase; Validate  95.1    0.14 3.5E-06   29.7   7.3   40    2-41    104-143 (269)
429 PRK07399 DNA polymerase III su  95.1     0.2   5E-06   28.8   8.1   26    7-32     29-54  (314)
430 TIGR03411 urea_trans_UrtD urea  95.1   0.024   6E-07   34.3   3.4   28    2-29     26-53  (242)
431 TIGR01448 recD_rel helicase, R  95.1   0.039   1E-06   33.0   4.6   46    3-53    364-422 (769)
432 PRK10787 DNA-binding ATP-depen  95.1   0.058 1.5E-06   32.0   5.4   34    3-39    348-381 (784)
433 COG1131 CcmA ABC-type multidru  95.1   0.023   6E-07   34.3   3.4   36    2-37     29-64  (293)
434 COG0132 BioD Dethiobiotin synt  95.1   0.054 1.4E-06   32.2   5.2   38    1-41      1-39  (223)
435 COG1122 CbiO ABC-type cobalt t  95.0   0.024   6E-07   34.3   3.3   34    2-35     28-61  (235)
436 PRK11819 putative ABC transpor  95.0   0.025 6.5E-07   34.1   3.5   28    2-29    348-375 (556)
437 PRK11147 ABC transporter ATPas  95.0   0.021 5.3E-07   34.6   3.0   31    1-31    342-372 (632)
438 pfam07726 AAA_3 ATPase family   95.0   0.056 1.4E-06   32.1   5.2   24    7-30      2-25  (131)
439 PRK13409 putative ATPase RIL;   95.0   0.023 5.9E-07   34.4   3.2   28    2-29     97-124 (590)
440 TIGR00972 3a0107s01c2 phosphat  95.0   0.023 5.9E-07   34.4   3.2   26    2-27     25-50  (248)
441 pfam02367 UPF0079 Uncharacteri  95.0   0.031 7.9E-07   33.6   3.8   28    2-29     13-40  (123)
442 cd03297 ABC_ModC_molybdenum_tr  95.0   0.025 6.5E-07   34.1   3.3   26    3-28     22-47  (214)
443 PRK13232 nifH nitrogenase redu  95.0   0.055 1.4E-06   32.1   5.0   39    1-42      1-40  (273)
444 PRK00349 uvrA excinuclease ABC  95.0   0.031 7.9E-07   33.6   3.8   20    2-21     24-43  (944)
445 PRK06526 transposase; Provisio  95.0    0.14 3.5E-06   29.8   7.0   40    2-41     96-135 (254)
446 COG4175 ProV ABC-type proline/  94.9   0.023   6E-07   34.3   3.1   27    1-27     51-77  (386)
447 KOG0065 consensus               94.9   0.039 9.9E-07   33.0   4.2  125    2-140   815-958 (1391)
448 cd03270 ABC_UvrA_I The excisio  94.9   0.018 4.7E-07   35.0   2.5   21    1-21     18-38  (226)
449 TIGR03265 PhnT2 putative 2-ami  94.9   0.024 6.1E-07   34.3   3.1   27    2-28     28-54  (353)
450 PRK00635 excinuclease ABC subu  94.9   0.034 8.7E-07   33.3   3.9   19    3-21    960-978 (1809)
451 PRK00349 uvrA excinuclease ABC  94.9   0.022 5.6E-07   34.5   2.9   28    3-30    634-662 (944)
452 pfam03796 DnaB_C DnaB-like hel  94.9   0.069 1.8E-06   31.5   5.4   39    1-39     16-55  (186)
453 PRK04195 replication factor C   94.9   0.051 1.3E-06   32.3   4.7   46    5-54     41-86  (403)
454 COG0470 HolB ATPase involved i  94.9    0.25 6.3E-06   28.2   8.2   26    7-32     27-52  (325)
455 PRK10535 macrolide transporter  94.9    0.03 7.5E-07   33.7   3.5   27    2-28     32-58  (648)
456 cd03243 ABC_MutS_homologs The   94.9    0.19 4.9E-06   28.9   7.6  110    2-122    27-139 (202)
457 cd01130 VirB11-like_ATPase Typ  94.9   0.026 6.7E-07   34.0   3.2   36    2-38     23-58  (186)
458 PRK10636 putative ABC transpor  94.8   0.026 6.6E-07   34.1   3.1   28    2-29    336-363 (638)
459 PRK10762 D-ribose transporter   94.8   0.031 7.9E-07   33.6   3.5   28    2-29     28-55  (501)
460 TIGR03522 GldA_ABC_ATP gliding  94.8   0.029 7.3E-07   33.8   3.3   34    2-35     26-59  (301)
461 COG4167 SapF ABC-type antimicr  94.8   0.022 5.7E-07   34.4   2.7   64    2-66     37-104 (267)
462 COG0178 UvrA Excinuclease ATPa  94.8   0.035 8.8E-07   33.3   3.7   25    4-28    627-652 (935)
463 cd02040 NifH NifH gene encodes  94.8   0.069 1.8E-06   31.5   5.1   34    6-39      3-36  (270)
464 PRK10982 galactose/methyl gala  94.8    0.03 7.8E-07   33.6   3.3   28    2-29     22-49  (491)
465 PRK00635 excinuclease ABC subu  94.7   0.025 6.4E-07   34.1   2.8   19    3-21     25-43  (1809)
466 KOG0055 consensus               94.7    0.11 2.8E-06   30.4   6.0   28    1-28   1013-1040(1228)
467 COG3638 ABC-type phosphate/pho  94.7   0.035 8.8E-07   33.3   3.5   28    1-28     27-54  (258)
468 PRK00784 cobyric acid synthase  94.7    0.36 9.1E-06   27.3   9.6   36    1-36      1-36  (492)
469 cd03258 ABC_MetN_methionine_tr  94.7   0.027 6.9E-07   34.0   2.9   27    1-27     28-54  (233)
470 COG0429 Predicted hydrolase of  94.7    0.12   3E-06   30.2   6.1   41    2-42     74-114 (345)
471 TIGR01184 ntrCD nitrate ABC tr  94.7   0.029 7.3E-07   33.8   3.0   27    1-27      8-34  (230)
472 PRK08939 primosomal protein Dn  94.7   0.055 1.4E-06   32.1   4.4   47    3-54    158-204 (306)
473 TIGR03269 met_CoM_red_A2 methy  94.7   0.031   8E-07   33.6   3.1   26    2-27     24-49  (520)
474 cd03227 ABC_Class2 ABC-type Cl  94.6   0.039   1E-06   33.0   3.6   26    1-26     18-43  (162)
475 TIGR00313 cobQ cobyric acid sy  94.6    0.11 2.7E-06   30.4   5.8   40  160-201    99-138 (502)
476 PRK10418 nikD nickel transport  94.6   0.032 8.3E-07   33.5   3.2   29    2-30     27-55  (254)
477 pfam02374 ArsA_ATPase Anion-tr  94.6   0.088 2.3E-06   30.9   5.4   37    5-41      2-39  (304)
478 PRK10938 putative molybdenum t  94.6   0.034 8.6E-07   33.4   3.2   25    2-26    284-308 (490)
479 COG4988 CydD ABC-type transpor  94.6   0.024 6.1E-07   34.3   2.5   28    2-29    345-372 (559)
480 smart00178 SAR Sar1p-like memb  94.6   0.038 9.6E-07   33.1   3.4   25    2-26     15-39  (184)
481 TIGR00955 3a01204 Pigment prec  94.6    0.03 7.7E-07   33.7   2.8   47    2-52     56-107 (671)
482 cd00879 Sar1 Sar1 subfamily.    94.5   0.038 9.8E-07   33.0   3.3   24    2-25     17-40  (190)
483 cd02035 ArsA ArsA ATPase funct  94.5   0.073 1.9E-06   31.4   4.8   34    6-39      1-34  (217)
484 cd02032 Bchl_like This family   94.5    0.09 2.3E-06   30.8   5.2   35    5-39      1-35  (267)
485 COG2256 MGS1 ATPase related to  94.5    0.03 7.6E-07   33.7   2.7   85    7-96     51-137 (436)
486 PRK13236 nitrogenase reductase  94.5   0.073 1.9E-06   31.4   4.7   38    1-41      6-44  (295)
487 PRK05896 DNA polymerase III su  94.5    0.33 8.4E-06   27.5   8.0   25    7-31     41-65  (613)
488 PRK09700 D-allose transporter   94.5   0.042 1.1E-06   32.8   3.4   27    2-28     29-55  (510)
489 pfam05496 RuvB_N Holliday junc  94.5   0.032 8.1E-07   33.5   2.8   23    7-29     53-75  (234)
490 PRK11144 modC molybdate transp  94.4   0.041   1E-06   32.9   3.3   28    2-29     22-49  (352)
491 cd03240 ABC_Rad50 The catalyti  94.4    0.04   1E-06   32.9   3.2   26    3-28     21-46  (204)
492 TIGR01192 chvA glucan exporter  94.4    0.04   1E-06   32.9   3.2   27    2-28    359-385 (592)
493 PRK10646 putative ATPase; Prov  94.4   0.057 1.5E-06   32.0   3.9   28    2-29     26-53  (153)
494 TIGR02857 CydD ABC transporter  94.4   0.037 9.4E-07   33.2   3.0   32    2-33    376-408 (570)
495 COG5271 MDN1 AAA ATPase contai  94.3    0.14 3.6E-06   29.6   5.9   32    4-38   1543-1574(4600)
496 COG0396 sufC Cysteine desulfur  94.3   0.048 1.2E-06   32.5   3.4   25    2-26     28-52  (251)
497 KOG0057 consensus               94.3   0.057 1.4E-06   32.0   3.8   32    2-33    376-407 (591)
498 KOG0744 consensus               94.3   0.039   1E-06   33.0   2.9   27    3-29    176-202 (423)
499 PRK10419 nikE nickel transport  94.3   0.048 1.2E-06   32.5   3.4   27    2-28     36-62  (266)
500 pfam01443 Viral_helicase1 Vira  94.2   0.033 8.5E-07   33.4   2.5   21    7-27      1-21  (226)

No 1  
>PRK13973 thymidylate kinase; Provisional
Probab=100.00  E-value=0  Score=432.02  Aligned_cols=213  Identities=50%  Similarity=0.810  Sum_probs=201.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      .||+||||||+||||||||+++|+++|+++|++|++|+|||+|+.|+.||++++++....++|.+++|||+|||++|+++
T Consensus         1 MkG~fIv~EGiDGsGKsTq~~~L~~~L~~~g~~v~~trePg~t~~~e~ir~~ll~~~~~~~~~~~e~lLfaA~R~eh~~~   80 (216)
T PRK13973          1 MRGRFITFEGGEGAGKSTQIRLLAERLRAAGYDVLVTREPGGSPGAEAIRHVLLSGAAELYGPAMEALLFAAARDDHVEE   80 (216)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98249998899999899999999999997799579940989984089999998466657899899999999999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             56554234525872354243100010034442457765444203889841156652034877644321111100000000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDY  161 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~  161 (225)
                      +|+|+|++|++||||||++||+||||++++++.+++.+++.+..+.|+||+|||||+||+++++|+.+|..   ....|+
T Consensus        81 ~I~paL~~g~~VI~DRy~~Ss~AYQg~~~~~~~~~l~~l~~~~~~~~~PDlti~LDv~~e~a~~R~~~R~~---~~~~dr  157 (216)
T PRK13973         81 VIRPALARGKIVLCDRFIDSTRAYQGVTGNVDPALLAALERVAINGVMPDLTLILDIPAEVGLERAAKRRG---SETPDR  157 (216)
T ss_pred             HHHHHHHCCCEEEECCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCC---CCCCCH
T ss_conf             99999977998986786257999977427889899999999996799999899981888999999998357---763002


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             21128899999999999999978994999818978899999999999999986426
Q gi|254780218|r  162 FERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS  217 (225)
Q Consensus       162 ~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~~~  217 (225)
                      ||+++.+|+++|+++|+++++.+|.+|++|||++|+++|+++|++.|.+.|.+-.+
T Consensus       158 ~E~~~~~f~~kVr~~Y~~la~~~~~r~~vIDa~~s~eeV~~~I~~~v~~~L~e~~~  213 (216)
T PRK13973        158 FEKEDLAFHEKRREAFLQIAAQEPERCVVIDADASPEAVAAEIWAAVDQRLLEAAA  213 (216)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             55647999999999999999859887899719999999999999999998621000


No 2  
>PRK00698 tmk thymidylate kinase; Validated
Probab=100.00  E-value=0  Score=403.67  Aligned_cols=204  Identities=39%  Similarity=0.664  Sum_probs=192.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      .|||||||||+||||||||+++|+++|+++|++|++++|||+|++|+.||+.+++.. ..++|.+++|||+|||++|+++
T Consensus         1 mkG~fIviEGiDGsGKsTq~~~L~~~L~~~g~~v~~t~eP~~t~~g~~ir~~~~~~~-~~~~~~~~~lLf~adR~~~~~~   79 (204)
T PRK00698          1 MRGMFITIEGIDGAGKSTQIELLAERLEEQGRDVVFTREPGGTPLGEKLRELLLDPN-EPMDDKTELLLFLAARAQHLEE   79 (204)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCC-CCCCHHHHHHHHHHHHHHHHHH
T ss_conf             983199998899998999999999999967997899869999806999999982777-6799899999999999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             56554234525872354243100010034442457765444203889841156652034877644321111100000000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDY  161 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~  161 (225)
                      +|+|+|++|++||||||++|++||||+..+++.+|+.+++.+..+.|+||+|||||+||+++++|+.+|+.      .|+
T Consensus        80 ~I~p~L~~g~iVI~DRy~~S~~aYqg~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~~~~Ri~~R~~------~dr  153 (204)
T PRK00698         80 VIKPALARGKWVISDRFIDSSLAYQGGGRGLDIDLLAALNRFALGGFRPDLTLYLDVPPEVGLARIAARGE------LDR  153 (204)
T ss_pred             HHHHHHHCCCEEEEECCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCC------CCC
T ss_conf             99988836998998364050999998607999999999998872799998589981799999999983798------642


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             211288999999999999999789949998189788999999999999999
Q gi|254780218|r  162 FERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV  212 (225)
Q Consensus       162 ~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l  212 (225)
                      ||.++.+|+++|+++|+++++.+|.+|++|||++++|+|+++|++.|++.|
T Consensus       154 ~e~~~~~~~~kv~~~Y~~l~~~~~~~~~~IDa~~~~eeV~~~I~~~i~~~l  204 (204)
T PRK00698        154 IEQEGLDFFERVREGYLELAAADPERIVVIDASQSLEEVHEDILAVLKAWL  204 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             015009999999999999998588968998499999999999999999649


No 3  
>PRK13974 thymidylate kinase; Provisional
Probab=100.00  E-value=0  Score=401.35  Aligned_cols=204  Identities=31%  Similarity=0.517  Sum_probs=187.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC-----CEEEEECCCCCCCCCHHHHCCCCCC-CCCCHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798-----1999877889844100110012444-54101345677788999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNY-----DVHVTREPGGTPAAEAARHVLLSCG-VDEFGAEAEAIVFAAAR   75 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~-----~v~~~~eP~~t~~ge~ir~~l~~~~-~~~~~~~~~~lLfaadr   75 (225)
                      .||+||||||+||||||||+++|+++|++.|+     +++.++|||+|++|+.||++|++.. ....+|.+++|||+|||
T Consensus         1 m~G~fIv~EGiDGsGKsTq~~~L~~~L~~~g~~~~~~~~~~~rePg~t~~g~~ir~~l~~~~~~~~~~~~~e~lLf~AdR   80 (212)
T PRK13974          1 MKGKFIVLEGIDGCGKTTQIDHLSKWLPSSGLMPKGAKLIITREPGGTLLGKSLRELLLDTSKDNSPSPLAELLLYAADR   80 (212)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99419998899999899999999999986587535861577149999806999999980665456888799999999999


Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             99776356554234525872354243100010034442457765444203889841156652034877644321111100
Q gi|254780218|r   76 LDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE  155 (225)
Q Consensus        76 ~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~  155 (225)
                      ++|+.++|+|+|.+|++||||||++||+||||+.++++.+|+..++.++...+.||+|||||+||+++++|..+|.    
T Consensus        81 ~e~~~~~I~paL~~G~iVI~DRY~~St~AYQg~~~g~~~~~i~~l~~~~~~~~~PDlt~~LDv~~e~a~~R~~~~~----  156 (212)
T PRK13974         81 AQHVSKIIRPALENGDWVISDRFSGSTLAYQGYGRGLDLELIKNLESIATQGLSPDLTFFLEISVEESIRRRKNRK----  156 (212)
T ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHCCC----
T ss_conf             9999999999983799999788323599998862699999999999987479999989997697588999884776----


Q ss_pred             CCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             00000021128899999999999999978994999818978899999999999999986
Q gi|254780218|r  156 SACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       156 ~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
                         .|+||.++.+|+++|+++|+.++++  .+|++|||++++|+|+++|++.|.+.++.
T Consensus       157 ---~dr~e~e~~~f~~kVr~~y~~la~~--~~~~~IDa~~~ieeV~~~I~~~i~~~~~~  210 (212)
T PRK13974        157 ---PDRIEAEGIEFLERVAEGFALIAEE--RNWKVISADQSIETISNEIKETLLNNFSN  210 (212)
T ss_pred             ---CCCHHCCCHHHHHHHHHHHHHHHCC--CCEEEEECCCCHHHHHHHHHHHHHHHHHC
T ss_conf             ---3431016199999999999998473--98799989999999999999999999734


No 4  
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=395.85  Aligned_cols=207  Identities=41%  Similarity=0.685  Sum_probs=195.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      .+||||||||+||||||||+++|+++|+++|++|++|||||+|++|+.||.+++++. ..++|.++++||+|||++|+.+
T Consensus         1 ~~g~fI~iEGiDGaGKTT~~~~L~~~l~~~g~~v~~trEP~~~~ige~iR~~ll~~~-~~~~~~~e~lLfaadR~~h~~~   79 (208)
T COG0125           1 MKGMFIVIEGIDGAGKTTQAELLKERLEERGIKVVLTREPGGTPIGEKIRELLLNGE-EKLSPKAEALLFAADRAQHLEE   79 (208)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHCCCC-CCCCHHHHHHHHHHHHHHHHHH
T ss_conf             996299997888898899999999999982980799868999869999999973886-6788899999999999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             56554234525872354243100010034442457765444203889841156652034877644321111100000000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDY  161 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~  161 (225)
                      +|.|+|.+|++||||||++||+||||+..+++.+++.+++.++.+.++||+|||||+||+++++|+.+|+..     .|+
T Consensus        80 ~i~pal~~g~vVI~DRy~~Ss~AYQg~~~~~~~~~~~~l~~~~~~~~~PD~ti~Ldv~~e~al~R~~~r~~~-----~~r  154 (208)
T COG0125          80 VIKPALKEGKVVICDRYVDSSLAYQGGGRGLDLDWVLALNEFAPGGLKPDLTLYLDVPPEVALERIRKRGEL-----RDR  154 (208)
T ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHCCCC-----CCH
T ss_conf             978876289999987831378885353059998999999976547899988999948889999999832776-----551


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             21128899999999999999978994999818978899999999999999986
Q gi|254780218|r  162 FERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       162 ~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
                      ||+++..|+++|++.|+++++..|.+|.+|||++++|+|+++|...+.+.+..
T Consensus       155 ~E~~~~~f~~kvr~~Y~~la~~~~~r~~vIda~~~~e~v~~~i~~~l~~~l~~  207 (208)
T COG0125         155 FEKEDDEFLEKVREGYLELAAKFPERIIVIDASRPLEEVHEEILKILKERLGL  207 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC
T ss_conf             56677899999999999998618771899989999799999999999987435


No 5  
>PRK13976 thymidylate kinase; Provisional
Probab=100.00  E-value=0  Score=386.07  Aligned_cols=193  Identities=38%  Similarity=0.669  Sum_probs=175.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHH--CCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997--7981999877889844100110012444541013456777889999977635
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~--~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      |||||||+||||||||+++|+++|++  .+.+++.|||||||++|+.||++|++.  ..++|.+++|||+|||++|+.++
T Consensus         1 mfIvfEGiDGsGKsTq~~~L~~~L~~~~~~~~~~~trEPggt~~ge~IR~~ll~~--~~~~~~te~lLf~A~R~eh~~~~   78 (202)
T PRK13976          1 MFITFEGIDGSGKTTQSRLLAEYLSQIYGENNVVLTREPGGTSFNESVRGLLLST--KNLDKLSELLLFIAMRREHFVKV   78 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHCC--CCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9899989999989999999999998606998689837999982789999997165--57996999999999999999999


Q ss_pred             HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             65542345258723542431000100344424577654442038898411566520348776443211111000000002
Q gi|254780218|r   83 IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYF  162 (225)
Q Consensus        83 I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~  162 (225)
                      |+|+|++|++||||||++||+||||++++++.+++..++.+. ..+.||+|||||+||+++++|..          .|+|
T Consensus        79 I~PaL~~g~~VI~DRy~~St~AYQg~~~gl~~~~i~~l~~~~-~~~~PDlt~~Ldi~~e~al~R~~----------~~~~  147 (202)
T PRK13976         79 ILPALTQGKIVICDRFIDSTIAYQGYGCGIDLKLIRDLNDLV-VDIYPDITFILDIDINQSLSRAD----------KNGY  147 (202)
T ss_pred             HHHHHHCCCEEEECCCCCHHHHHHCCCCCCCHHHHHHHHHHH-CCCCCCEEEEEECCHHHHHHCCC----------CCCH
T ss_conf             888886699899748535578873226798999999999984-07898879998378899975214----------6862


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCEEEE---CCCCCHHHHHHHHHHHHHH
Q ss_conf             11288999999999999999789949998---1897889999999999999
Q gi|254780218|r  163 ERKDVMIHEKRRQIFLDIARNQPDRCHIV---DSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       163 E~~~~~~~~kv~~~y~~la~~~~~~~~~I---Da~~~~eei~~~I~~~i~~  210 (225)
                      |.++.+|++|||++|++|++++|++|++|   ||++++++|++.+.++|.-
T Consensus       148 e~~~~~f~~kVr~~Yl~la~~~~~r~~~I~~ida~~~i~~I~~~~~~ii~~  198 (202)
T PRK13976        148 EFMDLEFYARVRKGFQDIAKKNPHRCHLITCIDATDNINDINSVHLKIIKV  198 (202)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             120599999999999999985998789997035767989999999999999


No 6  
>TIGR00041 DTMP_kinase thymidylate kinase; InterPro: IPR000062   Thymidylate kinase (2.7.4.9 from EC; dTMP kinase) catalyzes the phosphorylation of thymidine 5'-monophosphate (dTMP) to form thymidine 5'-diphosphate (dTDP) in the presence of ATP and magnesium:   ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate    Thymidylate kinase is an ubiquitous enzyme of about 25 Kd and is important in the dTTP synthesis pathway for DNA synthesis. The function of dTMP kinase in eukaryotes comes from the study of a cell cycle mutant, cdc8, in Saccharomyces cerevisiae Saccharomyces cerevisiae. Structural and functional analyses suggest that the cDNA codes for authentic human dTMP kinase. The mRNA levels and enzyme activities corresponded to cell cycle progression and cell growth stages. ; GO: 0004798 thymidylate kinase activity, 0005524 ATP binding, 0006233 dTDP biosynthetic process, 0006235 dTTP biosynthetic process.
Probab=100.00  E-value=0  Score=388.60  Aligned_cols=199  Identities=39%  Similarity=0.626  Sum_probs=185.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCCCCCHHHHC---CCCCCCCCCHHHHHHHHHHHHHH--
Q ss_conf             8868998678887979999999999997-79819998778898441001100---12444541013456777889999--
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHV---LLSCGVDEFGAEAEAIVFAAARL--   76 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~-~g~~v~~~~eP~~t~~ge~ir~~---l~~~~~~~~~~~~~~lLfaadr~--   76 (225)
                      =|||||||||||||||||++.|+++|++ .|+.+++|+|||||++|+.||++   ++.....++.+.++++||||||.  
T Consensus         1 m~~fiviEGiDGaGKTT~~~~l~~~l~~l~g~~~~~t~EPg~t~~ge~IR~~l~D~l~~~~~~~~~~~~alLFaAdR~~H   80 (211)
T TIGR00041         1 MGMFIVIEGIDGAGKTTQLNLLKKLLKELEGYKVLFTREPGGTPIGEKIRELLQDLLNENEEPLTDKTEALLFAADRHDH   80 (211)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             97458885115875899999999997751383478871899987899999999987414666335999999999858999


Q ss_pred             -HHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             -9776356554234525872354243100010034442457765444203889841156652034877644321111100
Q gi|254780218|r   77 -DHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE  155 (225)
Q Consensus        77 -~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~  155 (225)
                       +|+.++|+|+|++|++||||||++||+||||+.++++.+++..||..+....+||+||||||+|++|++|+..|+... 
T Consensus        81 L~~~~~~ik~al~~~~~Vi~DRy~~Ss~AYQg~~~~~d~~~~~~lN~~~~~~~~Pd~t~~Ld~d~e~al~R~~~~g~~~-  159 (211)
T TIGR00041        81 LEHVEEKIKPALAQGKLVISDRYLFSSIAYQGLARGIDIDLVLELNEDALGDMKPDLTILLDIDPEVALERLRKRGEDE-  159 (211)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHCCCCHH-
T ss_conf             9978987788986696799841124357775422568888999997752113586668988607377988752047234-


Q ss_pred             CCHHHHHHHCCHHHHHHHHHHHHHHHHHCC----CCEEEECCCCC-HHHHHHHH
Q ss_conf             000000211288999999999999999789----94999818978-89999999
Q gi|254780218|r  156 SACLDYFERKDVMIHEKRRQIFLDIARNQP----DRCHIVDSAHS-FQSVATNI  204 (225)
Q Consensus       156 ~~~~d~~E~~~~~~~~kv~~~y~~la~~~~----~~~~~IDa~~~-~eei~~~I  204 (225)
                        -.|+++.+..+|+.+||+.|++|++.++    .++++|||+++ +++|++.|
T Consensus       160 --~~~~~~~e~~d~~~~v~~~Yl~L~~~~~rkGD~~~~~~Da~~~~~~~v~~~I  211 (211)
T TIGR00041       160 --LLDREEFEKLDFFEKVRERYLELADKFERKGDKKIVVIDATNSGVEEVEQDI  211 (211)
T ss_pred             --HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHC
T ss_conf             --6655542118999999999999999841468863799866774478898609


No 7  
>PRK07933 thymidylate kinase; Validated
Probab=100.00  E-value=0  Score=383.79  Aligned_cols=203  Identities=21%  Similarity=0.327  Sum_probs=177.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC--CCCCCCCHHHHCCCCCCCC-CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778--8984410011001244454-101345677788999997763
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP--GGTPAAEAARHVLLSCGVD-EFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP--~~t~~ge~ir~~l~~~~~~-~~~~~~~~lLfaadr~~~~~~   81 (225)
                      |||||||+||||||||+++|+++|++.|++|++++||  |+++.|+.+|++|.+...+ ..++.+++|||+|||++|...
T Consensus         1 m~I~fEGiDGsGKSTq~~~L~~~L~~~g~~v~~~reP~~g~~~~g~~ir~~l~~~~~~~~~~~~~~~lLfaadR~~~~~~   80 (213)
T PRK07933          1 MLIAIEGVDGAGKRTLTEALRAALEAAGRSVATLAFPRYGRSVHADLAAEALHGRHGDLADSVYAMATLFALDRAGARDE   80 (213)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98999889999899999999999997799079984689999848999999980887776577799999999999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCC--CCCCHHHHHHHHHH---HCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             5655423452587235424310001003--44424577654442---038898411566520348776443211111000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGER--DSSQHLFLDSLQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~--~~~~~~~i~~l~~~---~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                       |.|+|++|++||||||++||+||||++  .+.....++|+..+   ..+.|+||+|||||+||+++++|+..|+.....
T Consensus        81 -I~paL~~G~~VI~DRy~~Ss~AYQ~a~~~~~~~~~~~~~i~~l~~~~~~~~~PDlti~lDv~~e~a~~R~~~R~~~~~~  159 (213)
T PRK07933         81 -LAGLVAAHDVVILDRYVASNAAYSAARLHQDADGEAVAWVAELEFGRLGLPVPDLQVLLDVPAELAAERARRRAARDAD  159 (213)
T ss_pred             -HHHHHHCCCEEEEECCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHCCCCCCC
T ss_conf             -9999978898998174306898611014687542689999999877507999986889538999999999832456666


Q ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             0000021128899999999999999978-9949998189788999999999999
Q gi|254780218|r  157 ACLDYFERKDVMIHEKRRQIFLDIARNQ-PDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       157 ~~~d~~E~~~~~~~~kv~~~y~~la~~~-~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      ...|+||++ ..||+||+++|+++++.+ |++|++|||++++|+|+++|++.+.
T Consensus       160 ~~~Dr~E~~-~~f~~rVr~~y~~lA~~~~p~R~~vIDa~~~~e~V~~~I~~~l~  212 (213)
T PRK07933        160 RARDAYERD-DGLQQRTGAVYAELAARGWGGPWLVVDPDVDPAALAARLAAALG  212 (213)
T ss_pred             CCCCCHHHH-HHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHC
T ss_conf             421302304-89999999999999972579988998199999999999998748


No 8  
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).
Probab=100.00  E-value=0  Score=359.36  Aligned_cols=199  Identities=42%  Similarity=0.714  Sum_probs=186.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      |||||||+||||||||+++|+++|+++|++|+.++||+++++|+.+|+++.+.....++|.+.++||+|||++|+.++|.
T Consensus         1 m~IviEG~dGsGKsT~~~~L~~~L~~~g~~v~~~~eP~~~~~~~~ir~~l~~~~~~~~~~~~~~lL~~a~R~~~~~~~i~   80 (200)
T cd01672           1 MFIVFEGIDGAGKTTLIELLAERLEARGYEVVLTREPGGTPIGEAIRELLLDPEDEKMDPRAELLLFAADRAQHVEEVIK   80 (200)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98999899899999999999999997799389986999984678999987333545689999999999999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             54234525872354243100010034442457765444203889841156652034877644321111100000000211
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFER  164 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~  164 (225)
                      |+|..|.+||||||++|++|||++..+.+..++.|++.+....|+||+|||||+||+++++|+.+|+..      +.+|.
T Consensus        81 ~~l~~~~~Vi~DRy~~S~~ayq~~~~~~~~~~~~~l~~~~~~~~~PDl~i~Ld~~pe~~~~Ri~~R~~~------~~~e~  154 (200)
T cd01672          81 PALARGKIVLSDRFVDSSLAYQGAGRGLGEALIEALNDLATGGLKPDLTILLDIDPEVGLARIEARGRD------DRDEQ  154 (200)
T ss_pred             HHHHCCCEEEEECCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCCC------CHHHH
T ss_conf             888459989984551128888774069999999999987746999998999817999999999846898------72765


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             288999999999999999789949998189788999999999999
Q gi|254780218|r  165 KDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       165 ~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      ++.+|+++|+++|.++++.++.+|++|||++++|+|+++|++.|.
T Consensus       155 ~~~~~~~kv~~~Y~~~~~~~~~~~~vIDa~~~~eev~~~I~~~i~  199 (200)
T cd01672         155 EGLEFHERVREGYLELAAQEPERIIVIDASQPLEEVLAEILKAIL  199 (200)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHH
T ss_conf             159999999999999997588978998699999999999999971


No 9  
>PRK13975 thymidylate kinase; Provisional
Probab=100.00  E-value=0  Score=351.07  Aligned_cols=188  Identities=30%  Similarity=0.531  Sum_probs=165.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      |+||||||+||||||||+++|+++|+     ++.++|||+|++|+.||++|.+   ..+++.+++|||+|||++|+.+ |
T Consensus         2 ~kfI~fEGiDGsGKsTq~~lL~~~L~-----~~~t~epg~t~~ge~IR~~l~~---~~~~~~~~~LLfaA~R~~~~~~-i   72 (198)
T PRK13975          2 NKFIVFEGIDGSGKTTQAKLLAEKLN-----AKFTFEPTDGKIGKSIREILSG---SECQKETLALLFAADRVEHVSE-I   72 (198)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCC-----CCEEECCCCCCHHHHHHHHHHC---CCCCHHHHHHHHHHHHHHHHHH-H
T ss_conf             98899989988869999999999738-----7488897998447999999826---8998599999999999999999-9


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             55423452587235424310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
                      .|++.++ +||||||++||+||||+ ++++.+++..++.+.   +.||+|||||+||+++++|+.+|..       ++||
T Consensus        73 ~~~l~~~-~VI~DRy~~St~AYQ~~-~g~~~~~i~~l~~~~---~~PDlt~~LDi~~e~~l~R~~~r~~-------~~~e  140 (198)
T PRK13975         73 EEDLKKS-HVVSDRYVYSSIVYQSS-QGIDKDFIYSINDYA---KIPDLVVLLDVDLEEALKRMESREK-------EIFE  140 (198)
T ss_pred             HHHHHCC-CEEEECCCCHHHHHHHH-CCCCHHHHHHHHHCC---CCCCEEEEECCCHHHHHHHHHCCCC-------HHHH
T ss_conf             9998689-88972761239998561-399999999999679---9999899973989999998763573-------1554


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCC------EEEECC-CCCHHHHHHHHHHHHHHHHHH
Q ss_conf             128899999999999999978994------999818-978899999999999999986
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDR------CHIVDS-AHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~------~~~IDa-~~~~eei~~~I~~~i~~~l~k  214 (225)
                        ..+|++|||++|+++++.+|.+      |++||+ ++|+|+||++|++.|.+.|.+
T Consensus       141 --~~~f~~kVr~~yl~la~~~~~r~~~~~~~i~Id~~~ksieeV~~~I~~~i~~~lp~  196 (198)
T PRK13975        141 --KIEIQKKIKEGYYNLINSENEKFMPKYGFIVIDTTSKSIEEVFNEILNAILDKIPD  196 (198)
T ss_pred             --HHHHHHHHHHHHHHHHHHCHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             --29999999999999997482310012571899899999999999999999986310


No 10 
>pfam02223 Thymidylate_kin Thymidylate kinase.
Probab=100.00  E-value=0  Score=347.37  Aligned_cols=186  Identities=41%  Similarity=0.651  Sum_probs=169.5

Q ss_pred             EECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             86788879799999999999977981999877889844100110012444541013456777889999977635655423
Q gi|254780218|r    9 FEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALM   88 (225)
Q Consensus         9 iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p~L~   88 (225)
                      |||+||||||||+++|+++|+++|++|+.++||++|++|+.||+++.+.  ..++|.+++|||+|||++|+.+.|.|+|.
T Consensus         1 ~EGiDGsGKsTq~~~L~~~L~~~g~~v~~~~ep~~~~~g~~ir~~l~~~--~~~~~~~~~llf~adR~~~~~~~i~~~l~   78 (186)
T pfam02223         1 IEGLDGAGKTTQAELLKERLKEQGIKVVLTREPGGTPIGEKIRELLLRN--EELSPLTEALLFAADRIEHLEEKIKPALK   78 (186)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHCC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9799998999999999999998799089974999983799999998501--25899999999999999999999999997


Q ss_pred             CCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHH
Q ss_conf             45258723542431000100344424577654442038898411566520348776443211111000000002112889
Q gi|254780218|r   89 EGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVM  168 (225)
Q Consensus        89 ~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~  168 (225)
                      +|++||||||++|++||||+..+.+.+++..++.. ...|+||+|||||+||+++++|+++|+.      .|++|.++.+
T Consensus        79 ~g~~VI~DRy~~S~~ayq~~~~~~~~~~i~~l~~~-~~~~~PDlti~Ldv~pe~~~~Ri~~R~~------~~~~e~e~~~  151 (186)
T pfam02223        79 QGKTVICDRYLFSSIAYQGAAGGLGLDLVLSLNPD-VPGPKPDLTFLLDVDPEVALKRLRRRGE------LDEFEFEQLD  151 (186)
T ss_pred             CCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHH-CCCCCCCEEEEEECCHHHHHHHHHHCCC------CCHHHHCCHH
T ss_conf             69989960731348998762047789999999872-0678999899983899999999986687------5627651799


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             999999999999997899499981897889999999
Q gi|254780218|r  169 IHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNI  204 (225)
Q Consensus       169 ~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I  204 (225)
                      |+++|+++|.++++. +.+|++|||++++++|+++|
T Consensus       152 ~~~kv~~~Y~~l~~~-~~~~~~IDa~~~i~ev~~~I  186 (186)
T pfam02223       152 FLRKVRERYLELAKD-DERILIIDASNSIEEVHEEI  186 (186)
T ss_pred             HHHHHHHHHHHHHCC-CCCEEEEECCCCHHHHHHHC
T ss_conf             999999999999769-99789987999999997049


No 11 
>KOG3327 consensus
Probab=100.00  E-value=2e-41  Score=267.51  Aligned_cols=199  Identities=24%  Similarity=0.346  Sum_probs=172.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997798199987788-9844100110012444541013456777889999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG-GTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHV   79 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~-~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~   79 (225)
                      |.+|.+||+||+|+||||||+..|...+...+.+.+..+||. .|++|..|-..|.+  ..+++..+.+|||.|+||++.
T Consensus         2 ~~rg~liV~eGlDrsgKstQ~~~l~~~l~~~~~~~~l~~FP~Rst~iGk~i~~YL~k--~~dl~d~~iHLlFSAnRwe~~   79 (208)
T KOG3327           2 MIRGALIVLEGLDRSGKSTQCGKLVESLIPGLDPAELLRFPERSTSIGKLIDGYLRK--KSDLPDHTIHLLFSANRWEHV   79 (208)
T ss_pred             CCCCCEEEEECCCCCCCEEEHHHHHHHHHHCCCHHHHHHCCHHCCCCCHHHHHHHHH--CCCCCHHHHHHHHCCCHHHHH
T ss_conf             987617765321347745206679999870567577661510004411778999874--157737899997605316679


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHH
Q ss_conf             63565542345258723542431000100344424577654442038898411566520348776443211111000000
Q gi|254780218|r   80 ENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACL  159 (225)
Q Consensus        80 ~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~  159 (225)
                      .. |...|.+|..||||||++|+.||..|+ +++   .+|...+-.++|+||+++|||+||+++.+|        .+.+.
T Consensus        80 ~~-i~e~l~kg~~~ivDRY~~SGvAyS~AK-gl~---~dWc~~pd~gL~KPDlvlfL~v~p~~~a~r--------ggfG~  146 (208)
T KOG3327          80 SL-IKEKLAKGTTLIVDRYSFSGVAYSAAK-GLD---LDWCKQPDVGLPKPDLVLFLDVSPEDAARR--------GGFGE  146 (208)
T ss_pred             HH-HHHHHHCCCEEEEECCEECCHHHHHHC-CCC---CCHHHCCCCCCCCCCEEEEEECCHHHHHHH--------CCCCH
T ss_conf             99-999985498299963430104666423-788---623338765898988689973798999874--------47654


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             002112889999999999999997899499981897889999999999999998642
Q gi|254780218|r  160 DYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV  216 (225)
Q Consensus       160 d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~~  216 (225)
                      +|||  ..+||+||...|..+.+.....|+++||+.++|+|+++|+.+++..+....
T Consensus       147 Erye--~v~fqekv~~~~q~l~r~e~~~~~~vDAs~sve~V~~~V~~i~e~~~~~~~  201 (208)
T KOG3327         147 ERYE--TVAFQEKVLVFFQKLLRKEDLNWHVVDASKSVEKVHQQVRSLVENVLSEPI  201 (208)
T ss_pred             HHHH--HHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             6777--789999999999999844588758974672599999999999987305777


No 12 
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.
Probab=99.96  E-value=1.8e-28  Score=190.12  Aligned_cols=174  Identities=21%  Similarity=0.210  Sum_probs=121.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC-CCC-HHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8998678887979999999999997798199987788984-410-01100124445410134567778899999776356
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTP-AAE-AARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~-~ge-~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      +|||||++||||||+++.|++.+   +  +.++.||+++. .+. .+..++.+..  . ...+..++|+++|.++..+ +
T Consensus         1 lI~iEG~iGsGKSTl~~~L~~~~---~--~~~~~Ep~~~~~~~~~~L~~fy~d~~--~-~~~~~Q~~~~~~r~~~~~~-~   71 (193)
T cd01673           1 VIVVEGNIGAGKSTLAKELAEHL---G--YEVVPEPVEPDVEGNPFLEKFYEDPK--R-WAFPFQLYFLLSRLKQYKD-A   71 (193)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH---C--CEEEECCCCCCCCCCHHHHHHHHCCH--H-CCHHHHHHHHHHHHHHHHH-H
T ss_conf             98998888888999999999966---9--94896788888687648999984804--3-1499999999999999999-9


Q ss_pred             HHHHCCCCEEEECCCCCCCEEH------HCCCCCCCHHHHHHH-HHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             5542345258723542431000------100344424577654-442038898411566520348776443211111000
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAY------QGERDSSQHLFLDSL-QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAY------Q~~~~~~~~~~i~~l-~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                      .+++..|.+||+||+++|..+|      ||.........+..+ +.+....++||++||||+||+++++|+++|+...+.
T Consensus        72 ~~~l~~~~~vI~dRs~~sd~~f~~~~~~~g~~~~~e~~~y~~~~~~~~~~~~~PDl~IyLd~~pe~~~~RI~~R~R~~E~  151 (193)
T cd01673          72 LEHLSTGQGVILERSIFSDRVFAEANLKEGGIMKTEYDLYNELFDNLIPELLPPDLVIYLDASPETCLKRIKKRGRPEEQ  151 (193)
T ss_pred             HHHHCCCCEEEEEEEECCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCCHHHC
T ss_conf             86503388399983033549999999982588768999999999998724789987999947789999999962975431


Q ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHHHH---CCCCEEEECCCC
Q ss_conf             000002112889999999999999997---899499981897
Q gi|254780218|r  157 ACLDYFERKDVMIHEKRRQIFLDIARN---QPDRCHIVDSAH  195 (225)
Q Consensus       157 ~~~d~~E~~~~~~~~kv~~~y~~la~~---~~~~~~~IDa~~  195 (225)
                             ..+.+|++++.+.|.+-...   ...++.+||++.
T Consensus       152 -------~i~~~Yl~~l~~~y~~~~~~~~~~~~pvl~iD~~~  186 (193)
T cd01673         152 -------GIPLDYLEDLHEAYEKWFLPQMYEKAPVLIIDANE  186 (193)
T ss_pred             -------CCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             -------79999999999999999987236899889998977


No 13 
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK). Members of this family have been identified as one of the subunits of NADH:Ubiquinone oxioreductase (complex I), a multi-protein complex located in the inner mitochondrial membrane. The main function of the complex is to transport electrons from NADH to ubiquinone, which is accompanied by the translocation of protons from the mitochondrial matrix to the inter membrane space.
Probab=99.86  E-value=2.3e-20  Score=141.77  Aligned_cols=188  Identities=15%  Similarity=0.120  Sum_probs=117.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC------CCCCCH----------HHHCCCCCCCCCCHHHHHHH
Q ss_conf             89986788879799999999999977981999877889------844100----------11001244454101345677
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGG------TPAAEA----------ARHVLLSCGVDEFGAEAEAI   69 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~------t~~ge~----------ir~~l~~~~~~~~~~~~~~l   69 (225)
                      +|+|||.-||||||.++.|++.|   |.+  +..||..      ...|..          +..+..+++.......+...
T Consensus         1 iI~IEGnIG~GKTTl~~~La~~l---~~~--~~~Ep~~~~~~~~~~~~~~~~~~~~~np~L~~FY~dP~~~~~~af~~Q~   75 (219)
T cd02030           1 VITVDGNIASGKGKLAKELAEKL---GMK--YFPEAGIHYLDSTTGDGKPLDPAFNGNCSLEKFYDDPKSNDGNSYRLQS   75 (219)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH---CCC--CCCCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHCHHHCCHHHHHHHH
T ss_conf             98996785679999999999985---982--1035235543002454553331125686499997291111014389999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCC---CCCCCHHHHHHH----HHHHCCCCCCCEEEEEEECHHH
Q ss_conf             788999997763565542345258723542431000100---344424577654----4420388984115665203487
Q gi|254780218|r   70 VFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE---RDSSQHLFLDSL----QEISVQEVMPDCTIILDLPVDI  142 (225)
Q Consensus        70 Lfaadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~---~~~~~~~~i~~l----~~~~~~~~~PDl~i~Ldv~~e~  142 (225)
                      .|...|..+..+.+...+..|..||+||.++|..++.-.   ...+.....+..    .......+.||++|||++||++
T Consensus        76 ~~~~~R~~q~~~~~~~~~~~~~~vv~eRSi~sD~iFa~~~~~~g~l~~~e~~~Y~~~~~~~~~~~~~PdlvIYL~a~pe~  155 (219)
T cd02030          76 WMYSSRLLQYSDALEHLLSTGQGVVLERSPFSDFVFLEAMYKQGYIRKQCVDHYNEVKGNTIPELLPPHLVIYLDVPVPE  155 (219)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHH
T ss_conf             99999999999999887620797556773577599999999768988899999999999974258999989998399999


Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHH----HHCCCCEEEECCC--CCHHHHHHHHHH
Q ss_conf             764432111110000000021128899999999999999----9789949998189--788999999999
Q gi|254780218|r  143 GLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA----RNQPDRCHIVDSA--HSFQSVATNILN  206 (225)
Q Consensus       143 a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la----~~~~~~~~~IDa~--~~~eei~~~I~~  206 (225)
                      +++||++|+...+..       -+.+|++++.+.|.+-.    .++ ..+.++|++  ++.++|.++|..
T Consensus       156 ~~~RI~kRgR~~E~~-------I~~~YL~~L~~~ye~~fl~~~~~~-~~vlv~D~~~~~~~~~v~~~~e~  217 (219)
T cd02030         156 VQKRIKKRGDPHEMK-------VTSAYLQDIENAYKKTFLPEISEH-SEVLQYDWTEAGDTEKVVEDIEY  217 (219)
T ss_pred             HHHHHHHHCCHHHCC-------CCHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCCCHHHHHHHHHH
T ss_conf             999999839475408-------999999999999999999988658-96799876656659999999984


No 14 
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]
Probab=99.70  E-value=1.1e-15  Score=113.97  Aligned_cols=191  Identities=20%  Similarity=0.238  Sum_probs=113.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC-CCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778-89844100110012444541013456777889999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP-GGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHV   79 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP-~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~   79 (225)
                      |+.-|+|||||+-|+||||++++|+++|.   .++..  |+ .+.|+-   ..++ .. ....++... +-|.+.|....
T Consensus         1 ~~~~~~IvI~G~IG~GKSTLa~~La~~l~---~~~~~--E~vednp~L---~~FY-~d-~~~yaf~~Q-iyFL~~Rfk~~   69 (216)
T COG1428           1 MNVAMVIVIEGMIGAGKSTLAQALAEHLG---FKVFY--ELVEDNPFL---DLFY-ED-PERYAFLLQ-IYFLLNRFKKI   69 (216)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEE--ECCCCCHHH---HHHH-HH-HHHHHHHHH-HHHHHHHHHHH
T ss_conf             98660899844644687899999998838---85022--224678479---9998-76-997419999-99999999999


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCE-EHH--C-CCCCCCHHHHH---HHHH----HHCCCC-CCCEEEEEEECHHHHHHHH
Q ss_conf             635655423452587235424310-001--0-03444245776---5444----203889-8411566520348776443
Q gi|254780218|r   80 ENVIRPALMEGKILLCDRFLDSSY-AYQ--G-ERDSSQHLFLD---SLQE----ISVQEV-MPDCTIILDLPVDIGLKRV  147 (225)
Q Consensus        80 ~~~I~p~L~~g~iVI~DRy~~S~l-AYQ--~-~~~~~~~~~i~---~l~~----~~~~~~-~PDl~i~Ldv~~e~a~~Ri  147 (225)
                      ..    ++..+. .|.||.+++-. .+.  - +.+.+.....+   .+.+    .....| +||+.||||++.++.++||
T Consensus        70 k~----~~~~~~-~i~drsI~eD~~lf~~~~~~~g~~~~~e~~~Y~~L~~~~~~~l~~~p~~PdllIyLd~~~e~~l~RI  144 (216)
T COG1428          70 KK----ALSDKN-NILDRSIFEDYFLFAKLNFAKGTLSPSEFKYYDDLYDNMLEELPYLPGRPDLLIYLDASLETLLRRI  144 (216)
T ss_pred             HH----HHCCCC-CCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHH
T ss_conf             99----843155-5458543425788999899847888889999999998799873257899988999827899999999


Q ss_pred             HHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCC-CCEEEECC-----CCCHHHHHHHHHHHHHHHH
Q ss_conf             21111100000000211288999999999999999789-94999818-----9788999999999999999
Q gi|254780218|r  148 QNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP-DRCHIVDS-----AHSFQSVATNILNIVWELV  212 (225)
Q Consensus       148 ~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~-~~~~~IDa-----~~~~eei~~~I~~~i~~~l  212 (225)
                      ..|+..-+....+.    +.++++.+...|.......+ -....||+     ..+++... .+...|.+.+
T Consensus       145 ~~RgR~~E~~~~~~----~~~Y~~~l~~~Y~~~~~~~~~~~~l~i~~~~~D~~~~~~d~~-~v~~~I~~~~  210 (216)
T COG1428         145 AKRGRPFEIDNFDE----NKDYLKDLHRRYDDWFENYDACPVLGIDGDSIDFVNNEQDLE-KVLDQILAKL  210 (216)
T ss_pred             HHHCCCCCCCCCCC----HHHHHHHHHHHHHHHHHHCCCCCEEEECCCEECCCCCHHHHH-HHHHHHHHHH
T ss_conf             98199740246651----689999999999999984555870543250103558989999-9999999998


No 15 
>PRK02496 adk adenylate kinase; Provisional
Probab=99.67  E-value=2.7e-15  Score=111.56  Aligned_cols=172  Identities=22%  Similarity=0.250  Sum_probs=91.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC------CCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9888689986788879799999999999977981999877------8898441001100124445410134567778899
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE------PGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAA   74 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e------P~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaad   74 (225)
                      |+|   |+|-|+.||||+||+++|++.+   |+.++.+-+      -.+|+.|..+++.+-.+.   +-|-....     
T Consensus         1 m~r---iillG~PGSGKgTqa~~L~~~~---~~~his~GdllR~~~~~~s~lg~~i~~~i~~G~---lvpd~iv~-----   66 (185)
T PRK02496          1 MAR---LIFLGPPGAGKGTQAVVLAEHL---QIPHISTGDILRQAITEQTPLGIKAQGYVDSGE---LVPDQLVL-----   66 (185)
T ss_pred             CEE---EEEECCCCCCHHHHHHHHHHHH---CCEEECHHHHHHHHHHCCCHHHHHHHHHHHCCC---CCCCHHHH-----
T ss_conf             918---9997999999899999999996---997788889999998749988999999998799---67728899-----


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHH-HHHH-HHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             99977635655423452587235424310001003444245-7765-444203889841156652034877644321111
Q gi|254780218|r   75 RLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHL-FLDS-LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        75 r~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~-~i~~-l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                        +.+.+.+...-....+ |.|          |+.+...+. .++. +..   ....||++|+|+||.+++.+|+..|+.
T Consensus        67 --~li~~~l~~~~~~~g~-ilD----------GfPR~~~Qa~~l~~~l~~---~~~~~~~vi~l~~~~~~~~~Rl~~R~R  130 (185)
T PRK02496         67 --GLVQERLQQPDAANGW-ILD----------GFPRNVTQAAFLDELLQE---INQSGDRVVNLDVPDDVIVERLLARGR  130 (185)
T ss_pred             --HHHHHHHHCCCCCCCE-EEE----------CCCCCHHHHHHHHHHHHH---CCCCCCEEEEECCCHHHHHHHHHCCCC
T ss_conf             --9999998484533877-886----------898857889999999997---056730333304999999999874676


Q ss_pred             HHHCCHHHHHHHCCHHHHHH---HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             10000000021128899999---9999999999789949998189788999999999999
Q gi|254780218|r  153 LRESACLDYFERKDVMIHEK---RRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       153 ~~~~~~~d~~E~~~~~~~~k---v~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      ..+  ..+.+.+.=..|.+.   +.+.|.    . .+.++.|||++++++|+++|.+.+.
T Consensus       131 ~DD--~~e~i~~Rl~~y~~~t~pvi~~y~----~-~~~~~~Idg~~~ieeV~~~I~~~l~  183 (185)
T PRK02496        131 KDD--TEEVIRRRLEVYREQTAPLIDYYR----D-RQKLLTIDGNQSVEAVTTRLKAALA  183 (185)
T ss_pred             CCC--CHHHHHHHHHHHHHHHHHHHHHHH----H-CCCEEEEECCCCHHHHHHHHHHHHC
T ss_conf             789--889999999999999999999998----4-6978999899998999999999863


No 16 
>PRK00279 adk adenylate kinase; Reviewed
Probab=99.62  E-value=3e-14  Score=105.28  Aligned_cols=176  Identities=16%  Similarity=0.220  Sum_probs=92.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE----C--CCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987----7--88984410011001244454101345677788999997
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR----E--PGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDH   78 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~----e--P~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~   78 (225)
                      |-|+|-|+.||||+||+++|++.+   |+.++.+-    +  -.+|+.|+.+++.+-.+.   +-|-..           
T Consensus         1 m~iillG~PGsGKgTqa~~la~~~---~~~~is~GdllR~~i~~~s~~g~~i~~~~~~G~---lVpd~i-----------   63 (215)
T PRK00279          1 MRLILLGPPGAGKGTQAKFIAEKY---GIPHISTGDMLRAAIKAGTELGKEAKSYMDAGE---LVPDEI-----------   63 (215)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCEEECHHHHHHHHHHCCCHHHHHHHHHHHCCC---CCCHHH-----------
T ss_conf             979998999998799999999986---991786889999998739988999999997798---778899-----------


Q ss_pred             HHHHHHHHHCCC---CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHH-CCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             763565542345---2587235424310001003444245776544420-388984115665203487764432111110
Q gi|254780218|r   79 VENVIRPALMEG---KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS-VQEVMPDCTIILDLPVDIGLKRVQNRYSLR  154 (225)
Q Consensus        79 ~~~~I~p~L~~g---~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~-~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~  154 (225)
                      +.+++...|.+.   .-.|.|          |+.+...+  .+++..+. .....||++|+|+||.+++.+|+..|....
T Consensus        64 ~~~lv~~~l~~~~~~~G~IlD----------GfPRt~~Q--a~~l~~~l~~~~~~i~~Vi~l~v~~~~~~~Rl~~R~~~~  131 (215)
T PRK00279         64 VIGLVKERLAQPDCANGFLLD----------GFPRTIPQ--AEALDEMLKEAGIKLDAVIEIDVPDEELVERLSGRRICP  131 (215)
T ss_pred             HHHHHHHHHHCCCCCCEEEEE----------CCCCCHHH--HHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCCCC
T ss_conf             999999998365655707986----------89998799--999999998649986889999688999999986115675


Q ss_pred             HCC---------------------H-HHHHHHCCHHHHHHHHHHHH----HHHHHC--CCCEEEECCCCCHHHHHHHHHH
Q ss_conf             000---------------------0-00021128899999999999----999978--9949998189788999999999
Q gi|254780218|r  155 ESA---------------------C-LDYFERKDVMIHEKRRQIFL----DIARNQ--PDRCHIVDSAHSFQSVATNILN  206 (225)
Q Consensus       155 ~~~---------------------~-~d~~E~~~~~~~~kv~~~y~----~la~~~--~~~~~~IDa~~~~eei~~~I~~  206 (225)
                      ..+                     . ..|-+-....+.+|. +.|.    .+.+.+  .+.++.|||++++++|+++|.+
T Consensus       132 ~~g~~y~~~~~pp~~~~~~~~~~~~l~~R~DD~~e~i~~Rl-~~y~~~t~pvi~~y~~~~~l~~Idg~~~~~eV~~~I~~  210 (215)
T PRK00279        132 ACGRTYHVKFNPPKVEGKCDVTGEELIQRADDNEETVRKRL-EVYHKQTAPLIDYYKKKGKLKKIDGTGSIDEVFADILK  210 (215)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
T ss_conf             56764554578988666455433202579998699999999-99999888999999817978999898998999999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780218|r  207 IVWE  210 (225)
Q Consensus       207 ~i~~  210 (225)
                      .+.+
T Consensus       211 ~l~~  214 (215)
T PRK00279        211 ALGK  214 (215)
T ss_pred             HHHC
T ss_conf             9844


No 17 
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266   This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic. ; GO: 0005524 ATP binding, 0016776 phosphotransferase activity phosphate group as acceptor, 0019201 nucleotide kinase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=99.50  E-value=1.9e-13  Score=100.55  Aligned_cols=165  Identities=18%  Similarity=0.246  Sum_probs=97.3

Q ss_pred             EECCCCCCHHHHHHHHHHHHHHCCCCEEEEE------CC--CCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8678887979999999999997798199987------78--898441001100124445410134567778899999776
Q gi|254780218|r    9 FEGIEGAGKTTHISLLKRFLQRKNYDVHVTR------EP--GGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         9 iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~------eP--~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      +=|.+||||.|||.++.+.|   +| ||+..      |=  .|+..|++|-.++..++.-+ +.-|--||         +
T Consensus         4 vLGGPGSGKGTQCa~Iv~~f---~~-~HLSAGDLLR~E~~R~GSe~g~lI~~~IkeG~IVP-s~VTv~LL---------~   69 (189)
T TIGR01359         4 VLGGPGSGKGTQCAKIVENF---GY-VHLSAGDLLRAEIKREGSENGELIESYIKEGKIVP-SEVTVELL---------K   69 (189)
T ss_pred             EECCCCCCHHHHHHHHHHHC---CC-EEECHHHHHHHHHHHCCCCCCCHHHHHHHCCCEEH-HEEEHHHH---------H
T ss_conf             63698987567899999853---94-68807478899861047888503774411583111-22324588---------8


Q ss_pred             HHHHHHH-CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHH-CCCCCCCE--EEEEEECHHHHHHHHHHHHH--HH
Q ss_conf             3565542-3452587235424310001003444245776544420-38898411--56652034877644321111--10
Q gi|254780218|r   81 NVIRPAL-MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS-VQEVMPDC--TIILDLPVDIGLKRVQNRYS--LR  154 (225)
Q Consensus        81 ~~I~p~L-~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~-~~~~~PDl--~i~Ldv~~e~a~~Ri~~R~~--~~  154 (225)
                      +-|+..= .+.+.. .|          |..+.  .+..+.-++.. ....-|+.  ++|||||.++..+|+.+|++  .+
T Consensus        70 kai~~~~W~~~~FL-ID----------GFPRN--~eN~~~W~~~~P~~kv~~~~alVlF~dC~e~~m~~R~l~Rg~~SGR  136 (189)
T TIGR01359        70 KAIKEDGWSSKKFL-ID----------GFPRN--EENLEAWEKLMPDNKVNVKFALVLFFDCPEEVMIKRLLKRGQTSGR  136 (189)
T ss_pred             HHHHHCCCCCCCEE-EC----------CCCCC--HHHHHHHHHHCCCCCCCEEEEEEEEEECCCCEEEEEECCCCCCCCC
T ss_conf             77763156788236-62----------57888--8788889861787761202678999867971476443147894786


Q ss_pred             HCCHHHHHHHCCHHHHHHHHHHHHHH----HH--HCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             00000002112889999999999999----99--78994999818978899999999999
Q gi|254780218|r  155 ESACLDYFERKDVMIHEKRRQIFLDI----AR--NQPDRCHIVDSAHSFQSVATNILNIV  208 (225)
Q Consensus       155 ~~~~~d~~E~~~~~~~~kv~~~y~~l----a~--~~~~~~~~IDa~~~~eei~~~I~~~i  208 (225)
                      .++..|-        ++|--+.|.+-    .+  +..+++..|+|++|+|+|.++|.+.+
T Consensus       137 ~DDN~es--------l~KR~~~y~~~t~piIe~f~~~~kv~~i~a~~~ve~Vf~~v~~~f  188 (189)
T TIGR01359       137 VDDNIES--------LKKRFRTYNEETLPIIEYFENKGKVKEINAEGSVEEVFEDVEKIF  188 (189)
T ss_pred             CCCCHHH--------HHHHHHHHHCCCCHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH
T ss_conf             1071778--------888866540168302100002795798279999889999999970


No 18 
>KOG3877 consensus
Probab=99.50  E-value=1e-12  Score=96.20  Aligned_cols=190  Identities=18%  Similarity=0.218  Sum_probs=114.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCH----------------HHHCCCCCCCCCCHH
Q ss_conf             886899867888797999999999999779819998--77889844100----------------110012444541013
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT--REPGGTPAAEA----------------ARHVLLSCGVDEFGA   64 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~--~eP~~t~~ge~----------------ir~~l~~~~~~~~~~   64 (225)
                      +.+.|++||.-|||||+.++.|++.|--..++.+..  ..|+  +.|.-                |+.+..++. ..++.
T Consensus        70 nSkvI~VeGnI~sGK~klAKelAe~Lgf~hfP~~~~d~iyvd--syg~D~r~l~~~~p~~cr~~di~~Fy~dPS-~dlsa  146 (393)
T KOG3877          70 NSKVIVVEGNIGSGKTKLAKELAEQLGFVHFPEFRMDDIYVD--SYGNDLRNLYNKFPARCRLPDISMFYKDPS-GDLSA  146 (393)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEC--CCCCCCHHCCCCCCCCCCCHHHHHHCCCCC-CCHHH
T ss_conf             650799857754670169999999719721564345514303--567644001456896457554898604987-11789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEH------HCCCCCCCHHHHHHHHHH----HCCCCCCCEEE
Q ss_conf             45677788999997763565542345258723542431000------100344424577654442----03889841156
Q gi|254780218|r   65 EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAY------QGERDSSQHLFLDSLQEI----SVQEVMPDCTI  134 (225)
Q Consensus        65 ~~~~lLfaadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAY------Q~~~~~~~~~~i~~l~~~----~~~~~~PDl~i  134 (225)
                      .....+|. .|..+..+.+.--|..|.-|+..|..+|-+++      ||+   +..+..+-.+..    ....+.|.++|
T Consensus       147 ~~Q~r~y~-~R~~QY~dAL~HiL~TGQGVVLERsp~SDFVF~eAM~~qgy---i~~~~~~hYnevr~nti~~ll~PHLVi  222 (393)
T KOG3877         147 AMQDRIYN-CRFDQYLDALAHILNTGQGVVLERSPHSDFVFAEAMRDQGY---IGHEYFKHYNEVRKNTIPQLLWPHLVI  222 (393)
T ss_pred             HHHHHHHH-HHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCC---CHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99999998-67999999999997138737985376425899999876473---015789999999762066525751799


Q ss_pred             EEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHH-HHHCCCCE--EEECCCC--CHHHHHHHHH
Q ss_conf             6520348776443211111000000002112889999999999999-99789949--9981897--8899999999
Q gi|254780218|r  135 ILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI-ARNQPDRC--HIVDSAH--SFQSVATNIL  205 (225)
Q Consensus       135 ~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~l-a~~~~~~~--~~IDa~~--~~eei~~~I~  205 (225)
                      |||+|....+++|+.|+...+-..      .+.++++.+.+.|.+- .++..+.+  ..-|.+.  +.+.|.+.|.
T Consensus       223 Yld~Pv~~v~~~Ik~rg~~~Eik~------~s~aYL~diE~~YK~~fL~e~s~h~eiL~Ydwt~~gdt~~VVEDIE  292 (393)
T KOG3877         223 YLDTPVNKVLENIKRRGNTDEIKT------VSEAYLKDIEESYKDSFLREYSNHSEILAYDWTKPGDTDAVVEDIE  292 (393)
T ss_pred             EECCCCHHHHHHHHHCCCCCCEEE------HHHHHHHHHHHHHHHHHHHHHHHHHHEEEEECCCCCCCHHHHHHHH
T ss_conf             974870899999985399720121------0689999999998887778875011102431356787136777666


No 19 
>TIGR01351 adk adenylate kinases; InterPro: IPR006259    Most members of this family are known or believed to be adenylate kinase.   Adenylate kinase (ADK) 2.7.4.3 from EC converts ATP + AMP to ADP + ADP, that is, it uses ATP as a phosphate donor for AMP. Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). However, some members accept other nucleotide triphosphates as donors, and may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (2.7.4.10 from EC) is Q9UIJ7 from SWISSPROT, a GTP:AMP phosphotransferase that has been identified in bovine heart and human cells  and derived from mitrochondrail GTP AMP that is specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate .This family is designated subfamily rather than equivalog for this reason.   ADK has also been identified in different bacterial species and in yeast . Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge.  ; GO: 0005524 ATP binding, 0016776 phosphotransferase activity phosphate group as acceptor, 0019201 nucleotide kinase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=99.43  E-value=2.6e-12  Score=93.75  Aligned_cols=182  Identities=18%  Similarity=0.229  Sum_probs=101.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE----ECC--CCCCCCCHHHHC-CCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99867888797999999999999779819998----778--898441001100-12444541013456777889999977
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT----REP--GGTPAAEAARHV-LLSCGVDEFGAEAEAIVFAAARLDHV   79 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~----~eP--~~t~~ge~ir~~-l~~~~~~~~~~~~~~lLfaadr~~~~   79 (225)
                      ++|=|+.||||.|||+.|++.+   |+.++.|    |+=  .+|+.|+.+.++ +.+.+.---+..+-.+  ..+|.++.
T Consensus         2 ~~~lGpPGsGKGTQa~~i~~~~---gl~HISTGDllR~~~~~~T~LG~~~k~y~y~~~G~LVPD~~v~~l--v~~rl~~~   76 (232)
T TIGR01351         2 LILLGPPGSGKGTQAKRIAEKL---GLPHISTGDLLRAAVKAGTPLGKKAKEYNYMDKGELVPDEIVNQL--VKERLQQN   76 (232)
T ss_pred             EEEECCCCCCHHHHHHHHHHHC---CCCCCCCHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCHHHHHHH--HHHHHHCC
T ss_conf             4675598987667999999860---885020258999998707977898732672003775778999999--99997456


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCH-HHHHHHHHHHCCCCCCCEEEEEEECH-HHHHHHHHHHH------
Q ss_conf             63565542345258723542431000100344424-57765444203889841156652034-87764432111------
Q gi|254780218|r   80 ENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQH-LFLDSLQEISVQEVMPDCTIILDLPV-DIGLKRVQNRY------  151 (225)
Q Consensus        80 ~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~-~~i~~l~~~~~~~~~PDl~i~Ldv~~-e~a~~Ri~~R~------  151 (225)
                      .+...-.+.+|  .|.|          |+.|++.+ +.++.+..  .....+|.+|+|+||. ++..+|+..|.      
T Consensus        77 ~~~~~~~~~~G--fILD----------GfPRT~~QAeaL~~~l~--~~g~~~d~V~~L~vp~~e~l~~R~~gR~~cp~cG  142 (232)
T TIGR01351        77 PDCVSLKSENG--FILD----------GFPRTLSQAEALDAMLK--ELGLPIDAVIELDVPDLEELVERITGRRICPSCG  142 (232)
T ss_pred             CCCEEEEECCC--EEEC----------CCCCCHHHHHHHHHHHH--HCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCC
T ss_conf             00011010686--2663----------88887899999999998--6189841788853587999999773273306778


Q ss_pred             --------HHHHC---CHHH-----HHHHCCHH----HHHHHHHHHHHHH----HHC--CCCEEE-------ECCCCCHH
Q ss_conf             --------11000---0000-----02112889----9999999999999----978--994999-------81897889
Q gi|254780218|r  152 --------SLRES---ACLD-----YFERKDVM----IHEKRRQIFLDIA----RNQ--PDRCHI-------VDSAHSFQ  198 (225)
Q Consensus       152 --------~~~~~---~~~d-----~~E~~~~~----~~~kv~~~y~~la----~~~--~~~~~~-------IDa~~~~e  198 (225)
                              .+...   ...|     .+-+...+    ..+|. +.|.+-.    +.+  ....+.       |||+++++
T Consensus       143 ~~Yh~~f~pPk~~gG~~~cD~~~~~~l~qR~DD~~evv~~RL-~~Y~~~t~Pli~yY~~~g~l~~f~~~y~~id~~~~~~  221 (232)
T TIGR01351       143 RVYHIKFNPPKVPGGENLCDDCGGELLIQREDDTEEVVKKRL-EVYKEQTEPLIDYYRKKGILVTFEGIYQTIDGNGPID  221 (232)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHH-HHHHHHCCHHHHHHHHCCEEEECCCCEEECCCCCCHH
T ss_conf             556102278867876798864457502770699889999999-9988852008999984691365686322003788888


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254780218|r  199 SVATNILNIV  208 (225)
Q Consensus       199 ei~~~I~~~i  208 (225)
                      +|.++|.+.+
T Consensus       222 ~v~~~~~~~l  231 (232)
T TIGR01351       222 EVWKRILEAL  231 (232)
T ss_pred             HHHHHHHHHH
T ss_conf             8999999972


No 20 
>PRK13808 adenylate kinase; Provisional
Probab=99.42  E-value=1.6e-11  Score=89.02  Aligned_cols=178  Identities=17%  Similarity=0.170  Sum_probs=98.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHH-----HHH
Q ss_conf             689986788879799999999999977981999877889844100110012444541013456777889999-----977
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARL-----DHV   79 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~-----~~~   79 (225)
                      |=|+|=|+.||||+||+..|.+.+   |+.++.|        |+++|..+..+  ..+.......+   ++-     +.+
T Consensus         1 MrIIlLGPPGsGKGTQA~~L~~~~---gi~hIST--------GDmLR~aI~~~--T~LG~kaK~im---~~G~LVPDeIV   64 (297)
T PRK13808          1 MRLILLGPPGAGKGTQAQRLVQQY---GIVQLST--------GDMLRAAVAAG--TPVGLKAKDIM---ASGGLVPDEVV   64 (297)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCEECH--------HHHHHHHHHCC--CHHHHHHHHHH---HCCCCCCHHHH
T ss_conf             959997899998589999999986---9886758--------69999999759--98799999999---76698888999


Q ss_pred             HHHHHHHHCC----CCEEEECCCCCCCEEHHCCCCCCCH-HHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             6356554234----5258723542431000100344424-5776544420388984115665203487764432111110
Q gi|254780218|r   80 ENVIRPALME----GKILLCDRFLDSSYAYQGERDSSQH-LFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR  154 (225)
Q Consensus        80 ~~~I~p~L~~----g~iVI~DRy~~S~lAYQ~~~~~~~~-~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~  154 (225)
                      -++|...|.+    +.+ |.|          |+.+.+.+ +.++.+..  .....-|.+|.|+||.++.++||.+|....
T Consensus        65 i~lI~erL~~~d~~~Gf-ILD----------GFPRTv~QAEaLD~~L~--~~g~~LD~VIel~Vdd~~Lv~RI~~R~~e~  131 (297)
T PRK13808         65 VGIISDRIEQPDAANGF-ILD----------GFPRTVPQAEALDALLK--DKQLKLDAVVELRVNEGALLARVETRVAEM  131 (297)
T ss_pred             HHHHHHHHCCCCCCCCE-EEE----------CCCCCHHHHHHHHHHHH--HCCCCCCEEEEEECCHHHHHHHHHHHHHHH
T ss_conf             99999996685667898-722----------89999899999999998--189997868997678899999999888877


Q ss_pred             HCC-HHHHHHHCCHHHHHHHHHHHHH----HHHH--CCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             000-0000211288999999999999----9997--89949998189788999999999999999
Q gi|254780218|r  155 ESA-CLDYFERKDVMIHEKRRQIFLD----IARN--QPDRCHIVDSAHSFQSVATNILNIVWELV  212 (225)
Q Consensus       155 ~~~-~~d~~E~~~~~~~~kv~~~y~~----la~~--~~~~~~~IDa~~~~eei~~~I~~~i~~~l  212 (225)
                      ... ..-|-+-....|..|. +.|.+    |...  ..+....||++.++|+|..+|-.++..+-
T Consensus       132 ~a~Ge~~R~DDn~E~~~kRL-~~Y~~qT~Pl~~yY~e~~~L~~VDGm~~IDeVt~~I~r~l~a~~  195 (297)
T PRK13808        132 RARGEEVRADDTPEVLAKRL-ASYRAQTEPLVHYYSEKRKLLTVDGMMTIDEVTREIGRVLAAVG  195 (297)
T ss_pred             HHCCCCCCCCCCHHHHHHHH-HHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             61488788899999999999-99998201259998716957862286609999999999999984


No 21 
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=99.39  E-value=2.1e-11  Score=88.29  Aligned_cols=161  Identities=21%  Similarity=0.252  Sum_probs=94.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844100110012444541013456777889999977635655
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP   85 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p   85 (225)
                      ||++.|+.||||||.++.|.+.|++.|..+++..       .+.++..+..     .+...+-.    .|.. ....++.
T Consensus         1 Livl~GlP~SGKSt~a~~L~~~l~~~~~~~i~~~-------~d~~~~~~~~-----~~~~~Ek~----~r~~-~~~~v~~   63 (249)
T TIGR03574         1 LIILTGLPGVGKSTFSKELSKKLSEKNIDNIILG-------TDLIRESFPV-----WKEKYEEF----IRDS-TLYLIKT   63 (249)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEC-------CCCCHHHHHH-----CCHHHHHH----HHHH-HHHHHHH
T ss_conf             9789678999899999999999998299659965-------5200212000-----33677999----8999-9999999


Q ss_pred             HHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHC
Q ss_conf             42345258723542431000100344424577654442038898411566520348776443211111000000002112
Q gi|254780218|r   86 ALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERK  165 (225)
Q Consensus        86 ~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~  165 (225)
                      +|.+..+||+|    |+--|.|++.        .+...+...-.|-.++|+++|++.+.+|...|+..           .
T Consensus        64 ~l~~~~~vI~D----~~nYiKg~RY--------EL~clAk~~~t~~c~I~~~~p~e~c~~~N~~R~~~-----------~  120 (249)
T TIGR03574        64 ALKNKYSVIVD----DTNYYNSKRR--------DLINIAKEYNKNYIIIYLKAPLDTLLRRNIERGEK-----------I  120 (249)
T ss_pred             HHCCCCEEEEC----CCCHHHHHHH--------HHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCCCC-----------C
T ss_conf             84337669972----7327889999--------99999998499869999739999999987606899-----------9


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCE----EEECCC--CCHHHHHHHHHHHH
Q ss_conf             88999999999999999789949----998189--78899999999999
Q gi|254780218|r  166 DVMIHEKRRQIFLDIARNQPDRC----HIVDSA--HSFQSVATNILNIV  208 (225)
Q Consensus       166 ~~~~~~kv~~~y~~la~~~~~~~----~~IDa~--~~~eei~~~I~~~i  208 (225)
                      +.+....+.+.|..--  ..++|    .+|+.+  .+.++|.+.+++..
T Consensus       121 ~~e~i~~m~~r~E~P~--~~nrWdsplf~i~~~~~~~~~~i~~~l~e~~  167 (249)
T TIGR03574       121 PNEVIKDMYEKFDEPG--TKYSWDLPDITIDTTKKIDYNEILEEILEIS  167 (249)
T ss_pred             CHHHHHHHHHHHCCCC--CCCCCCCCCEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9999999999707999--8986557816842898889999999999985


No 22 
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=99.36  E-value=1.3e-11  Score=89.57  Aligned_cols=163  Identities=20%  Similarity=0.261  Sum_probs=81.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE----ECC--CCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99867888797999999999999779819998----778--898441001100124445410134567778899999776
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT----REP--GGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~----~eP--~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |+|-|..||||+||+++|++.+   |+.++.+    |+.  .+|+.|+.++..+..+.   +-|-.           .+.
T Consensus         2 i~l~G~PGsGKgTqa~~La~~~---~~~~is~gdlLR~~~~~~t~~g~~i~~~~~~G~---lvp~~-----------i~~   64 (194)
T cd01428           2 ILLLGPPGSGKGTQAERLAKKY---GLPHISTGDLLREEIASGTELGKKAKEYIDSGK---LVPDE-----------IVI   64 (194)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH---CCEEECHHHHHHHHHHCCCHHHHHHHHHHHCCC---CCCHH-----------HHH
T ss_conf             8998999998799999999997---984676889999999749958999999998799---77899-----------999


Q ss_pred             HHHHHHHCC----CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             356554234----5258723542431000100344424577654442038898411566520348776443211111000
Q gi|254780218|r   81 NVIRPALME----GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        81 ~~I~p~L~~----g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                      +++..++.+    ..+| .|          |+.+...+  .+.+.........|+.+++|++|.+++.+|+..|......
T Consensus        65 ~l~~~~l~~~~~~~g~i-lD----------GfPR~~~Q--a~~l~~~~~~~~~~~~vi~l~~~~~~~~~Rl~~R~~~~~~  131 (194)
T cd01428          65 KLLKERLKKPDCKKGFI-LD----------GFPRTVDQ--AEALDELLDEGIKPDKVIELDVPDEVLIERILGRRICPVS  131 (194)
T ss_pred             HHHHHHHHCCCCCCCEE-EE----------CCCCCHHH--HHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCCCCCC
T ss_conf             99999984765438778-74----------79798999--9999999973998788999966899999999646767766


Q ss_pred             C--------------HHHHHHHCCHHHHHHHHHHHH----HHHHHC--CCCEEEECCCCCHHHH
Q ss_conf             0--------------000021128899999999999----999978--9949998189788999
Q gi|254780218|r  157 A--------------CLDYFERKDVMIHEKRRQIFL----DIARNQ--PDRCHIVDSAHSFQSV  200 (225)
Q Consensus       157 ~--------------~~d~~E~~~~~~~~kv~~~y~----~la~~~--~~~~~~IDa~~~~eei  200 (225)
                      .              ...|.+-......+|.+ .|.    .+.+.+  .+.++.|||++++++|
T Consensus       132 g~~~~~~~~~~~~~~~~~R~DD~~e~i~~Rl~-~y~~~~~pv~~~y~~~~~~~~Id~~~~~eeV  194 (194)
T cd01428         132 GRVYHLGKDDVTGEPLSQRSDDNEETIKKRLE-VYKEQTAPLIDYYKKKGKLVEIDGSGDIDEV  194 (194)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH-HHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             66245566776566667888986999999999-9999988999999827978999799996749


No 23 
>PRK00889 adenylylsulfate kinase; Provisional
Probab=99.36  E-value=1.1e-10  Score=84.04  Aligned_cols=159  Identities=21%  Similarity=0.286  Sum_probs=96.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |+||..|=|.|+.||||||.++.|.+.|.+.|.++++..       |..+|..+-. . ..++.        +||.++..
T Consensus         1 ~~kg~viWltGlsgSGKTTia~~l~~~L~~~~~~~~~LD-------GD~lR~~l~~-~-lgfs~--------~dR~~n~~   63 (175)
T PRK00889          1 MQRGVTVWFTGLSGAGKTTISHALAEKLRARGYPVEVLD-------GDIVRTNLSK-G-LGFSK--------EDRDTNIR   63 (175)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CHHHHHHHCC-C-CCCCH--------HHHHHHHH
T ss_conf             998889998898999999999999999998699679977-------6888875367-8-89898--------99999999


Q ss_pred             HH---HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             35---655423452587235424310001003444245776544420388984115665203487764432111110000
Q gi|254780218|r   81 NV---IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        81 ~~---I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      .+   ..-...+|.+|||.     .++       ...+.-++.....    ..-+-+|+++|.+++.+|=.+        
T Consensus        64 r~~~la~~l~~~g~~vIvs-----~is-------p~~~~R~~~r~~~----~~~~EIyv~~~l~~~~~RD~K--------  119 (175)
T PRK00889         64 RIGFVAHLLTRHGVIVLVS-----AIS-------PYRETREEVRGTI----GNFVEVFVNAPLEVCEQRDVK--------  119 (175)
T ss_pred             HHHHHHHHHHHCCCEEEEE-----ECC-------CCHHHHHHHHHHC----CCCEEEEECCCHHHHHHCCHH--------
T ss_conf             9999999998189868885-----047-------9999999999857----876699842888999880705--------


Q ss_pred             HHHHHHHCCHHHHHHHHHH----HHHHHH--HCC-CCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             0000211288999999999----999999--789-94999818-97889999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQI----FLDIAR--NQP-DRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~----y~~la~--~~~-~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                              +  ++.+.+++    +-.+-.  +.| +.-.+||+ ..++++..++|++.+.+
T Consensus       120 --------g--LY~ka~~g~i~n~~Gid~~yE~P~~pdl~IdT~~~si~~~~~~Ii~~L~~  170 (175)
T PRK00889        120 --------G--LYAKARAGEIKHFTGIDDPYEPPLNPEVECRTDLESLEESVAKVLQKLEE  170 (175)
T ss_pred             --------H--HHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             --------4--77897648778840056899999998069879999999999999999998


No 24 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=99.34  E-value=2e-11  Score=88.48  Aligned_cols=174  Identities=24%  Similarity=0.270  Sum_probs=90.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |.+|+=|++-|+.||||||..+.|++.|   +++++-+..-=-...|..|.+++..        ..+.. |   | +.=.
T Consensus         1 ~~~~~nI~liG~~GsGKTtvgk~LA~~L---~~~fiD~D~~Ie~~~g~si~~if~~--------~Ge~~-F---R-~~E~   64 (175)
T PRK00131          1 MLKGPNIVLIGMMGAGKSTIGRLLAKRL---GYEFIDTDHLIEARAGKSIPEIFEE--------EGEAG-F---R-ELEE   64 (175)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCCCCCCHHHHHHHCCCHHHHHHH--------HCHHH-H---H-HHHH
T ss_conf             9999808988899999899999999995---9690239889997616999999998--------58899-9---9-9999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             35655423452587235424310001003444245776544420388984115665203487764432111110000000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD  160 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d  160 (225)
                      +++...+.....||      |+    |.+.-...+...++.       ....+|||++|+++..+|+.++..+.--...+
T Consensus        65 ~~l~~l~~~~~~VI------st----GGG~v~~~~~~~~L~-------~~g~vV~L~~~~e~l~~Rl~~~~~RPll~~~~  127 (175)
T PRK00131         65 EVLAELLQRHNLVI------ST----GGGAVLREENRALLR-------ERGTVVYLDASFEELLRRLARDRNRPLLQTED  127 (175)
T ss_pred             HHHHHHCCCCCEEE------EC----CCCCCCCHHHHHHHH-------CCCCEEEEECCHHHHHHHHCCCCCCCCCCCCC
T ss_conf             99996514798599------74----898226889999998-------16937998579999999864899998788998


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHHHHHHH
Q ss_conf             021128899999999999999978994999818-978899999999999999986
Q gi|254780218|r  161 YFERKDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       161 ~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~~~l~k  214 (225)
                      ..+.. ..++.+-...|.+.|    +  .+||+ +.++++|.++|.+.+...+++
T Consensus       128 ~~~~l-~~l~~~R~~~Y~~~A----d--~~Idt~~~s~~ei~~~Ii~~L~~~~~~  175 (175)
T PRK00131        128 PKEKL-RALYEERDPLYEEVA----D--LTIETDRRSPEEVVNEILELLELLLRR  175 (175)
T ss_pred             HHHHH-HHHHHHHHHHHHHHC----C--EEEECCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             69999-999999999897538----9--999899999999999999999998529


No 25 
>KOG3079 consensus
Probab=99.33  E-value=5.2e-11  Score=85.96  Aligned_cols=179  Identities=14%  Similarity=0.160  Sum_probs=98.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE----E-CC-C-CCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999779819998----7-78-8-98441001100124445410134567778899
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT----R-EP-G-GTPAAEAARHVLLSCGVDEFGAEAEAIVFAAA   74 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~----~-eP-~-~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaad   74 (225)
                      ++..+|-+-|..||||.||+.++++.+   |+-++..    | |- . ++..|.+|++++.++..-+ ...+..||.   
T Consensus         6 ~~~~IifVlGGPGsgKgTqC~kiv~ky---~ftHlSaGdLLR~E~~~~gse~g~~I~~~i~~G~iVP-~ei~~~LL~---   78 (195)
T KOG3079           6 DKPPIIFVLGGPGSGKGTQCEKIVEKY---GFTHLSAGDLLRAEIASAGSERGALIKEIIKNGDLVP-VEITLSLLE---   78 (195)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHC---CCEEECHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCC-HHHHHHHHH---
T ss_conf             579889997689888226999999976---9546328799999880546767899999998699674-899999999---


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHH-
Q ss_conf             9997763565542345258723542431000100344424577654442038898411566520348776443211111-
Q gi|254780218|r   75 RLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSL-  153 (225)
Q Consensus        75 r~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~-  153 (225)
                            +.+...-.++.+ +.|-          +.+..++  ....++....  .|++++|+||+.++.++|+..|++. 
T Consensus        79 ------~am~~~~~~~~f-LIDG----------yPR~~~q--~~~fe~~i~~--~~~fvl~fdc~ee~~l~Rll~R~q~~  137 (195)
T KOG3079          79 ------EAMRSSGDSNGF-LIDG----------YPRNVDQ--LVEFERKIQG--DPDFVLFFDCPEETMLKRLLHRGQSN  137 (195)
T ss_pred             ------HHHHHCCCCCEE-EECC----------CCCCHHH--HHHHHHHHCC--CCCEEEEEECCHHHHHHHHHHHCCCC
T ss_conf             ------999965778838-8658----------9887688--9999988567--87779998688899999999606657


Q ss_pred             -HHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             -000000002112889999999999999997899499981897889999999999999
Q gi|254780218|r  154 -RESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       154 -~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                       +.....+...+ -..++.+...--.++.+ ..++.+.|||+.++++|..++...+..
T Consensus       138 ~R~DDn~esikk-R~et~~~~t~Pvi~~~e-~kg~l~~i~a~~~~d~Vf~~v~~~id~  193 (195)
T KOG3079         138 SRSDDNEESIKK-RLETYNKSTLPVIEYYE-KKGKLLKINAERSVDDVFEEVVTAIDA  193 (195)
T ss_pred             CCCCCCHHHHHH-HHHHHHHCCHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             878875577999-99999870018999987-359688751779878899999987403


No 26 
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=99.32  E-value=1.3e-11  Score=89.57  Aligned_cols=157  Identities=18%  Similarity=0.244  Sum_probs=92.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCC-----------CCCCCCHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778898441001100124-----------44541013456777889
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS-----------CGVDEFGAEAEAIVFAA   73 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~-----------~~~~~~~~~~~~lLfaa   73 (225)
                      |+|+|-|++||||||.++.|++.|   +++++.         +..||++=-.           ...+.++...       
T Consensus         1 M~I~ISGpPGSGktTvA~~lA~~L---sl~~iS---------aG~iRelA~~~Gldl~E~~~aee~~eIDk~i-------   61 (173)
T TIGR02173         1 MIITISGPPGSGKTTVAKILAEKL---SLKLIS---------AGDIRELAEKMGLDLAESKYAEENPEIDKKI-------   61 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHC---CCCEEC---------CCHHHHHHHHCCCCHHHHHHHCCCCCCCHHH-------
T ss_conf             978873589686478999999863---983120---------2007889864298877734430586311675-------


Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHH
Q ss_conf             99997763565542345258723542431000100344424577654442038898411566520348776443211111
Q gi|254780218|r   74 ARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSL  153 (225)
Q Consensus        74 dr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~  153 (225)
                      ||.+     .+-|..++.+|+ -              +.-.   -|+..  .++-.||+++||++|+++..+||..|.+-
T Consensus        62 D~~~-----~E~A~~~~nvvl-E--------------srla---gW~~~--~nG~yaD~~iyL~A~levRA~RIA~Re~k  116 (173)
T TIGR02173        62 DRRI-----REIAEKEKNVVL-E--------------SRLA---GWILK--KNGEYADVKIYLKAPLEVRARRIAKRENK  116 (173)
T ss_pred             HHHH-----HHHHCCCCCEEE-E--------------EHHH---HHHCC--CCCCCCCEEEEECCCHHHHHHHHHHCCCC
T ss_conf             3788-----554304896688-5--------------2054---33115--78896756788608833324332113688


Q ss_pred             HHCCHHHHHHHCCHHHHHHHHHHHH-HHHHHCCCCE--EEECC-CCCHHHHHHHHHHHH
Q ss_conf             0000000021128899999999999-9999789949--99818-978899999999999
Q gi|254780218|r  154 RESACLDYFERKDVMIHEKRRQIFL-DIARNQPDRC--HIVDS-AHSFQSVATNILNIV  208 (225)
Q Consensus       154 ~~~~~~d~~E~~~~~~~~kv~~~y~-~la~~~~~~~--~~IDa-~~~~eei~~~I~~~i  208 (225)
                      ............+....+|+.+.|- .|   +.-.+  .+||+ +..++.|.+-|...|
T Consensus       117 ~~~~A~~~~~~REe~e~rRy~~iYgIDi---dDlsiYDLvinT~~~~~~~v~~iv~~al  172 (173)
T TIGR02173       117 DLTVALKEIIEREESEKRRYKEIYGIDI---DDLSIYDLVINTSNLDVDEVSDIVLDAL  172 (173)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCC---CCCEEEEEEEECCCCCHHHHHHHHHHHC
T ss_conf             9899999999988762234566525023---4322220033447668126999999860


No 27 
>PRK06217 hypothetical protein; Validated
Probab=99.31  E-value=1.4e-10  Score=83.43  Aligned_cols=158  Identities=19%  Similarity=0.158  Sum_probs=93.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE----CCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997798199987----7889844100110012444541013456777889999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR----EPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARL   76 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~----eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~   76 (225)
                      |+|   |.|-|.-||||||.++.|++.|   |++++.+.    .|+..|+.+.            .++        ++|.
T Consensus         1 m~r---I~i~G~sGsGkSTla~~La~~l---~~~~~~lD~~~W~p~~~pf~~k------------R~~--------~eR~   54 (185)
T PRK06217          1 MMR---IHITGASGSGTTTLGAALAEAL---DLPHLDTDDFFWLPTDPPFTTK------------REP--------EERL   54 (185)
T ss_pred             CCE---EEEECCCCCCHHHHHHHHHHHH---CCCEEECCCCEECCCCCCCCCC------------CCH--------HHHH
T ss_conf             967---9997899887899999999975---9896864555356899975643------------799--------9999


Q ss_pred             HHHHHHHHHHH-CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             97763565542-34525872354243100010034442457765444203889841156652034877644321111100
Q gi|254780218|r   77 DHVENVIRPAL-MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE  155 (225)
Q Consensus        77 ~~~~~~I~p~L-~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~  155 (225)
                      ..    |...+ ....+|++--|           .       .|.+.+   .|.-|+++||++|+++.++|++.|...+.
T Consensus        55 ~l----l~~~~~~~~~WV~sGs~-----------~-------~wgd~l---~p~~DlvVfL~lP~~irl~Rlr~RE~~Ry  109 (185)
T PRK06217         55 RL----LLEDLRDSEGWILSGSL-----------L-------GWGDPL---EPLFDLVVFLYIPPELRLERLRLREEQRY  109 (185)
T ss_pred             HH----HHHHHHCCCCEEEECCC-----------C-------CCCCCC---CCCCCEEEEEECCHHHHHHHHHHHHHHHC
T ss_conf             99----99986379998995775-----------2-------323211---34356899982898999999999999860


Q ss_pred             CC----HHHHHHHCCHHHHHHHHH------------HHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             00----000021128899999999------------99999997899499981897889999999999999
Q gi|254780218|r  156 SA----CLDYFERKDVMIHEKRRQ------------IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       156 ~~----~~d~~E~~~~~~~~kv~~------------~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      +.    +-|.+++ ..+|++-+..            .-.+=.+...-.+..||++.++++..+.|++.+..
T Consensus       110 G~ri~pgGdm~~~-~~~Fl~Wa~~YD~~~~~gRsl~~He~Wl~~~~cPVlrldg~~~~~~~~~~vl~~~~~  179 (185)
T PRK06217        110 GNRILPGGDMHKA-SLEFLEWAAQYDNAGPEGRSLAAHEQWLADQSCPVLRLDGDLTVEERLAQVLAALNS  179 (185)
T ss_pred             CCCCCCCCCHHHH-HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             7866899418888-899999998678898776449999999952898679976989899999999999742


No 28 
>PRK06761 hypothetical protein; Provisional
Probab=99.28  E-value=1.2e-09  Score=77.91  Aligned_cols=202  Identities=19%  Similarity=0.269  Sum_probs=106.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCC-----------------------CCHH-HHCCC
Q ss_conf             988868998678887979999999999997798199987788-9844-----------------------1001-10012
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG-GTPA-----------------------AEAA-RHVLL   55 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~-~t~~-----------------------ge~i-r~~l~   55 (225)
                      |+|  +|.|||+.||||||-+++|.+.|.++|++|...+|-+ +.|.                       .+.+ +..+.
T Consensus         1 m~k--LIiIEGlPGsGKSTta~~l~d~L~~~g~~v~~~~Egd~~hP~D~~~~A~~t~~e~~~ll~~~p~~~e~l~k~~~~   78 (281)
T PRK06761          1 MTK--LIIIEGLPGFGKSTTAHLLNDKLSQLKIEVELFVEGDLNHPADYDWVACFTKFEYDRLLSNYPDFKEVLLKNILK   78 (281)
T ss_pred             CCC--EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHCCCHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             961--799966899980149999999998669853899507899961112221047888999988573188999987663


Q ss_pred             CCC-------------CCCCH---------------HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC-----
Q ss_conf             444-------------54101---------------345677788999997763565542345258723542431-----
Q gi|254780218|r   56 SCG-------------VDEFG---------------AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSS-----  102 (225)
Q Consensus        56 ~~~-------------~~~~~---------------~~~~~lLfaadr~~~~~~~I~p~L~~g~iVI~DRy~~S~-----  102 (225)
                      .+.             ...++               |....--..++||..+.+   .+....++.|+|--+.-+     
T Consensus        79 ~~~y~l~~Y~k~~~~~~~~~~d~L~~~~~k~diY~lp~~~~~~~~~~rWr~Fa~---~a~~~~~v~IFec~l~qnplt~l  155 (281)
T PRK06761         79 KGDYYLLPYRKIKNEFGDQFSDELFNDISRNEIYEVPFDKFVELIADKWKDFAE---IALEDNKVYIFECCLIQNPLNIL  155 (281)
T ss_pred             CCCEEEEEEEECHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH---HCCCCCCEEEEEEEEECCHHHHH
T ss_conf             177044321100010477667377766425256408999999999999999998---40678864999735436818999


Q ss_pred             EEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEC-HHHHHHHHH-HHHHHHHCCHHHH--------------HHHCC
Q ss_conf             0001003444245776544420388984115665203-487764432-1111100000000--------------21128
Q gi|254780218|r  103 YAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLP-VDIGLKRVQ-NRYSLRESACLDY--------------FERKD  166 (225)
Q Consensus       103 lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~-~e~a~~Ri~-~R~~~~~~~~~d~--------------~E~~~  166 (225)
                      +.+.++....-...+..|.....  |.--++|||+.+ ++.+++++. +|+..=..+-.+.              +|. -
T Consensus       156 m~~y~~~~~~i~~Yi~~L~~ii~--~LNP~l~Yl~q~Dv~~~~rka~~ER~~eW~~~~~~y~t~~~Yg~~~~~~G~dG-~  232 (281)
T PRK06761        156 MIKYGAQEEKIINYIMKLAKIIE--NLNPMIFYLEQDNVEFSFRKALKERNPEWSTGIVDYYTNQGYGKEHNHSGVEG-A  232 (281)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHH--CCCCEEEEEECCCHHHHHHHHHHHCCHHHHHHHHHHHHCCCHHHHCCCCCCCH-H
T ss_conf             99859988999999999999972--55968999707788999999998434789988899984372787628888503-8


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             899999999999999978994999818-97889999999999999
Q gi|254780218|r  167 VMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       167 ~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                      +.+++.-++-=+++...-|-.=.+||. ....+.....|.+++..
T Consensus       233 i~~~e~Rk~le~~il~~L~i~k~~I~ns~~~~~~~~~~~~~~~~~  277 (281)
T PRK06761        233 IKVLEARKQLELEILDMLKVKKEKINITKEEIDSYRSMLKDKLTI  277 (281)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             999999989999999708865056577523779999999999999


No 29 
>pfam03976 PPK2 Polyphosphate kinase 2 (PPK2). Inorganic polyphosphate (polyP) plays a role in metabolism and regulation and has been proposed to serve as a energy source in a pre-ATP world. In prokaryotes, the synthesis and utilisation of polyP are catalysed by PPK1, PPK2 and polyphosphatases. Proteins with a single PPK2 domain catalyse polyP-dependent phosphorylation of ADP to ATP, whereas proteins containing 2 fused PPK2 domains phosphorylate AMP to ADP. The structure of PPK2 from Pseudomonas aeruginosa has revealed a a 3-layer alpha/beta/alpha sandwich fold with an alpha-helical lid similar to the structures of microbial thymidylate kinases.
Probab=99.27  E-value=1.8e-10  Score=82.70  Aligned_cols=169  Identities=17%  Similarity=0.143  Sum_probs=101.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      +++.+|+|||.|||||+..++.|.++|.-+|+.|+.+..|+.    +..+           .|.    |   -|   +..
T Consensus        29 ~~~viIv~eG~daaGKg~~I~~l~~~lDPrg~~v~~~~~pt~----eE~~-----------~p~----l---wR---fw~   83 (229)
T pfam03976        29 GKKLVVIFEGRDAAGKGGAIKRITEALNPRGARIVALPAPTE----EERS-----------QWY----F---QR---YVQ   83 (229)
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCH----HHHC-----------CCH----H---HH---HHH
T ss_conf             994899996657787369999998625988569986899997----8847-----------861----9---99---986


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCH-H---HHHHHHHH---HCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             565542345258723542431000100344424-5---77654442---0388984115665203487764432111110
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQH-L---FLDSLQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLR  154 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~-~---~i~~l~~~---~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~  154 (225)
                       -.|  ..|.+.|.||.+|+....+......+. +   .++.++.+   ....=.-=+=|||.++.++-.+|...|....
T Consensus        84 -~lP--~~G~I~iFdrSWY~~~l~~rv~g~~~~~~~~~~~~~I~~FE~~L~~~G~~ivKf~lhIsk~eQ~~Rl~~r~~~p  160 (229)
T pfam03976        84 -HLP--AGGEIVLFDRSWYNRAGVERVMGFCTPKQYERFLREIPEFERMLTDSGIRVVKFWLSISDEEQLERFKERRNDP  160 (229)
T ss_pred             -HCC--CCCEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHHHHCCC
T ss_conf             -377--77818997462556689999834499999999999999999999967945999988549899999999874297


Q ss_pred             HC-CHHHHHHHCCHHHHHHHHHHHHHHHHHC---CCCEEEECCCCCHH
Q ss_conf             00-0000021128899999999999999978---99499981897889
Q gi|254780218|r  155 ES-ACLDYFERKDVMIHEKRRQIFLDIARNQ---PDRCHIVDSAHSFQ  198 (225)
Q Consensus       155 ~~-~~~d~~E~~~~~~~~kv~~~y~~la~~~---~~~~~~IDa~~~~e  198 (225)
                      .. -..+.-+-.....+.++.++|.++.+.-   ...|++|+|+...-
T Consensus       161 ~k~Wk~s~~D~~~~~~~d~y~~a~e~~l~~T~t~~APW~vI~a~dk~~  208 (229)
T pfam03976       161 LKQWKLSPMDLKSREKWDDYTKAKDEMLARTSTPDAPWTVVPADDKKR  208 (229)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHH
T ss_conf             426306778999987699999999999972499999959985898088


No 30 
>PRK05541 adenylylsulfate kinase; Provisional
Probab=99.27  E-value=3.9e-10  Score=80.75  Aligned_cols=159  Identities=18%  Similarity=0.169  Sum_probs=93.0

Q ss_pred             CC-CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             98-88689986788879799999999999977981999877889844100110012444541013456777889999977
Q gi|254780218|r    1 MN-SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHV   79 (225)
Q Consensus         1 M~-~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~   79 (225)
                      |+ +|..|=|.|+.||||||.++.|.+.|.++|.++++..       |..+|+.+-+.   .++.        .||.++.
T Consensus         3 ~~~kg~viW~TGLsGSGKTTiA~~l~~~L~~~g~~~~~LD-------GD~lR~~~~~~---gfs~--------~~R~~n~   64 (176)
T PRK05541          3 MKPNGYVIWITGLAGSGKTTIAKALYERLKLKYSNVIYLD-------GDELREIFGHS---GYDK--------ESRIEMA   64 (176)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CHHHHHHHCCC---CCCH--------HHHHHHH
T ss_conf             7888679997899999899999999999997599779988-------68999873658---9899--------9999999


Q ss_pred             HHH---HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             635---65542345258723542431000100344424577654442038898411566520348776443211111000
Q gi|254780218|r   80 ENV---IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        80 ~~~---I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                      ..+   .+-.-.+|.+|||.     .+       ....+..+|......    --+-+|+++|.+++.+|=.+ +     
T Consensus        65 ~r~~~lak~l~~~g~~vIvs-----~i-------sp~~~~R~~~R~~~~----~~~EVyv~~ple~~~~RD~K-g-----  122 (176)
T PRK05541         65 LKRAKLAAFLADQGMIVIVT-----TI-------SMFNEIYAYNRKHLP----NYFEVYLKCDMEELIRRDQK-G-----  122 (176)
T ss_pred             HHHHHHHHHHHHCCCCEEEE-----EC-------CCCHHHHHHHHHHCC----CCEEEEEECCHHHHHHCCCH-H-----
T ss_conf             99999999986469803675-----22-------798999999997488----76899994899999873854-1-----


Q ss_pred             CHHHHHHHCCHHHHHHHHHH----HHHHHH--HCCC-CEEEECCC-CCHHHHHHHHHHHHHHH
Q ss_conf             00000211288999999999----999999--7899-49998189-78899999999999999
Q gi|254780218|r  157 ACLDYFERKDVMIHEKRRQI----FLDIAR--NQPD-RCHIVDSA-HSFQSVATNILNIVWEL  211 (225)
Q Consensus       157 ~~~d~~E~~~~~~~~kv~~~----y~~la~--~~~~-~~~~IDa~-~~~eei~~~I~~~i~~~  211 (225)
                                  ++.+.+.+    +-.+--  +.|. ..++++.+ .|+++..++|++.+.+.
T Consensus       123 ------------LY~ka~~g~i~n~~Gid~pye~P~~~~~i~~t~~~s~~e~~~~Il~~lk~r  173 (176)
T PRK05541        123 ------------LYTKALKGEISNVVGVDIPFDEPKADLVIDNSCRTSLDEKVDLILNKLKLR  173 (176)
T ss_pred             ------------HHHHHHCCCCCCCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             ------------789987598889610568999989998987999989999999999999970


No 31 
>TIGR01360 aden_kin_iso1 adenylate kinase; InterPro: IPR006267   Members of this family are adenylate kinase, 2.7.4.3 from EC. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (IPR006266 from INTERPRO), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in IPR006259 from INTERPRO.; GO: 0004017 adenylate kinase activity, 0005524 ATP binding, 0046034 ATP metabolic process, 0005737 cytoplasm.
Probab=99.25  E-value=1.6e-10  Score=83.14  Aligned_cols=175  Identities=17%  Similarity=0.182  Sum_probs=100.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHH-----HHHHH-HHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677-----78899-9997
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAI-----VFAAA-RLDH   78 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~l-----Lfaad-r~~~   78 (225)
                      .+|=|=|.+||||.|||.++.+..   |+-+.        +.|+++|+-+.++..  -..+..+.     |-..| =.+.
T Consensus         4 kIiFivGGPGSGKGTQC~KiV~KY---GfTHL--------SsGdLLR~Ev~SgS~--rg~~L~aiMe~G~LVp~~~VL~L   70 (191)
T TIGR01360         4 KIIFIVGGPGSGKGTQCEKIVEKY---GFTHL--------SSGDLLREEVASGSE--RGKQLQAIMESGELVPLDVVLDL   70 (191)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHC---CCCCC--------CHHHHHHHHHCCCCC--HHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             568886588888401368988641---88645--------406788987415781--14789999861885550668999


Q ss_pred             HHHHHHHHHCC-CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             76356554234-52587235424310001003444245776544420388984115665203487764432111110000
Q gi|254780218|r   79 VENVIRPALME-GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        79 ~~~~I~p~L~~-g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      +++-+..++.+ .+==+.|          ||.+...+     =.+|-..+-.|+|++|+||+.++..+|+..|.....-.
T Consensus        71 l~dAm~~~~~~GskGFLID----------GYPRev~Q-----G~eFe~~I~~a~L~Ly~d~s~dTmv~RLL~Ra~~S~vk  135 (191)
T TIGR01360        71 LKDAMLAALGKGSKGFLID----------GYPREVKQ-----GEEFEKRIAPAKLVLYFDCSEDTMVKRLLKRAETSGVK  135 (191)
T ss_pred             HHHHHHHHHCCCCCCCCCC----------CCCCCHHH-----HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             9999998624898631126----------87332011-----24567515996346430004447999999987624799


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHH---HHHHC-C-CCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             0000211288999999999999---99978-9-9499981897889999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLD---IARNQ-P-DRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~---la~~~-~-~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      -.|..|+   ...+|....|..   +...| + .+.+.|||.+++|+|..++.+.|++
T Consensus       136 R~DDn~~---TI~kRL~ty~~~t~pvi~yYe~kg~~~~iNAEG~vddvF~~vv~~lD~  190 (191)
T TIGR01360       136 RVDDNEK---TIKKRLETYYKATEPVIAYYESKGKLLKINAEGTVDDVFLQVVAALDK  190 (191)
T ss_pred             CCCCCHH---HHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             8898878---999999998850288998617887157742778775899999997426


No 32 
>PRK03839 putative kinase; Provisional
Probab=99.23  E-value=4.3e-10  Score=80.52  Aligned_cols=155  Identities=20%  Similarity=0.227  Sum_probs=89.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778898441001100-124445410134567778899999776356
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHV-LLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~-l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      |.|+|.|..|+||||+++.|++.|   |++++.        +++.+.+. +.....+.+.         .|- +.+.+.+
T Consensus         1 M~I~ITGTPGtGKTTva~~La~~l---g~~~i~--------v~~la~~~~~~~~~d~~~~---------iD~-d~l~~~~   59 (180)
T PRK03839          1 MIIAITGTPGVGKTTISKLLAEKL---GYEYVN--------LRDFALEKGIGEEKDDELE---------IDV-DELAYFV   59 (180)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCEEEE--------HHHHHHHCCCCCCCCCCCC---------CCH-HHHHHHH
T ss_conf             989997899999899999999976---987987--------9999998399867677504---------659-9999999


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             55423452587235424310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
                      .+.... ..+|.|-+ .|.+                        +.+|++|.|.++|++..+|.++|+=....    ..|
T Consensus        60 ~~~~~~-~~~ivd~H-~~h~------------------------~p~D~VIVLR~~P~iL~~RL~~RgYs~~K----I~E  109 (180)
T PRK03839         60 EEEFKG-KNVVLDGH-LSHL------------------------MPADLVIVLRAHPKLIAERLKERGYSKKK----IGE  109 (180)
T ss_pred             HHHHCC-CCEEEEEE-CCCC------------------------CCCCEEEEEECCHHHHHHHHHHCCCCHHH----HHH
T ss_conf             987348-98899864-3146------------------------36877999978869999999976999899----999


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHHHHHHH
Q ss_conf             128899999999999999978994999818-978899999999999999986
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~~~l~k  214 (225)
                      +-+.+.+.-+   +.+.... ..++..||+ +++|+++.+.|...+..-.+.
T Consensus       110 NveaEil~vi---l~Ea~e~-~~~~~eidtt~~~pe~v~~~I~~~i~~~~~~  157 (180)
T PRK03839        110 NVEAELVDVI---LIEALEE-HENVIEVDTTNKTPEEVVEEILNLIKSGVKR  157 (180)
T ss_pred             HHHHHHHHHH---HHHHHHH-CCCEEEEECCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             9999999999---9999984-3988999899999999999999999579988


No 33 
>PRK04182 cytidylate kinase; Provisional
Probab=99.23  E-value=4.8e-10  Score=80.19  Aligned_cols=170  Identities=20%  Similarity=0.261  Sum_probs=93.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778898441001100124445--41013456777889999977635
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV--DEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~--~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      |.|+|.|.-||||||.++.|++.|   |++++-+        |+..|.+-...+.  ..+....+. -+..+.  .+...
T Consensus         1 m~ItI~g~~GSGk~tIak~LA~~l---g~~~~d~--------g~i~r~~a~~~g~~~~~~~~~~e~-~~~id~--~~~~~   66 (178)
T PRK04182          1 MRITISGPPGSGKTTVARLLAEKL---GLKLVSA--------GDIFRELARERGMSLEEFNKYAEE-DPEIDK--EIDRR   66 (178)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCEEECH--------HHHHHHHHHHCCCCHHHHHHHHHC-CHHHHH--HHHHH
T ss_conf             989995899888799999999995---9938721--------299999999859999999999851-926899--99999


Q ss_pred             HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             65542345258723542431000100344424577654442038898411566520348776443211111000000002
Q gi|254780218|r   83 IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYF  162 (225)
Q Consensus        83 I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~  162 (225)
                      +...-..|.+||.-|             ..+     |+     -.+.|++-|||.+|+++..+|+..|.+..........
T Consensus        67 ~~~~a~~~~~Vi~GR-------------~~~-----~i-----l~~~~~l~ifl~A~~e~R~~Ri~~r~~~~~~~a~~~i  123 (178)
T PRK04182         67 QLELAKRGNVVLEGR-------------LAG-----WI-----VKNYADLKIYLKAPLEVRAKRIAEREGISVEEALEET  123 (178)
T ss_pred             HHHHHHCCCEEEECC-------------CCC-----EE-----ECCCCCEEEEEECCHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             999985399899838-------------887-----69-----7279877999989999999999973299999999999


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCCC---CE-EEECC-CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             112889999999999999997899---49-99818-9788999999999999999864
Q gi|254780218|r  163 ERKDVMIHEKRRQIFLDIARNQPD---RC-HIVDS-AHSFQSVATNILNIVWELVQKR  215 (225)
Q Consensus       163 E~~~~~~~~kv~~~y~~la~~~~~---~~-~~IDa-~~~~eei~~~I~~~i~~~l~k~  215 (225)
                      ...+.  .  -++.|.......+.   .+ .+||+ ..+++++.+.|.+.|+++|+++
T Consensus       124 ~~rd~--~--~~~r~~~~y~~~~~d~~~ydl~Idts~l~~d~vv~~I~~~i~k~l~~~  177 (178)
T PRK04182        124 IEREE--S--EAKRYLEYYGIDIDDLSIYDLVINTSKWSPEEVFEIILAAIDKLLLAK  177 (178)
T ss_pred             HHHHH--H--HHHHHHHHCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99899--9--999999860899775310748998999999999999999999998447


No 34 
>PRK05480 uridine kinase; Provisional
Probab=99.21  E-value=3.2e-10  Score=81.30  Aligned_cols=198  Identities=17%  Similarity=0.165  Sum_probs=99.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCHHHHCCCCCCCCCC-HHHHHHHHHHHHHHHH
Q ss_conf             9888689986788879799999999999977981999877889-8441001100124445410-1345677788999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGG-TPAAEAARHVLLSCGVDEF-GAEAEAIVFAAARLDH   78 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~-t~~ge~ir~~l~~~~~~~~-~~~~~~lLfaadr~~~   78 (225)
                      |+++++|.|.|.-||||||.++.|++.|...+..++...  +- -+.+..-..--  ... ++ +|.+.      | ++.
T Consensus         3 ~k~P~iIgIaG~SgSGKTT~a~~L~~~l~~~~v~vi~~D--~Yy~~~~~~~~~e~--~~~-nfD~P~a~------d-~~l   70 (209)
T PRK05480          3 MKQPIIIGIAGGSGSGKTTVASTIYEELGDESIAVISQD--SYYKDQSHLSMEER--VKT-NYDHPDAF------D-HDL   70 (209)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECC--CCCCCCCCCCHHHH--CCC-CCCCCHHH------H-HHH
T ss_conf             889889999899977899999999998086875999554--41247340788681--236-87882676------6-999


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCC---HHHHHHHHHHHCCC--CCCCEEEEEEECHHHHHHHHHHHHHH
Q ss_conf             76356554234525872354243100010034442---45776544420388--98411566520348776443211111
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQ---HLFLDSLQEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSL  153 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~---~~~i~~l~~~~~~~--~~PDl~i~Ldv~~e~a~~Ri~~R~~~  153 (225)
                      +.+.+. +|.+|..|-.=.|-+++-........+.   --.++-+.-+....  -.-|+.+|+|+|.++.+.|...|...
T Consensus        71 l~~~L~-~L~~G~~v~~P~Ydf~t~~r~~~~~~i~~~~iiIvEGi~~l~~~~lr~~~DlkIfid~~~d~rl~RRi~RD~~  149 (209)
T PRK05480         71 LIEHLK-ALKAGKAIEIPVYDYTEHTRSKETIHVEPKDVIILEGILLLEDERLRDLMDIKIFVDTPLDIRLIRRLKRDVN  149 (209)
T ss_pred             HHHHHH-HHHCCCCCCCCCCCCCCCCCCCCEEEECCCCEEEEECHHHCCCHHHHHHHCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             999999-9974998756754455665578638966987699934564067878865265799966777899999997899


Q ss_pred             HHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             00000000211288999999999999999789949-99818978899999999999999986
Q gi|254780218|r  154 RESACLDYFERKDVMIHEKRRQIFLDIARNQPDRC-HIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       154 ~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~-~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
                      +.+...+.-   -..|...|+-.|.+........- .+|+....-+.-.+-|.+.|+++|++
T Consensus       150 eRGr~~e~v---i~q~~~~v~p~~~~yI~P~k~~ADlII~~~~~~~va~~~i~~~i~~~l~~  208 (209)
T PRK05480        150 ERGRSLESV---INQYLSTVRPMHLQFIEPSKRYADIIIPEGGKNRVAIDILKAKIRQLLEK  208 (209)
T ss_pred             HHCCCHHHH---HHHHHHHHHHHHHHHCHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             978899999---99999976576997684527424089889996459999999999999842


No 35 
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=99.21  E-value=3.6e-10  Score=80.99  Aligned_cols=155  Identities=21%  Similarity=0.251  Sum_probs=91.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCC-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778898441001100124445410-134567778899999776356
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF-GAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~-~~~~~~lLfaadr~~~~~~~I   83 (225)
                      ++|.+.|..||||||.++.|++.|++++..++...       ....+.++.+...+.. ..+-++.+      +...+.|
T Consensus         2 pLiIlTGyPgsGKTtfakeLak~L~~~i~~vi~l~-------kdy~~~i~~DEslpi~ke~yres~~------ks~~rll   68 (261)
T COG4088           2 PLIILTGYPGSGKTTFAKELAKELRQEIWRVIHLE-------KDYLRGILWDESLPILKEVYRESFL------KSVERLL   68 (261)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCC-------HHHHHHEECCCCCCHHHHHHHHHHH------HHHHHHH
T ss_conf             56998269998801789999999997200112132-------0145412331324037999999998------8899999


Q ss_pred             HHHHCCCCEEEECC-CCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             55423452587235-42431000100344424577654442038898411566520348776443211111000000002
Q gi|254780218|r   84 RPALMEGKILLCDR-FLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYF  162 (225)
Q Consensus        84 ~p~L~~g~iVI~DR-y~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~  162 (225)
                      ..||+ +++||||- .+++++-||-+             -.+...-.|-.+||+.+|++++++|..+|+++-        
T Consensus        69 dSalk-n~~VIvDdtNYyksmRrqL~-------------ceak~~~tt~ciIyl~~plDtc~rrN~ergepi--------  126 (261)
T COG4088          69 DSALK-NYLVIVDDTNYYKSMRRQLA-------------CEAKERKTTWCIIYLRTPLDTCLRRNRERGEPI--------  126 (261)
T ss_pred             HHHHC-CEEEEEECCCHHHHHHHHHH-------------HHHHHCCCCEEEEEECCCHHHHHHHHCCCCCCC--------
T ss_conf             99863-64999706328889999999-------------999863786599997268899988602479999--------


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCC-CC----EEEEC----CCCCHHHH
Q ss_conf             11288999999999999999789-94----99981----89788999
Q gi|254780218|r  163 ERKDVMIHEKRRQIFLDIARNQP-DR----CHIVD----SAHSFQSV  200 (225)
Q Consensus       163 E~~~~~~~~kv~~~y~~la~~~~-~~----~~~ID----a~~~~eei  200 (225)
                         ..+..+++.+.|.+   .++ .+    ..+||    ++..+|.|
T Consensus       127 ---p~Evl~qly~RfEe---Pn~~~rWDspll~id~~d~~t~~IDfi  167 (261)
T COG4088         127 ---PEEVLRQLYDRFEE---PNPDRRWDSPLLVIDDSDVSTEVIDFI  167 (261)
T ss_pred             ---CHHHHHHHHHHHCC---CCCCCCCCCCEEEEECCCCCCCCHHHH
T ss_conf             ---89999999996149---997765567637886355544413678


No 36 
>PRK08356 hypothetical protein; Provisional
Probab=99.18  E-value=4.7e-09  Score=74.33  Aligned_cols=169  Identities=14%  Similarity=0.195  Sum_probs=87.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCC-----------CCCCCHHHHHHH
Q ss_conf             988868998678887979999999999997798199987788984410011001244-----------454101345677
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSC-----------GVDEFGAEAEAI   69 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~-----------~~~~~~~~~~~l   69 (225)
                      |+| |+|.|.|..||||||.++.|    +++|+.++.+..        .+|+.+..+           .....++  +.|
T Consensus         3 ~~k-mIIgitG~~gSGK~tva~~l----~~~G~~~~s~sd--------~lrd~~~~~~~~~~~~~e~~~~~e~tr--e~l   67 (195)
T PRK08356          3 VEK-MIVGIAGKIAAGKTTVAKFL----EELGFCRISCSE--------PLIDILTGNVSDYSWVPEVPFKGEPTR--ENL   67 (195)
T ss_pred             CCE-EEEEEECCCCCCHHHHHHHH----HHCCCEEEECCH--------HHHHHHHCCCCCCCCHHHHHHCCCCCH--HHH
T ss_conf             752-69998589988789999999----986992884227--------899998402320001155551479988--999


Q ss_pred             HHHHH--HHHH----HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHH
Q ss_conf             78899--9997----76356554234525872354243100010034442457765444203889841156652034877
Q gi|254780218|r   70 VFAAA--RLDH----VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIG  143 (225)
Q Consensus        70 Lfaad--r~~~----~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a  143 (225)
                      .-.+.  |.++    +...+.+.+.++..|+.|          |. +  ....++.+.+.      ++.+|..++||+..
T Consensus        68 ~~~~~~LR~~~G~~i~a~~~~~~i~~~~~vVId----------gi-R--~~~Eve~lk~~------~~~lI~V~A~~~~R  128 (195)
T PRK08356         68 IELGRYLKEKYGEDILIRLAVDKLRHCKNIAID----------GV-R--SRGEVEAIKRM------GGKVIYVEAKPEIR  128 (195)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHCCCCEEEE----------CC-C--CHHHHHHHHHC------CCEEEEEECCHHHH
T ss_conf             999999999869258999999997448978994----------89-9--88999999965------99799996778789


Q ss_pred             HHHHHHHHHHHHCC--HHHHHHHCCHHHHHHHHHH-H--HHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             64432111110000--0000211288999999999-9--9999978994999818978899999999999999
Q gi|254780218|r  144 LKRVQNRYSLRESA--CLDYFERKDVMIHEKRRQI-F--LDIARNQPDRCHIVDSAHSFQSVATNILNIVWEL  211 (225)
Q Consensus       144 ~~Ri~~R~~~~~~~--~~d~~E~~~~~~~~kv~~~-y--~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~  211 (225)
                      ++|+..|+...++.  ..+.|-..     ....+. |  ..+.+.- + ++ |..+.+.|+.+++|-+++.++
T Consensus       129 ~eRl~~Rgr~~D~~~~s~e~fl~~-----d~~e~~~~~~~~~i~~A-D-y~-I~N~gtleel~~~i~~il~~i  193 (195)
T PRK08356        129 FERLRRRGAEKDRGIKSLEDLLKF-----DEWEEKLYQTTKLKDKA-D-YV-IVNEGTLEELRKKVEEILREL  193 (195)
T ss_pred             HHHHHHCCCCCCCCCCCHHHHHHH-----HHHHHHHCCHHHHHHHC-C-EE-EECCCCHHHHHHHHHHHHHHH
T ss_conf             999997689888650429999986-----48888604878899879-9-99-982998999999999999983


No 37 
>PRK01184 hypothetical protein; Provisional
Probab=99.18  E-value=2e-09  Score=76.50  Aligned_cols=170  Identities=14%  Similarity=0.205  Sum_probs=90.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH----H
Q ss_conf             689986788879799999999999977981999877889844100110012444541013456777889999977----6
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHV----E   80 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~----~   80 (225)
                      |+|.+.|..||||||.++.    |++.|++++..        |..+|+.+...+. +.++....-+...-|.++-    .
T Consensus         2 ~iIGlTG~iGSGKstva~i----~~e~G~~vi~~--------~Divr~~v~~~g~-~~~~~~~~~~~~~lR~~~G~~~~a   68 (183)
T PRK01184          2 MIIIVTGMPGSGKGEFSKI----ARELGIPVVVM--------GDVIREEVKKRGL-PPTDENIGKVATDLRKELGMDAVA   68 (183)
T ss_pred             EEEEEECCCCCCHHHHHHH----HHHCCCEEEEC--------CHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHCCHHHH
T ss_conf             3999968998878999999----99779939986--------0778999998389-997789999999999871955899


Q ss_pred             HHHHHHHCC--CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC-EEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             356554234--525872354243100010034442457765444203889841-15665203487764432111110000
Q gi|254780218|r   81 NVIRPALME--GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD-CTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        81 ~~I~p~L~~--g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD-l~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      ..+.+.+.+  ..+|+.|-          . +  ....+.++...+     |+ .++..++|+++.++|+.+|+...+..
T Consensus        69 ~~~~~~i~~~~~~~~vidg----------i-r--~~~E~~~~~~~~-----~~~~li~V~A~~~~R~eRl~~R~r~~D~~  130 (183)
T PRK01184         69 IRTVPKIRELGSELVVVDG----------V-R--GDAEVEYFRKEF-----EDFILVAIHAPPETRFERLKKRGRSDDPK  130 (183)
T ss_pred             HHHHHHHHHCCCCEEEEEC----------C-C--CHHHHHHHHHHC-----CCEEEEEEECCHHHHHHHHHHCCCCCCCC
T ss_conf             9999999703798289816----------7-8--789999999746-----98499999898889999998469988966


Q ss_pred             HHHHHHHCCHHHHHHHHHH----HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             0000211288999999999----999999789949998189788999999999999999864
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQI----FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR  215 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~----y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~  215 (225)
                      ..+.       |..+-...    -.+..+ .-+  .+|+.+.+.++..++|.+.+.++++.+
T Consensus       131 s~e~-------f~~rd~~E~~~~i~~~i~-~AD--~vI~N~gsleel~~~v~~~l~~i~~~~  182 (183)
T PRK01184        131 TWEE-------LRERDERELSWGIGEAIA-LAD--YMIVNDCTLEEFKARVRKLLEEILSSR  182 (183)
T ss_pred             CHHH-------HHHHHHHHHCCCHHHHHH-HCC--EEEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             7999-------999999874467778998-799--999879989999999999999997069


No 38 
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=99.18  E-value=4.8e-10  Score=80.23  Aligned_cols=168  Identities=18%  Similarity=0.166  Sum_probs=87.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |++.  |++-|.-||||||..+.|++.|   |++++-+..-=-...|..|.+++...+        +.. |   | +.=.
T Consensus         1 M~~~--I~LiG~mGsGKstiGk~LA~~L---~~~fiD~D~~Ie~~~g~sI~eif~~~G--------e~~-F---R-~~E~   62 (172)
T PRK03731          1 MTQP--LFLVGPRGCGKTTVGMALAQAL---GYRFVDTDLWLQSTLQMTVAEIVEREG--------WAG-F---R-ARES   62 (172)
T ss_pred             CCCC--EEEECCCCCCHHHHHHHHHHHH---CCCEEECCHHHHHHHCCCHHHHHHHHC--------HHH-H---H-HHHH
T ss_conf             9998--8998899998899999999985---999797869999883989999999839--------899-9---9-9999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHH---HHHHHCC
Q ss_conf             3565542345258723542431000100344424577654442038898411566520348776443211---1110000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNR---YSLRESA  157 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R---~~~~~~~  157 (225)
                      +++. .+.....||      |+    |.+.-...+..+.+.+       --.+|||++|+++..+|+...   ..+.--.
T Consensus        63 ~~l~-~l~~~~~VI------st----GGG~v~~~~n~~~L~~-------~g~vv~L~~~~~~l~~Rl~~~~~~~~RPll~  124 (172)
T PRK03731         63 AALE-AVTAPSTVV------AT----GGGIILTEENRAFMRN-------NGIVIYLCAPVSVLANRLEADPEEDQRPTLT  124 (172)
T ss_pred             HHHH-HHCCCCEEE------EE----CCCCCCCHHHHHHHHH-------CCEEEEEECCHHHHHHHHHCCCCCCCCCCCC
T ss_conf             9999-842788289------80----7864268999999996-------8999999799999999981387789898788


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             000021128899999999999999978994999818978899999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWEL  211 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~  211 (225)
                      ..+-.+.- ..++.+-...|.+.+      -++||+++++++|.++|++.+.+-
T Consensus       125 ~~~~~~~i-~~l~~~R~~~Y~~~a------~~ii~~~~~~~~i~~~Il~~L~e~  171 (172)
T PRK03731        125 GKPLSEEV-AEVLAERDALYREVA------HHIIDATQPPSQVVSEILSALAQS  171 (172)
T ss_pred             CCCHHHHH-HHHHHHHHHHHHHHC------CEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99879999-999999999999848------998879899999999999987321


No 39 
>PTZ00088 adenylate kinase 1; Provisional
Probab=99.17  E-value=1.2e-09  Score=77.78  Aligned_cols=118  Identities=23%  Similarity=0.267  Sum_probs=64.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHH----HHHHH--HHH
Q ss_conf             689986788879799999999999977981999877889844100110012444541013456777----88999--997
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIV----FAAAR--LDH   78 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lL----faadr--~~~   78 (225)
                      |-|+|-|+.||||+||++.|++.+   |+.++.+        |+++|+.+..+  ..+......++    +.-|.  .+.
T Consensus         1 M~iillGpPGsGKgT~a~~l~~~~---~~~hiSt--------GdllR~~i~~~--t~lg~~ik~~i~~G~LVpD~iv~~l   67 (225)
T PTZ00088          1 MKIVLFGAPGVGKGTFAEILSKKE---KLKHINM--------GNILRDEIKKE--SNIGKEIHKVVRSGNLVADELIIKI   67 (225)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCEEECH--------HHHHHHHHHCC--CHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             979998999998799999999987---9906878--------99999999739--9889999999977984668999999


Q ss_pred             HHHHHHHHHCCC---CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             763565542345---2587235424310001003444245776544420388984115665203487764432111
Q gi|254780218|r   79 VENVIRPALMEG---KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRY  151 (225)
Q Consensus        79 ~~~~I~p~L~~g---~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~  151 (225)
                      +.+-+.....++   +-.|.|          |+.+.+.+.  +.|..+    ..+|++++|++|.++..+|+..|.
T Consensus        68 v~~~l~~~~~~~~~~~GfILD----------GfPRt~~QA--~~L~~~----~~id~vi~l~v~~~~li~Rl~gRr  127 (225)
T PTZ00088         68 VHDEIAKILAKDGHFKGFILD----------GFPRNLLQC--KELIEI----TNIDLFVNIHLPRHILIKKILGRR  127 (225)
T ss_pred             HHHHHHHHHCCCCCCCCEEEC----------CCCCCHHHH--HHHHHH----CCCCEEEEEECCHHHHHHHHHCCE
T ss_conf             999998444246434743652----------788877999--999974----678879999668999999997063


No 40 
>pfam01712 dNK Deoxynucleoside kinase. This family consists of various deoxynucleoside kinases cytidine EC:2.7.1.74, guanosine EC:2.7.1.113, adenosine EC:2.7.1.76 and thymidine kinase EC:2.7.1.21 (which also phosphorylates deoxyuridine and deoxycytosine.) These enzymes catalyse the production of deoxynucleotide 5'-monophosphate from a deoxynucleoside. Using ATP and yielding ADP in the process.
Probab=99.14  E-value=6e-10  Score=79.64  Aligned_cols=131  Identities=15%  Similarity=0.190  Sum_probs=82.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCE-EHH---CCCCCCCHHHHHHHH----HHHCCCC-CCCEEEEEEEC
Q ss_conf             77889999977635655423452587235424310-001---003444245776544----4203889-84115665203
Q gi|254780218|r   69 IVFAAARLDHVENVIRPALMEGKILLCDRFLDSSY-AYQ---GERDSSQHLFLDSLQ----EISVQEV-MPDCTIILDLP  139 (225)
Q Consensus        69 lLfaadr~~~~~~~I~p~L~~g~iVI~DRy~~S~l-AYQ---~~~~~~~~~~i~~l~----~~~~~~~-~PDl~i~Ldv~  139 (225)
                      +.|.+.|..+..+.     ..+..+|+||.++|.. ++-   .+.+.+.....+...    .+....| .||++|||++|
T Consensus         3 ~~fL~~R~~q~~~~-----~~~~~~i~eRsi~sD~~if~~~l~~~g~l~~~E~~~Y~~~~~~~~~~~~~~pDliIYL~~~   77 (146)
T pfam01712         3 TYFLNSRFKQQLSA-----ARDEVVILERSIYSDRYIFAKNLYDKGTMSDEEYKTYKELYDNMLRQLPKRPDLIIYLKVS   77 (146)
T ss_pred             HHHHHHHHHHHHHH-----HHCCCCEEECCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             99999999999999-----8279825547502129999999998289999999999999999986168999879998388


Q ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHH-HHHHHHHHCC-CCEEEECCCC-CHHHHHHHHHHHHHHH
Q ss_conf             487764432111110000000021128899999999-9999999789-9499981897-8899999999999999
Q gi|254780218|r  140 VDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ-IFLDIARNQP-DRCHIVDSAH-SFQSVATNILNIVWEL  211 (225)
Q Consensus       140 ~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~-~y~~la~~~~-~~~~~IDa~~-~~eei~~~I~~~i~~~  211 (225)
                      |+++++||++|+...+..       -+.+|++++.+ .|......++ .++.+||++. +..+.......++.++
T Consensus        78 ~e~~~~RI~kRgR~~E~~-------I~~~YL~~L~~~~y~~~~~~~~~~pvl~Id~~~~Dfv~n~~d~~~~~~~I  145 (146)
T pfam01712        78 PETCLERIKKRGRTEEKN-------IELDYLELLHSEKYEKWYTKYNASPVLVIDGDKLDFVEDEEDIMNKRNEI  145 (146)
T ss_pred             HHHHHHHHHHHCCHHHCC-------CCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             899999999829575428-------99999999989999999985899988988897678769999999999985


No 41 
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=99.13  E-value=1e-09  Score=78.23  Aligned_cols=168  Identities=23%  Similarity=0.257  Sum_probs=94.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHH---HHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677---788999997763
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAI---VFAAARLDHVEN   81 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~l---Lfaadr~~~~~~   81 (225)
                      |.|+|-|+.||||||.++.|++.+   |++++..    |+.+-+..++.=++  ...++.+++.=   =..-||.++   
T Consensus         1 m~ItIsG~pGsG~TTva~~lAe~~---gl~~vsa----G~iFR~~A~e~gms--l~ef~~~AE~~p~iD~~iD~rq~---   68 (179)
T COG1102           1 MVITISGLPGSGKTTVARELAEHL---GLKLVSA----GTIFREMARERGMS--LEEFSRYAEEDPEIDKEIDRRQK---   68 (179)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHH---CCCEEEC----CHHHHHHHHHCCCC--HHHHHHHHHCCCHHHHHHHHHHH---
T ss_conf             979961799997027999999982---9715621----27999999983999--99999987519216699889999---


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             56554234525872354243100010034442457765444203889841156652034877644321111100000000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDY  161 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~  161 (225)
                        .-+. +|.+|+-     |-+|             -|+..     ..+|+.+||.+|.++..+|+..|.+.........
T Consensus        69 --e~a~-~~nvVle-----grLA-------------~Wi~k-----~~adlkI~L~Apl~vRa~Ria~REgi~~~~a~~~  122 (179)
T COG1102          69 --ELAK-EGNVVLE-----GRLA-------------GWIVR-----EYADLKIWLKAPLEVRAERIAKREGIDVDEALAE  122 (179)
T ss_pred             --HHHH-CCCEEEH-----HHHH-------------HHHHC-----CCCCEEEEEECCHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             --9987-2895870-----0457-------------88733-----5654688885759999999998608989999999


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCE----EEECC-CCCHHHHHHHHHHHHHHHHHH
Q ss_conf             211288999999999999999789949----99818-978899999999999999986
Q gi|254780218|r  162 FERKDVMIHEKRRQIFLDIARNQPDRC----HIVDS-AHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       162 ~E~~~~~~~~kv~~~y~~la~~~~~~~----~~IDa-~~~~eei~~~I~~~i~~~l~k  214 (225)
                      ....+..-.+    .|+++..-..+.+    .+||+ .-++++|...|...+.....+
T Consensus       123 ~~~RE~se~k----RY~~~YgIDidDlSiyDLVinTs~~~~~~v~~il~~aid~~~~~  176 (179)
T COG1102         123 TVEREESEKK----RYKKIYGIDIDDLSIYDLVINTSKWDPEEVFLILLDAIDALSIK  176 (179)
T ss_pred             HHHHHHHHHH----HHHHHHCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             9998899999----99998587876663677887536678889999999998742134


No 42 
>PRK03846 adenylylsulfate kinase; Provisional
Probab=99.13  E-value=6.7e-09  Score=73.38  Aligned_cols=160  Identities=19%  Similarity=0.262  Sum_probs=91.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      ++|+.|=|.|+.||||||.++.|.+.|.+.|+++++..       |..+|..|-. . ..++.        .||.++...
T Consensus        22 ~kg~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LD-------GD~lR~~l~~-d-lgfs~--------~dR~~n~~r   84 (198)
T PRK03846         22 HKGVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLLD-------GDNVRHGLCS-D-LGFSD--------ADRKENIRR   84 (198)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------HHHHHHHHCC-C-CCCCH--------HHHHHHHHH
T ss_conf             99869998799999889999999999997599759977-------7999874366-7-89899--------999999999


Q ss_pred             H---HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             5---6554234525872354243100010034442457765444203889841156652034877644321111100000
Q gi|254780218|r   82 V---IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        82 ~---I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
                      +   ..-..++|.+|||.     .++       ...+.-++..+...  ...-+-+|+++|.+++.+|=.+.        
T Consensus        85 ~~~lak~l~~~G~iVIvs-----~Is-------p~~~~R~~~R~~~~--~~~f~EIyl~~~le~c~~RD~Kg--------  142 (198)
T PRK03846         85 VGEVAKLMVDAGLVVLTA-----FIS-------PHRAERQMVRERLG--EGEFIEVFVDTPLAICEARDPKG--------  142 (198)
T ss_pred             HHHHHHHHHHCCCEEEEC-----CCC-------CCHHHHHHHHHHCC--CCCEEEEEECCCHHHHHHCCCHH--------
T ss_conf             999999998589836641-----478-------87999999998678--77579999438899998738165--------


Q ss_pred             HHHHHHCCHHHHHHHHH----HHHHHH--HHCC-CCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             00021128899999999----999999--9789-94999818-97889999999999999
Q gi|254780218|r  159 LDYFERKDVMIHEKRRQ----IFLDIA--RNQP-DRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       159 ~d~~E~~~~~~~~kv~~----~y~~la--~~~~-~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                                ++.+.+.    .|-.+-  =+.| +.-.+||+ ..++++...+|++.+.+
T Consensus       143 ----------LY~ka~~gei~n~~Gvd~pyE~P~~pdl~Idt~~~si~~~~~~I~~~l~~  192 (198)
T PRK03846        143 ----------LYKKARAGEIKNFTGIDSPYEAPESPEIHLDTGEQLVTNLVEQLLDYLRQ  192 (198)
T ss_pred             ----------HHHHHHCCCCCCCEECCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             ----------78898658888840078899999998069869999999999999999998


No 43 
>pfam08433 KTI12 Chromatin associated protein KTI12. This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II. The Elongator complex has histone acetyltransferase activity.
Probab=99.13  E-value=3.6e-09  Score=75.02  Aligned_cols=120  Identities=23%  Similarity=0.310  Sum_probs=77.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844100110012444541013456777889999977635655
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP   85 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p   85 (225)
                      ||++.|..+|||||-++.|+++|+++|++|+++.+-  + .+- -+..+.       +...|-.    .|...... +..
T Consensus         1 Livl~G~P~SGKSt~A~~L~~~l~~~~~~v~vi~d~--~-~~~-~~~~y~-------~s~~Ek~----~R~~l~s~-v~r   64 (266)
T pfam08433         1 LIILTGLPSSGKSTRAKELAKYLEEKGYDVIVISDE--S-LGI-ESDDYK-------DSKKEKF----LRGSLRSA-VKR   64 (266)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCC--C-CCC-CCCCCC-------CCHHHHH----HHHHHHHH-HHH
T ss_conf             979857999968899999999999759938997800--1-267-531000-------1047899----99999999-987


Q ss_pred             HHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHH
Q ss_conf             42345258723542431000100344424577654442038898411566520348776443211111
Q gi|254780218|r   86 ALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSL  153 (225)
Q Consensus        86 ~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~  153 (225)
                      +|.++.+||+|-    .--|.|++        ..|.-.+...-.|-.++|+++|++.+.+|...|+..
T Consensus        65 ~Ls~~~iVIlD~----~NYiKG~R--------YEL~C~Ak~~~t~~c~v~~~~p~e~~~~~N~~r~~~  120 (266)
T pfam08433        65 DLSKNTIVIVDS----LNYIKGFR--------YELYCIAKEAKTTYCVVYCKAPLDTCLKWNEERGEP  120 (266)
T ss_pred             HHCCCCEEEECC----CCCHHHHH--------HHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCCCC
T ss_conf             516688899548----74045689--------999999986388848999689989999862147777


No 44 
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=99.10  E-value=1.2e-08  Score=71.86  Aligned_cols=170  Identities=22%  Similarity=0.201  Sum_probs=87.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |+..+=|++=|..||||||..+.|++.|   +++++-+..-=-...|..|.+++.        ...+.. |   | +.=.
T Consensus         1 M~~kknI~LiG~mGsGKstvgk~LA~~l---~~~fiD~D~~Ie~~~g~si~~If~--------~~Ge~~-F---R-~~E~   64 (172)
T PRK05057          1 MAEKRNIFLVGPMGAGKSTIGRQLAQQL---NMEFYDSDQEIEKRTGADIGWVFD--------VEGEEG-F---R-DREE   64 (172)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCHHHHHH--------HHHHHH-H---H-HHHH
T ss_conf             9988828988999998899999999996---999687809999997989999999--------974999-9---9-9999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             35655423452587235424310001003444245776544420388984115665203487764432111110000000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD  160 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d  160 (225)
                      +++........+||      |+    |.+.-...+....+..       --.+|||++|+++..+|+.....+.--...+
T Consensus        65 ~~l~~l~~~~~~VI------st----GGG~v~~~~~~~~L~~-------~g~vv~L~~~~~~~~~R~~~~~~RPll~~~~  127 (172)
T PRK05057         65 KVINELTEKQGIVL------AT----GGGSVKSRETRNRLSA-------RGVVVYLETTIEKQLARTQRDKKRPLLQVDD  127 (172)
T ss_pred             HHHHHHHCCCCEEE------EC----CCCCCCCHHHHHHHHH-------CCEEEEEECCHHHHHHHHCCCCCCCCCCCCC
T ss_conf             99998854799799------78----9853588999999996-------6958999599899999805899999798998


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             021128899999999999999978994999818-97889999999999999
Q gi|254780218|r  161 YFERKDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       161 ~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                      ..+. -..++..-+..|.++|.      ++||+ +.++++|.++|.+.+.+
T Consensus       128 ~~~~-~~~l~~~R~~~Y~~~Ad------~~I~td~~~~~~i~~~Ii~~L~~  171 (172)
T PRK05057        128 PREV-LEALANERNPLYEEIAD------VTVRTDDQSAKVVANQIIHMLES  171 (172)
T ss_pred             HHHH-HHHHHHHHHHHHHHHCC------EEEECCCCCHHHHHHHHHHHHHC
T ss_conf             7999-99999999999998699------99989999999999999999960


No 45 
>PRK06696 uridine kinase; Validated
Probab=99.09  E-value=2.3e-09  Score=76.11  Aligned_cols=177  Identities=17%  Similarity=0.149  Sum_probs=83.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999977981999877889844100110012444541013456777889999977635
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      +..+|+|.|++||||||.++.|++.|.+.|.+|++++- ++.-.....|...  +....-..+...+    |......++
T Consensus        25 rpl~VgIdG~~gSGKTTlA~~La~~L~~~G~~V~~v~~-Ddf~~~~~~r~~~--g~~~~~~~~~d~~----D~~~l~~~l   97 (227)
T PRK06696         25 RPLRVAIDGITASGKTTFANELAEEIKKRGRPVIRASI-DDFHNPKVIRYRR--GRESARGYYEDAY----DYTAFRELL   97 (227)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECC-CCCCCCHHHHHHH--CCCCCCCCCCCCC----CHHHHHHHH
T ss_conf             86899977899878799999999999746994899715-4434737777651--6677443475410----589999999


Q ss_pred             HHHHHCCC--CEE--EECCCCCCCEEH---HCCCCC---CCHHHH--HHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHH
Q ss_conf             65542345--258--723542431000---100344---424577--654442038898411566520348776443211
Q gi|254780218|r   83 IRPALMEG--KIL--LCDRFLDSSYAY---QGERDS---SQHLFL--DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNR  150 (225)
Q Consensus        83 I~p~L~~g--~iV--I~DRy~~S~lAY---Q~~~~~---~~~~~i--~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R  150 (225)
                      +.|.-..|  .+.  ..|+-.......   +.....   +...++  .++..      .=|+.+|||+|++++++|...|
T Consensus        98 l~pL~~~~~~~~~~~~~D~~td~~~~~~~~~~p~~~VlIveG~~ll~~elr~------~~D~~v~ld~~~~~~~~R~~~R  171 (227)
T PRK06696         98 LKPLGPNGDRQYRTASHDLKTDIPVHNEPLMAAPNAVLIVDGTFLLRKELRD------LWDYKIFLDTDFEESRRRGAKR  171 (227)
T ss_pred             HHHHCCCCCCEEEECCCCCCCCCCCCCCCEECCCCCEEEEECHHHCCHHHHH------CCCEEEEEECCHHHHHHHHHHH
T ss_conf             8663158980584112463357545687164699808999255646655773------0748999979999998876653


Q ss_pred             HHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHH-CCCC--EEEECCCCC
Q ss_conf             111000000002112889999999999999997-8994--999818978
Q gi|254780218|r  151 YSLRESACLDYFERKDVMIHEKRRQIFLDIARN-QPDR--CHIVDSAHS  196 (225)
Q Consensus       151 ~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~-~~~~--~~~IDa~~~  196 (225)
                      .....+...+    ....|+.++.-++....++ .|..  =++||++.+
T Consensus       172 d~~~~g~~~~----~~~~~~~ry~pa~~~Y~~~~~P~~~Advvv~n~d~  216 (227)
T PRK06696        172 DTEAFGSYEE----AEKMYLERYHPACKLYIDEHNPKECADVVFDNSDP  216 (227)
T ss_pred             HHHHHCCCHH----HHHHHHHHHHHHHHHHHCCCCHHHHCEEEEECCCC
T ss_conf             2544168378----99999987638999986416837838599979998


No 46 
>PRK13946 shikimate kinase; Provisional
Probab=99.08  E-value=2.8e-09  Score=75.67  Aligned_cols=171  Identities=19%  Similarity=0.208  Sum_probs=89.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      ++=|++=|.-||||||..+.|++.|   +++++-+..-=-...|..|.+++-.        ..+.. |   | +.=.+++
T Consensus        20 kknIvLIG~mGsGKStvGk~LA~~L---~~~fiD~D~~IE~~~g~sI~eIF~~--------~GE~~-F---R-~~E~~~l   83 (195)
T PRK13946         20 KRTVVLVGLMGAGKSTVGRRLATML---GLPFLDADTEIERAARMTIPEIFAT--------YGEPE-F---R-DLERRVI   83 (195)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCHHHHHHH--------HCHHH-H---H-HHHHHHH
T ss_conf             9958998999998899999999997---9798988599999809989999998--------69799-9---9-9899999


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             55423452587235424310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
                      ...+..+..||+=          |.+.-...+..+.+.+       .-.+|||++|+++..+|+.....+.--...|..+
T Consensus        84 ~~l~~~~~~VIst----------GGG~v~~~~n~~~L~~-------~g~vI~L~~~~e~l~~Rl~~~~~RPLl~~~~~~~  146 (195)
T PRK13946         84 ARLLKGGPLVLAT----------GGGAFMNEETRAAIRE-------KGISVWLKADLDVLWERVSRRDTRPLLRTADPKE  146 (195)
T ss_pred             HHHHCCCCEEEEC----------CCCCCCCHHHHHHHHH-------CCEEEEEECCHHHHHHHHCCCCCCCCCCCCCHHH
T ss_conf             9986489879975----------8742368999999995-------7968998499999999972899999899988799


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCEEEEC-CCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             12889999999999999997899499981-89788999999999999999864
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDRCHIVD-SAHSFQSVATNILNIVWELVQKR  215 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~~~~ID-a~~~~eei~~~I~~~i~~~l~k~  215 (225)
                      ... .+++.-...|.+ |    +  .+|| .+.++++|.++|++.+...++-.
T Consensus       147 ~l~-~l~~~R~~lY~~-A----d--~~I~t~~~s~~~ia~eIi~~L~~~~~~~  191 (195)
T PRK13946        147 TLA-RLMEERYPVYAQ-A----D--LTVESRDVPHEVIADEVIEALAAYLEVE  191 (195)
T ss_pred             HHH-HHHHHHHHHHHH-C----C--EEEECCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             999-999999999997-8----9--8988998999999999999999998566


No 47 
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=99.07  E-value=4.9e-09  Score=74.17  Aligned_cols=168  Identities=19%  Similarity=0.194  Sum_probs=93.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC----C--CCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             689986788879799999999999977981999877----8--8984410011001244454101345677788999997
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE----P--GGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDH   78 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e----P--~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~   78 (225)
                      |-|+|=|..|||||||++.|++.   .++.++-+-.    .  ..++.|+.++.++..+.   +-|-...       ...
T Consensus         1 ~riiilG~pGaGK~T~A~~La~~---~~i~hlstgd~~r~~~~~~t~lg~~~k~~i~~g~---lv~d~i~-------~~~   67 (178)
T COG0563           1 MRILILGPPGAGKSTLAKKLAKK---LGLPHLDTGDILRAAIAERTELGEEIKKYIDKGE---LVPDEIV-------NGL   67 (178)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHH---CCCCEECCCCCCCHHHCCCCHHHHHHHHHHHCCC---CCCHHHH-------HHH
T ss_conf             97999899999889999999997---6997855220111100323689999999987589---5041769-------979


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCC-CCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             763565542345258723542431000100344424577654442038-8984115665203487764432111110000
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQ-EVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~-~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      +..-+..+ +....+|.|.|-          +.+...  ..+.+.... ..++|.++.++++.+..+.|+..|..+..  
T Consensus        68 v~~rl~~~-d~~~~~I~dg~P----------R~~~qa--~~l~r~l~~~g~~~d~v~~~~~~~~~~~~r~~~r~~r~d--  132 (178)
T COG0563          68 VKERLDEA-DCKAGFILDGFP----------RTLCQA--RALKRLLKELGVRLDMVIELDVPEELLLERLLGRRVRED--  132 (178)
T ss_pred             HHHHHHHC-CCCCEEEEECCC----------CHHHHH--HHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHCCCCCCC--
T ss_conf             99999750-657729998998----------369999--999999986399855260244778999999736654334--


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHCCCCE--EEECCCCCHHHHHHHHHHHH
Q ss_conf             0000211288999999999999999789949--99818978899999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDIARNQPDRC--HIVDSAHSFQSVATNILNIV  208 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~--~~IDa~~~~eei~~~I~~~i  208 (225)
                        |     ..+...+....|.+....--. +  +.||+.++++++.+.|.+.+
T Consensus       133 --d-----~~~~~~~R~~~y~~~~~pl~~-~y~~~id~~~~i~~v~~~i~~~l  177 (178)
T COG0563         133 --D-----NEETVKKRLKVYHEQTAPLIE-YYSVTIDGSGEIEEVLADILKAL  177 (178)
T ss_pred             --C-----CHHHHHHHHHHHHHCCCCEEE-EEEECCCCCCCHHHHHHHHHHHH
T ss_conf             --6-----789999999998754683477-77511467788999999999864


No 48 
>PRK08233 hypothetical protein; Provisional
Probab=99.06  E-value=2.7e-08  Score=69.77  Aligned_cols=169  Identities=18%  Similarity=0.253  Sum_probs=90.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999779819998778898441-001100124445410134567778899999776
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAA-EAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~g-e~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      +|+.+|.|-|.-||||||.++.|.+.|...  .+..... ...... +.....+. .. .+++.. ..-++    .+++.
T Consensus         1 kkp~IIgIaGgSgSGKTtla~~l~~~l~~~--~~~~~D~-y~~~~~~~~~~~~~~-~~-~~~d~~-d~~~l----~~~l~   70 (182)
T PRK08233          1 KKTKIITIAAVSGGGKTTLTERLTHKLKNS--KALYFDR-YDFDNCPEDICKWID-DG-ANYSEW-VLTPL----IKDIQ   70 (182)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCC--EEEEECC-CCCCCCHHHHHHHHC-CC-CCCCHH-HHHHH----HHHHH
T ss_conf             998899996888678999999999974677--5899666-555468788998740-67-786666-69999----99999


Q ss_pred             HHHHHHHCCC---CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH-C
Q ss_conf             3565542345---25872354243100010034442457765444203889841156652034877644321111100-0
Q gi|254780218|r   81 NVIRPALMEG---KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE-S  156 (225)
Q Consensus        81 ~~I~p~L~~g---~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~-~  156 (225)
                      +     |.+|   .+||.|--    ++|       -.   ..+.++      =|+.+|+|+|.++++.|...|.-.+. +
T Consensus        71 ~-----l~~~~~~d~iIvEgi----l~l-------~~---~~lr~l------~D~kIfVdtp~Dirl~RRi~RDi~Er~g  125 (182)
T PRK08233         71 E-----LIAKSNVDYIIVDYP----FAY-------LN---SEMRQY------IDVTIFIDTPLDIAMARRILRDFKEDTG  125 (182)
T ss_pred             H-----HHCCCCCCEEEEEEE----HHH-------CC---HHHHHH------HCEEEEECCCHHHHHHHHHHHHHHHHCC
T ss_conf             9-----855998728999644----362-------68---989977------1878997286899999988888777618


Q ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             00000211288999999999999999---7899499981897889999999999999
Q gi|254780218|r  157 ACLDYFERKDVMIHEKRRQIFLDIAR---NQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       157 ~~~d~~E~~~~~~~~kv~~~y~~la~---~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      ..   .|+--..|.+.|+-.|.+..+   .+.+  .+||++.+++.+.+.|.+.+.+
T Consensus       126 r~---i~svl~qY~~~VrPm~~~fvePsk~~AD--iIId~~~aid~i~~~i~~~l~~  177 (182)
T PRK08233        126 NE---IHNDLKHYLNYARPLYLEALDTVKPNAD--IVLDGALSVEEIINQIEEELYR  177 (182)
T ss_pred             CC---HHHHHHHHHHHHHHHHHHHHCHHHHCCC--EEEECCCCHHHHHHHHHHHHHH
T ss_conf             87---8999999999878899998570032196--8985860799999999999974


No 49 
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=99.04  E-value=1.6e-08  Score=71.07  Aligned_cols=160  Identities=18%  Similarity=0.178  Sum_probs=90.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-HHHHCCCCCCCCCCHHHHHHHHHHHHHHHH---
Q ss_conf             8868998678887979999999999997798199987788984410-011001244454101345677788999997---
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAE-AARHVLLSCGVDEFGAEAEAIVFAAARLDH---   78 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge-~ir~~l~~~~~~~~~~~~~~lLfaadr~~~---   78 (225)
                      +|+-|++=|+-||||||..+.|++.|.   .+++-    |+..+.+ -|-++-.   ..++        .-.||+--   
T Consensus         2 ~~~a~VVmGVsGsGKSTvg~~LA~~L~---~~fie----gDd~Hp~~Ni~KM~~---GiPL--------~D~DR~pWL~~   63 (176)
T PRK09825          2 AGESYILMGVSGSGKSLIGSKIAALFS---AKFID----GDDLHPAKNIDKMSQ---GIPL--------TDEDRLPWLER   63 (176)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHC---CCEEC----CCCCCCHHHHHHHHC---CCCC--------CHHHHHHHHHH
T ss_conf             985799982898998999999999959---87762----344378989999868---9998--------86679999999


Q ss_pred             HHHHHHHHHCCC-CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC-EEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             763565542345-25872354243100010034442457765444203889841-1566520348776443211111000
Q gi|254780218|r   79 VENVIRPALMEG-KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD-CTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        79 ~~~~I~p~L~~g-~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD-l~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                      +.+.+...+..| ..||.    +|.         +...+-+.+..-     .|+ ..+||+.++++..+|+.+|.+.   
T Consensus        64 l~~~~~~~~~~~~~~Vva----CSA---------LK~~YRd~Lr~~-----~~~v~fv~L~g~~~~i~~Rl~~R~gH---  122 (176)
T PRK09825         64 LNDASYSLYKKNETGFIV----CSS---------LKKQYRDILRKS-----SPNVHFLWLDGDYETILARMQRRAGH---  122 (176)
T ss_pred             HHHHHHHHHHCCCCEEEE----EHH---------HHHHHHHHHHCC-----CCCEEEEEEECCHHHHHHHHHHCCCC---
T ss_conf             999999999649982997----188---------679999999747-----99879999718999999999746037---


Q ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHHHHCC----CCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             00000211288999999999999999789----9499981897889999999999999998
Q gi|254780218|r  157 ACLDYFERKDVMIHEKRRQIFLDIARNQP----DRCHIVDSAHSFQSVATNILNIVWELVQ  213 (225)
Q Consensus       157 ~~~d~~E~~~~~~~~kv~~~y~~la~~~~----~~~~~IDa~~~~eei~~~I~~~i~~~l~  213 (225)
                           |  ....++.   ..|..|  +.|    ..+..||.+.++++|.++|.+.++.+.+
T Consensus       123 -----F--Mp~~LL~---SQf~tL--E~P~~dE~~v~~idi~~~~e~iv~~~~~al~a~~~  171 (176)
T PRK09825        123 -----F--MPPDLLQ---SQFDAL--ERPCADEHDIARIDVNHDIENVTEQCRQAVQAFRQ  171 (176)
T ss_pred             -----C--CCHHHHH---HHHHHH--CCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             -----9--9979999---899981--79998889869997899999999999999999998


No 50 
>PRK13947 shikimate kinase; Provisional
Probab=99.02  E-value=7.9e-09  Score=72.95  Aligned_cols=167  Identities=20%  Similarity=0.202  Sum_probs=85.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |++   |++=|..||||||..+.|++.|   +++++-+..-=-...|..|.+++...        .+.. |   | +.=.
T Consensus         1 mkn---I~LiG~mGsGKTtiGk~La~~L---~~~fiD~D~~Ie~~~g~sI~eIf~~~--------GE~~-F---R-~~E~   61 (171)
T PRK13947          1 MKN---IVLIGFMGTGKTTVGKKVATTL---SFGFIDTDKEIEKMAGMTVSEIFEKD--------GEVR-F---R-SLEK   61 (171)
T ss_pred             CCC---EEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHCCCCHHHHHHHH--------CHHH-H---H-HHHH
T ss_conf             985---8997999998899999999997---96989874999988299889999984--------8999-9---9-9999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             35655423452587235424310001003444245776544420388984115665203487764432111110000000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD  160 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d  160 (225)
                      +++.........||+-          |.+.-...+..+.+..       --.+|||++|+++..+|+.....+.--...+
T Consensus        62 ~~l~~~~~~~~~Vist----------GGG~v~~~~n~~~l~~-------~g~vi~L~~~~~~l~~Rl~~~~~RPll~~~~  124 (171)
T PRK13947         62 AAVRKAARLKNLVIAT----------GGGVVLNPENIVQLRK-------NGVLICLVARPEVILRRIKKKKDRPLLMVGN  124 (171)
T ss_pred             HHHHHHCCCCCEEEEC----------CCCCCCCHHHHHHHHH-------CCEEEEECCCHHHHHHHHHCCCCCCCCCCCC
T ss_conf             9999740368979978----------9850069999999996-------8989997399999999972899999798998


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEC-CCCCHHHHHHHHHHHHHHH
Q ss_conf             02112889999999999999997899499981-8978899999999999999
Q gi|254780218|r  161 YFERKDVMIHEKRRQIFLDIARNQPDRCHIVD-SAHSFQSVATNILNIVWEL  211 (225)
Q Consensus       161 ~~E~~~~~~~~kv~~~y~~la~~~~~~~~~ID-a~~~~eei~~~I~~~i~~~  211 (225)
                      ..+.. ..++..-...| +.|    +  ++|| .+++++++.++|++.+.+.
T Consensus       125 ~~~~l-~~l~~~R~~~Y-~~A----d--~~I~~~~~s~~ei~~~Ii~~~~k~  168 (171)
T PRK13947        125 PEERI-RELLKEREPFY-RFA----D--FTIDTSDMTIDEVAEEIIKAYIKL  168 (171)
T ss_pred             HHHHH-HHHHHHHHHHH-HHC----C--EEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             79999-99999999999-976----9--898899899999999999999972


No 51 
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=99.01  E-value=4.8e-09  Score=74.24  Aligned_cols=172  Identities=20%  Similarity=0.309  Sum_probs=90.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE-EEEECCCCCCCCCH-HHHC-CCCCCCCCCHHHH--HHHH----H
Q ss_conf             98886899867888797999999999999779819-99877889844100-1100-1244454101345--6777----8
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV-HVTREPGGTPAAEA-ARHV-LLSCGVDEFGAEA--EAIV----F   71 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v-~~~~eP~~t~~ge~-ir~~-l~~~~~~~~~~~~--~~lL----f   71 (225)
                      |.+|++||+-|+-|+||||.++.|-+.. +..+.| .+||-|-   -||. ..+. +.+  ...+....  ..+|    |
T Consensus         1 ~~~G~l~vlsgPSG~GKsTl~k~L~~~~-~l~~SVS~TTR~pR---~gEv~G~dY~Fvs--~~EF~~~i~~~~fLE~a~~   74 (191)
T COG0194           1 MSKGLLIVLSGPSGVGKSTLVKALLEDD-KLRFSVSATTRKPR---PGEVDGVDYFFVT--EEEFEELIERDEFLEWAEY   74 (191)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHC-CEEEEEEECCCCCC---CCCCCCCEEEECC--HHHHHHHHHCCCCEEEEEE
T ss_conf             9986399998998888899999998634-93799985267999---9875780247577--9999998756874788777


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEC-HHHHHHHHHHH
Q ss_conf             89999977635655423452587235424310001003444245776544420388984115665203-48776443211
Q gi|254780218|r   72 AAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLP-VDIGLKRVQNR  150 (225)
Q Consensus        72 aadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~-~e~a~~Ri~~R  150 (225)
                      ..+.+-....-|+..+++|+.||.|      +=+||+.         .+.+-.   | +-.+||+..| .++..+|+..|
T Consensus        75 ~gnyYGT~~~~ve~~~~~G~~vild------Id~qGa~---------qvk~~~---p-~~v~IFi~pPs~eeL~~RL~~R  135 (191)
T COG0194          75 HGNYYGTSREPVEQALAEGKDVILD------IDVQGAL---------QVKKKM---P-NAVSIFILPPSLEELERRLKGR  135 (191)
T ss_pred             CCCCCCCCHHHHHHHHHCCCEEEEE------EEHHHHH---------HHHHHC---C-CEEEEEECCCCHHHHHHHHHCC
T ss_conf             1973248688999998669908999------8539999---------999749---9-9699997599999999999715


Q ss_pred             HHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             111000000002112889999999999999997899499981897889999999999999
Q gi|254780218|r  151 YSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       151 ~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      +...+.           ....|...++.+++....-.+++||-  +.+....++..++..
T Consensus       136 gtds~e-----------~I~~Rl~~a~~Ei~~~~~fdyvivNd--d~e~a~~~l~~ii~a  182 (191)
T COG0194         136 GTDSEE-----------VIARRLENAKKEISHADEFDYVIVND--DLEKALEELKSIILA  182 (191)
T ss_pred             CCCCHH-----------HHHHHHHHHHHHHHHHHHCCEEEECC--CHHHHHHHHHHHHHH
T ss_conf             999799-----------99999999999998887599999895--499999999999999


No 52 
>pfam01583 APS_kinase Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Probab=99.01  E-value=1.1e-08  Score=72.08  Aligned_cols=112  Identities=22%  Similarity=0.302  Sum_probs=71.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999977981999877889844100110012444541013456777889999977635
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      ||..|=|.|+.||||||.++.|.+.|.++|.++++..       |..+|..+- ... .++.        .+|.++...+
T Consensus         1 kG~viW~TGLsGsGKTTlA~~l~~~L~~~~~~~~~LD-------GD~~R~~l~-~dl-gys~--------~~R~~n~~r~   63 (157)
T pfam01583         1 RGCTVWFTGLSGSGKSTIANALERKLFAQGISVYVLD-------GDNVRHGLN-KDL-GFSE--------EDRTENIRRI   63 (157)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CHHHHCCCC-CCC-CCCH--------HHHHHHHHHH
T ss_conf             9889998898999999999999999997599779976-------887750125-777-9898--------9999999999


Q ss_pred             ---HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCC-CCEEEEEEECHHHHHHH
Q ss_conf             ---65542345258723542431000100344424577654442038898-41156652034877644
Q gi|254780218|r   83 ---IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVM-PDCTIILDLPVDIGLKR  146 (225)
Q Consensus        83 ---I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~-PDl~i~Ldv~~e~a~~R  146 (225)
                         .+-.-.+|.+|||.     .+       ....+.-+|..+..   +. .=+-+|+++|.+++.+|
T Consensus        64 ~~lak~l~~~g~~VIvs-----~i-------sp~~~~R~~~r~~~---~~~~y~EIyv~~~le~~~~R  116 (157)
T pfam01583        64 AEVAKLFADAGLIVITS-----FI-------SPYRADRDMARELH---EDGKFIEVFVDTPLEVCEQR  116 (157)
T ss_pred             HHHHHHHHCCCCEEEEE-----CC-------CCCHHHHHHHHHHC---CCCCEEEEEECCCHHHHHHC
T ss_conf             99999984289658872-----15-------78999999999864---78857999963867887751


No 53 
>PRK00300 gmk guanylate kinase; Provisional
Probab=99.00  E-value=4.4e-09  Score=74.50  Aligned_cols=172  Identities=22%  Similarity=0.286  Sum_probs=87.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC-CCCE-EEEECCCCCC-CCCHHHHCCCCCCCCCCHHHHH---HHHH---
Q ss_conf             9888689986788879799999999999977-9819-9987788984-4100110012444541013456---7778---
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDV-HVTREPGGTP-AAEAARHVLLSCGVDEFGAEAE---AIVF---   71 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~-g~~v-~~~~eP~~t~-~ge~ir~~l~~~~~~~~~~~~~---~lLf---   71 (225)
                      |++|++|||-|+-|+||+|.++.|.+..... ++.+ ++||-|.... -|+-  -.+.+  ...+.....   ++-|   
T Consensus         4 ~~~g~livisGPSG~GK~tl~~~L~~~~p~~~~~~vs~TTR~pR~~E~dG~d--Y~Fvs--~eeF~~~i~~g~FlE~~~~   79 (208)
T PRK00300          4 MRRGLLIVLSAPSGAGKSTLVRALLERDPNDLQLSVSATTRAPRPGEVDGVH--YHFVS--REEFEEMIENGEFLEWAEV   79 (208)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCE--EEEEC--HHHHHHHHHHCCCEEEEEE
T ss_conf             4188389999999889999999999729986899897468898998778965--79961--9999999862836678998


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC-EEEEEEE-CHHHHHHHHHH
Q ss_conf             899999776356554234525872354243100010034442457765444203889841-1566520-34877644321
Q gi|254780218|r   72 AAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD-CTIILDL-PVDIGLKRVQN  149 (225)
Q Consensus        72 aadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD-l~i~Ldv-~~e~a~~Ri~~  149 (225)
                      .-+..-...+.|...+++|++||+|      +=.||+.         .+.+.     .|| ++||+.. +.++..+|+.+
T Consensus        80 ~g~~YGT~~~~I~~~~~~G~~vild------idvqGa~---------~lk~~-----~~~~~~IFI~Pps~e~L~~RL~~  139 (208)
T PRK00300         80 FGNYYGTPREPVEEALAAGKDVLLE------IDWQGAQ---------QVKKK-----MPDAVSIFILPPSLEELERRLRG  139 (208)
T ss_pred             CCCCEECCHHHHHHHHHCCCCEEEE------CCHHHHH---------HHHHH-----CCCCEEEEEECCCHHHHHHHHHH
T ss_conf             3870352469999998569987974------6789999---------99985-----97757999828899999999986


Q ss_pred             HHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             111100000000211288999999999999999789949998189788999999999999
Q gi|254780218|r  150 RYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       150 R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      |+...+           .....|+..+-.++.....--+++|+  .+.++-.+++..+|.
T Consensus       140 Rg~es~-----------~~I~~Rl~~A~~El~~~~~fD~vIiN--ddl~~a~~~l~~ii~  186 (208)
T PRK00300        140 RGTDSE-----------EVIARRLEAAKEEIAHASEYDYVIVN--DDLETALEELKAIIR  186 (208)
T ss_pred             CCCCCH-----------HHHHHHHHHHHHHHHHHHCCCEEEEC--CCHHHHHHHHHHHHH
T ss_conf             389988-----------89999999999999888559999989--999999999999999


No 54 
>KOG4235 consensus
Probab=98.99  E-value=9.4e-09  Score=72.51  Aligned_cols=180  Identities=17%  Similarity=0.144  Sum_probs=91.9

Q ss_pred             CCCEEE-EECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----C-CCCHHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             886899-867888797999999999999779819998778898-----4-410011001244454101345677788999
Q gi|254780218|r    3 SGLFIS-FEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGT-----P-AAEAARHVLLSCGVDEFGAEAEAIVFAAAR   75 (225)
Q Consensus         3 ~g~~I~-iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t-----~-~ge~ir~~l~~~~~~~~~~~~~~lLfaadr   75 (225)
                      +.+.++ |||.-++||||-.+.+.+..-   -...+..||-..     . ....+--+..++..=.+..++-.+|.   |
T Consensus        20 ~pkr~~~iEGNIa~GKsTfl~~~~~~t~---~~~ev~tEPV~kW~nV~~~~~n~L~~mY~ep~Rws~tfQtYv~lt---r   93 (244)
T KOG4235          20 GPKRLSIIEGNIAVGKSTFLNFFLNKTY---EEWEVLTEPVAKWQNVQGANANLLDMMYREPARWSYTFQTYVFLT---R   93 (244)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHCCC---CHHEECCCHHHHHHCCCCCCCCHHHHHHHCHHHHCCHHHHHHHHH---H
T ss_conf             8833688740111356899999985315---013004762887722677565479987436776201046789999---9


Q ss_pred             HHHHHHHHHHHHCCCCE------EEECCCCCCCEEHHCCCCC-----CCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHH
Q ss_conf             99776356554234525------8723542431000100344-----424577654442038898411566520348776
Q gi|254780218|r   76 LDHVENVIRPALMEGKI------LLCDRFLDSSYAYQGERDS-----SQHLFLDSLQEISVQEVMPDCTIILDLPVDIGL  144 (225)
Q Consensus        76 ~~~~~~~I~p~L~~g~i------VI~DRy~~S~lAYQ~~~~~-----~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~  144 (225)
                      .   .....|.-....+      |-+|||++-.-.|......     .-.+|-+|+..-  ....||..|||.++|+++.
T Consensus        94 L---~~~~~p~~~~kpvrimERSv~SdRyiFv~nl~esg~m~e~e~~iy~eW~d~i~~~--~~v~~dgiIYLrasPetc~  168 (244)
T KOG4235          94 L---KVQLEPFNGRKPVRIMERSVYSDRYIFVENLYESGSMNEVEYVIYQEWFDWILRS--MDVSLDGIIYLRASPETCY  168 (244)
T ss_pred             H---HHHHCCCCCCCCEEEEHHHHCCHHHHHHHHHHHCCCCCCEEEHHHHHHHHHHHHC--CCCCCCEEEEEECCHHHHH
T ss_conf             9---9873465788872300245400265789888863887630102598899999744--7503125999836959999


Q ss_pred             HHHHHHHHHHHCCHHHHHHHCCHHHHHHHH---HHHHH-HHHH--CCCCEEEECCCCCHHHH
Q ss_conf             443211111000000002112889999999---99999-9997--89949998189788999
Q gi|254780218|r  145 KRVQNRYSLRESACLDYFERKDVMIHEKRR---QIFLD-IARN--QPDRCHIVDSAHSFQSV  200 (225)
Q Consensus       145 ~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~---~~y~~-la~~--~~~~~~~IDa~~~~eei  200 (225)
                      +|+..|...+++..       .+.|++...   +.++- +--.  ..-++.++||+.+.|-.
T Consensus       169 ~Ri~~R~R~EE~gi-------pL~YLe~LH~~HE~WLi~~~f~~lq~vpvLVLDad~n~df~  223 (244)
T KOG4235         169 KRIYLRAREEEKGI-------PLKYLEALHELHESWLIKLHFPNLQAVPVLVLDADHNMDFS  223 (244)
T ss_pred             HHHHHHHHHHCCCC-------CHHHHHHHHHHHHHHHHHHCCHHHHCCCEEEEECCCCHHHH
T ss_conf             99999866131586-------67999999988899998732614432977998356456667


No 55 
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]
Probab=98.98  E-value=2e-08  Score=70.57  Aligned_cols=155  Identities=22%  Similarity=0.294  Sum_probs=86.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      |.|+|.|..|+||||.+++|+    ..|++++..        ++.+++.=+   ....+..-.....-.|   .+...+.
T Consensus         1 m~I~ITGTPGvGKTT~~~~L~----~lg~~~i~l--------~el~~e~~~---~~~~de~r~s~~vD~d---~~~~~le   62 (180)
T COG1936           1 MLIAITGTPGVGKTTVCKLLR----ELGYKVIEL--------NELAKENGL---YTEYDELRKSVIVDVD---KLRKRLE   62 (180)
T ss_pred             CEEEEECCCCCCHHHHHHHHH----HHCCCEEEH--------HHHHHHCCC---EECCCCCCCEEEEEHH---HHHHHHH
T ss_conf             937993799986687999999----829846619--------999986697---1143776615886679---9998888


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             54234525872354243100010034442457765444203889841156652034877644321111100000000211
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFER  164 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~  164 (225)
                      +.+.++..| .|-.    ++                    .-.|.||++|.|.++|++..+|.+.|+=..+.-    -|+
T Consensus        63 ~~~~~~~~I-vd~H----~~--------------------hl~~~~dlVvVLR~~p~~L~~RLk~RGy~~eKI----~EN  113 (180)
T COG1936          63 ELLREGSGI-VDSH----LS--------------------HLLPDCDLVVVLRADPEVLYERLKGRGYSEEKI----LEN  113 (180)
T ss_pred             HHHCCCCEE-EECH----HH--------------------HCCCCCCEEEEECCCHHHHHHHHHHCCCCHHHH----HHH
T ss_conf             875058847-6126----66--------------------217878889997189899999998769987898----877


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEEC-CCCCHHHHHHHHHHHHHH
Q ss_conf             2889999999999999997899499981-897889999999999999
Q gi|254780218|r  165 KDVMIHEKRRQIFLDIARNQPDRCHIVD-SAHSFQSVATNILNIVWE  210 (225)
Q Consensus       165 ~~~~~~~kv~~~y~~la~~~~~~~~~ID-a~~~~eei~~~I~~~i~~  210 (225)
                      -+...+.   -.+.+..+.+ .....|| ++.+++++...|..++.-
T Consensus       114 veAEi~~---vi~~EA~E~~-~~v~evdtt~~s~ee~~~~i~~ii~~  156 (180)
T COG1936         114 VEAEILD---VILIEAVERF-EAVIEVDTTNRSPEEVAEEIIDIIGG  156 (180)
T ss_pred             HHHHHHH---HHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             9999999---9999999734-76499978999999999999999703


No 56 
>pfam00406 ADK Adenylate kinase.
Probab=98.97  E-value=5.2e-09  Score=74.03  Aligned_cols=117  Identities=19%  Similarity=0.217  Sum_probs=63.0

Q ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC------CCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6788879799999999999977981999877------8898441001100124445410134567778899999776356
Q gi|254780218|r   10 EGIEGAGKTTHISLLKRFLQRKNYDVHVTRE------PGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus        10 EGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e------P~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      =|+.||||+||+++|++.+   |+.++.+-+      ..+|+.|+.|++.+..+.   +-|-...       .+.+.+.+
T Consensus         2 ~G~PGsGKgTqa~~La~~~---~~~~is~GdllR~~~~~~s~~g~~i~~~i~~G~---lvpd~i~-------~~l~~~~l   68 (186)
T pfam00406         2 LGPPGAGKGTQAERIVQKY---GIVHLSTGDLLRAEVKSGTELGKEAKEYMDKGE---LVPDEVV-------VGLVKERL   68 (186)
T ss_pred             CCCCCCCHHHHHHHHHHHH---CCEEECHHHHHHHHHHCCCHHHHHHHHHHHCCC---CCCHHHH-------HHHHHHHH
T ss_conf             1889898599999999985---990676999999998628879999999998699---5430999-------99999997


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      ...-....+| .|          |+.+.+.+  ...++.+......||++|+|+||.++..+|+.+|..
T Consensus        69 ~~~~~~~g~i-LD----------GfPRt~~Q--a~~l~~~l~~~~~~~~Vi~l~~~~~~~~~Rl~~R~~  124 (186)
T pfam00406        69 EQNDCKNGFL-LD----------GFPRTVPQ--AEALEEMLEYGIKLDYVIEFDVPDEVLVERLTGRRI  124 (186)
T ss_pred             CCCCCCCCEE-EE----------CCCCCHHH--HHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             0745548668-73----------79898999--999999997499877799997378999999976641


No 57 
>PRK13948 shikimate kinase; Provisional
Probab=98.96  E-value=1.8e-08  Score=70.86  Aligned_cols=171  Identities=16%  Similarity=0.201  Sum_probs=87.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      -.+|++=|.-||||||..+.|++.|   |++++-+..-=-...|..|.+++-.        ..+.. |   | +.=.+++
T Consensus        10 ~~~IvLIG~mGsGKStiGk~LA~~l---~~~fiD~D~~Ie~~~g~sI~eIF~~--------~GE~~-F---R-~~E~~~l   73 (182)
T PRK13948         10 ATFVALAGFMGTGKSRIGWELSRAL---ALHFVDTDKLITRVVGKSIPEVFAQ--------EGEEY-F---R-ACEKEVV   73 (182)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCHHHHHHH--------HCHHH-H---H-HHHHHHH
T ss_conf             9818988999998899999999996---9598888499999889399999998--------48999-9---9-9999999


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             55423452587235424310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
                      +..+.....||+=          |.+.-...+..+.+.+       -..+|||+++|++..+|++....+- ....|-.+
T Consensus        74 ~~l~~~~~~VISt----------GGG~v~~~~n~~~l~~-------~g~vv~L~~~~~~i~~R~~~~~RPl-l~~~~~~~  135 (182)
T PRK13948         74 RRVTRLDYAVISL----------GGGTFIHEENRRALLG-------RGPVVVLWASPETVYQRTKHSDRPL-LQVEDPLE  135 (182)
T ss_pred             HHHHCCCCEEEEC----------CCCEECCHHHHHHHHH-------CCEEEEEECCHHHHHHHCCCCCCCC-CCCCCHHH
T ss_conf             9997479969975----------8850058999999996-------8989999699999998817899998-88998799


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             1288999999999999999789949998189788999999999999999864
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR  215 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~  215 (225)
                      .-.. ++..-...|.+ |    + +++...+++++++.++|.+.++...+-+
T Consensus       136 ~l~~-l~~eR~~~Y~~-A----~-~~I~td~~~~~eiv~~Ii~~L~a~~~~~  180 (182)
T PRK13948        136 RIRT-LMEEREPVYRQ-G----T-IHVHSDGRPVEEIVEEVVERLWAWAEAQ  180 (182)
T ss_pred             HHHH-HHHHHHHHHHH-C----C-EEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             9999-99999999996-7----8-8988998999999999999999998665


No 58 
>PRK13949 shikimate kinase; Provisional
Probab=98.94  E-value=1.7e-08  Score=70.99  Aligned_cols=163  Identities=17%  Similarity=0.135  Sum_probs=79.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |++   |++-|.-||||||..+.|++.|   |++++-+..-=-...|..|.+++..        ..+.. |   | +.=.
T Consensus         1 Mk~---I~LiG~mGsGKstiGk~La~~l---~~~fiD~D~~Ie~~~g~sI~eif~~--------~Ge~~-F---R-~~E~   61 (169)
T PRK13949          1 MAR---IFLVGYMGAGKTTLGKALAREL---GLSFIDLDFFIENRFHKTVGDIFAE--------RGEAV-F---R-ELER   61 (169)
T ss_pred             CCC---EEEECCCCCCHHHHHHHHHHHH---CCCEEECCHHHHHHHCCCHHHHHHH--------HCHHH-H---H-HHHH
T ss_conf             983---8997999998899999999995---9997978499999859999999998--------69899-9---9-9999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH-HHHCCHH
Q ss_conf             356554234525872354243100010034442457765444203889841156652034877644321111-1000000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS-LRESACL  159 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~-~~~~~~~  159 (225)
                      +++...+.....||+=          |.+.-...+..+.+.+       --.+|||++|+++..+|+..... +.--...
T Consensus        62 ~~l~~l~~~~~~Vist----------GGG~v~~~~n~~~l~~-------~g~vV~L~~~~~~l~~Rl~~~~~~RPll~~~  124 (169)
T PRK13949         62 NMLHEVAEFEDVVIST----------GGGAPCFFDNMELMNA-------SGTTVYLKVSPEVLFVRLRLAKQQRPLLKGK  124 (169)
T ss_pred             HHHHHHHCCCCEEEEC----------CCCCCCCHHHHHHHHH-------CCEEEEEECCHHHHHHHHHCCCCCCCCCCCC
T ss_conf             9999984589839974----------8631157999999996-------8957999899999999975689999987898


Q ss_pred             HHHHHCCHHHH----HHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHH
Q ss_conf             00211288999----99999999999978994999818-978899999999999
Q gi|254780218|r  160 DYFERKDVMIH----EKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIV  208 (225)
Q Consensus       160 d~~E~~~~~~~----~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i  208 (225)
                      +.-|  -.++.    ++-...|.+ |    +  ++||+ +.+++++.++|.+.+
T Consensus       125 ~~~e--~~~~i~~~~~~R~~~Y~~-A----~--~~I~td~~s~~~i~~~Ii~~L  169 (169)
T PRK13949        125 SDEE--LLDFIIEALEKRAPFYRQ-A----K--IIFNADKLEDESQIEQLVQRL  169 (169)
T ss_pred             CHHH--HHHHHHHHHHHHHHHHHH-C----C--EEEECCCCCHHHHHHHHHHHC
T ss_conf             9899--999999999999999997-9----9--899899999999999999729


No 59 
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=98.93  E-value=1.1e-07  Score=66.21  Aligned_cols=161  Identities=23%  Similarity=0.314  Sum_probs=96.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      +.+|..|=|.|+.||||||.+..|.+.|.++|+.+.+..       |..+|.-|-  ..-.++        -+||.+++.
T Consensus        20 ~~~~~viW~TGLSGsGKSTiA~ale~~L~~~G~~~y~LD-------GDnvR~gL~--~dLgFs--------~edR~eniR   82 (197)
T COG0529          20 GQKGAVIWFTGLSGSGKSTIANALEEKLFAKGYHVYLLD-------GDNVRHGLN--RDLGFS--------REDRIENIR   82 (197)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC-------CHHHHHCCC--CCCCCC--------HHHHHHHHH
T ss_conf             799859996468888787999999999997597589855-------746765005--788978--------678999999


Q ss_pred             HHH---HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             356---55423452587235424310001003444245776544420388984115665203487764432111110000
Q gi|254780218|r   81 NVI---RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        81 ~~I---~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      .+-   +-..++|-+|||-  +-|-+.       -..+...   ...-  --+-+-+|.|+|.+++.+|=-+        
T Consensus        83 RvaevAkll~daG~iviva--~ISP~r-------~~R~~aR---~~~~--~~~FiEVyV~~pl~vce~RDpK--------  140 (197)
T COG0529          83 RVAEVAKLLADAGLIVIVA--FISPYR-------EDRQMAR---ELLG--EGEFIEVYVDTPLEVCERRDPK--------  140 (197)
T ss_pred             HHHHHHHHHHHCCEEEEEE--EECCCH-------HHHHHHH---HHHC--CCCEEEEEECCCHHHHHHCCCH--------
T ss_conf             9999999998789089997--517309-------9999999---9727--6862899957989999861825--------


Q ss_pred             HHHHHHHCCHHHHHHHHHH----HHHHHH--HCC-CCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             0000211288999999999----999999--789-94999818-97889999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQI----FLDIAR--NQP-DRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~----y~~la~--~~~-~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                                -+++|.+.+    |-.+..  +.| +.=.++|+ ..++++..++|++.+..
T Consensus       141 ----------GLYkKAr~GeI~~fTGid~pYE~P~~Pel~l~t~~~~vee~v~~i~~~l~~  191 (197)
T COG0529         141 ----------GLYKKARAGEIKNFTGIDSPYEAPENPELHLDTDRNSVEECVEQILDLLKE  191 (197)
T ss_pred             ----------HHHHHHHCCCCCCCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             ----------789999759877875778888899998267506657899999999999985


No 60 
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional
Probab=98.92  E-value=1.8e-08  Score=70.86  Aligned_cols=197  Identities=18%  Similarity=0.188  Sum_probs=89.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHC---CCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100---124445410134567778899999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHV---LLSCGVDEFGAEAEAIVFAAARLD   77 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~---l~~~~~~~~~~~~~~lLfaadr~~   77 (225)
                      |+++-+|+|.|+-||||||.++.|++.|   |+.++-|        |.+=|-+   ++..+   +++..+.-+.  ....
T Consensus       281 ~~~~~IIAIDGPAgSGKSTvAK~lA~~L---~~~yLDT--------GamYRAva~~~l~~~---i~~~d~~~l~--~~l~  344 (512)
T PRK13477        281 MKRRPIIAIDGPAGAGKSTVTRAVAKKL---GLLYLDT--------GAMYRAVTWLVLQEG---IDPQDEEALA--ELLS  344 (512)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEECC--------CHHHHHHHHHHHHCC---CCCCCHHHHH--HHHH
T ss_conf             5788779986787578789999999981---9968624--------499999999999759---6976899999--9987


Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCEEH---------HCCC-CCCCHHHHHHHHHHH--------------CCCCCCCEE
Q ss_conf             7763565542345258723542431000---------1003-444245776544420--------------388984115
Q gi|254780218|r   78 HVENVIRPALMEGKILLCDRFLDSSYAY---------QGER-DSSQHLFLDSLQEIS--------------VQEVMPDCT  133 (225)
Q Consensus        78 ~~~~~I~p~L~~g~iVI~DRy~~S~lAY---------Q~~~-~~~~~~~i~~l~~~~--------------~~~~~PDl~  133 (225)
                      ...=...+......-|.+|-.-.|..-+         +-+. -.+....+.....+.              .-+|..|+=
T Consensus       345 ~~~i~~~~~~~~~~~i~lng~dvt~~IRs~eVs~~vS~vA~~p~VR~~l~~~QR~~a~~~g~V~eGRDIGTVVfPdA~lK  424 (512)
T PRK13477        345 DLKLELKPSSGSPQRVWINGEDVTEAIRSPEVTSSVSAIAAQPCVRQALVKQQQRIGEKGGLVAEGRDIGTHVFPDAELK  424 (512)
T ss_pred             HCCEEEECCCCCCEEEEECCEEHHHHHCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCEECCCCCEE
T ss_conf             29879831888762899888570665544788999999839798999999999998465999997998766677899966


Q ss_pred             EEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHH-HHHHHHH-CC----CCEEEECC-CCCHHHHHHHHHH
Q ss_conf             6652034877644321111100000000211288999999999-9999997-89----94999818-9788999999999
Q gi|254780218|r  134 IILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI-FLDIARN-QP----DRCHIVDS-AHSFQSVATNILN  206 (225)
Q Consensus       134 i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~-y~~la~~-~~----~~~~~IDa-~~~~eei~~~I~~  206 (225)
                      |||++++++.-+|.-.--........+ |+.    ..+.+.+. +....++ .|    .--++||+ +.++|||.++|++
T Consensus       425 ~fLtAs~e~RA~RR~~el~~~g~~~~s-~~~----i~~~I~~RD~~D~~R~~sPL~~A~DAi~IDTs~lsieeVv~kI~~  499 (512)
T PRK13477        425 IFLTASVEERARRRALDLEAQGFPVID-LEE----LEAQIAERDRLDSTREIAPLRKADDAIELITDGLSIEEVVDKIID  499 (512)
T ss_pred             EEEECCHHHHHHHHHHHHHHCCCCCCC-HHH----HHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             999899999999999999966888789-999----999999861431447768886589848998999999999999999


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999864264
Q gi|254780218|r  207 IVWELVQKRVSP  218 (225)
Q Consensus       207 ~i~~~l~k~~~~  218 (225)
                      .+++.+.+-++|
T Consensus       500 l~~~ki~~~~~~  511 (512)
T PRK13477        500 LYRDRIPEEVWP  511 (512)
T ss_pred             HHHHHCCHHHCC
T ss_conf             999753031069


No 61 
>PRK00625 shikimate kinase; Provisional
Probab=98.92  E-value=1.3e-07  Score=65.79  Aligned_cols=165  Identities=17%  Similarity=0.152  Sum_probs=78.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC----CCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778----898441001100124445410134567778899999776
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP----GGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP----~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |=|++-|.-||||||..+.|++.|   |++++-+..-    -+..+...+.+++-        ...+.. |   |. .=.
T Consensus         1 MnI~LIG~mGsGKStiGk~LA~~l---~~~FvD~D~~Ie~~~~~~i~~Si~eIf~--------~~GE~~-F---R~-~E~   64 (173)
T PRK00625          1 MQIFLCGLPTVGKTSFGKALAKFL---SLPFFDTDDLIVSNYHGALYSSPKEIYQ--------AYGEEG-F---CE-EEA   64 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCCCCCHHHHHH--------HHCHHH-H---HH-HHH
T ss_conf             929998999998899999999993---9995774999999868652356999999--------718999-9---99-999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             35655423452587235424310001003444245776544420388984115665203487764432111110000000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD  160 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d  160 (225)
                      +++. .+.....||      |+    |.+.-...+..+.+.+.       -.+|||++|+++..+|+++|.........+
T Consensus        65 ~~l~-~l~~~~~VI------st----GGG~v~~~~n~~~Lk~~-------g~vV~L~~~~e~i~~Rl~~rpl~~~~~~~~  126 (173)
T PRK00625         65 LALE-SLPVIPSIV------AL----GGGTLMHEESYDHIRNR-------GLLVLLSLPIATIYQRLQKRGLPERLKKTP  126 (173)
T ss_pred             HHHH-HHCCCCCEE------EC----CCCCCCCHHHHHHHHHC-------CEEEEEECCHHHHHHHHHCCCCCCCCCCHH
T ss_conf             9999-732489689------74----88501789999999968-------999998399999999982699877788357


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             02112889999999999999997899499981897889999999999999998
Q gi|254780218|r  161 YFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ  213 (225)
Q Consensus       161 ~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~  213 (225)
                      .++    +.++.-...|.+.|.      .+|+++.-.....+.+.+..++++.
T Consensus       127 ~l~----~l~~eR~~lY~~~AD------~iI~~d~~sit~~~~~~~~~~~~~~  169 (173)
T PRK00625        127 SLE----EILTQRIDRMREIAD------YIFSLDHVALTSESSLMSACQSFCT  169 (173)
T ss_pred             HHH----HHHHHHHHHHHHHCC------EEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             999----999999999999799------9996899761325449999999999


No 62 
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=98.92  E-value=1.2e-07  Score=65.98  Aligned_cols=160  Identities=21%  Similarity=0.288  Sum_probs=96.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      .+|..|-|.|+.||||||.++.|.+.|.+.|+++.+..       |..+|.-| +.. -.+        -.+||.+++.+
T Consensus       441 ~~~~~iw~tGlsgsGKstiA~~le~~L~~~g~~~~~LD-------Gd~lR~gl-~~d-lgf--------~~~dR~enirR  503 (613)
T PRK05506        441 QKPATVWFTGLSGSGKSTIANLVERRLHALGRHTYVLD-------GDNVRHGL-NRD-LGF--------TDADRVENIRR  503 (613)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CHHHHHHH-CCC-CCC--------CHHHHHHHHHH
T ss_conf             99769999778989747999999999997799879988-------08987410-457-797--------98999999999


Q ss_pred             HHH---HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             565---54234525872354243100010034442457765444203889841156652034877644321111100000
Q gi|254780218|r   82 VIR---PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        82 ~I~---p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
                      +-.   -..++|-+|||-  +-|-  |     ..+.+.   .....-  ..+-+-+|+++|.+++.+|=.+         
T Consensus       504 ~~eva~l~~~aG~i~i~a--~iSp--~-----~~~R~~---~r~~~~--~~~f~Ev~v~~~le~c~~RDpK---------  560 (613)
T PRK05506        504 VAEVARLMADAGLIVLVS--FISP--F-----REEREL---ARALIG--EGEFVEVFVDTPLEVCEARDPK---------  560 (613)
T ss_pred             HHHHHHHHHHCCCEEEEE--CCCC--C-----HHHHHH---HHHHCC--CCCEEEEEEECCHHHHHHCCCH---------
T ss_conf             999999998689889997--5889--9-----899999---997578--8878999990899999762955---------


Q ss_pred             HHHHHHCCHHHHHHHHHH----HHHHHH--HCC-CCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             000211288999999999----999999--789-94999818-97889999999999999
Q gi|254780218|r  159 LDYFERKDVMIHEKRRQI----FLDIAR--NQP-DRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       159 ~d~~E~~~~~~~~kv~~~----y~~la~--~~~-~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                               .++.|.+.+    |-.+..  +.| +.=.+||+ ..++++...+|++.+.+
T Consensus       561 ---------glY~kar~gei~~~tGi~~pYe~P~~p~l~i~t~~~~~~~~~~~i~~~l~~  611 (613)
T PRK05506        561 ---------GLYAKARAGEIKNFTGIDSPYEAPENPELRLDTDGRSPEELAEQVLELLRE  611 (613)
T ss_pred             ---------HHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             ---------678998779978871368788999998479758999999999999999986


No 63 
>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate. This domain contains an ATP binding P-loop motif .; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity transferring phosphorus-containing groups, 0000103 sulfate assimilation.
Probab=98.92  E-value=2.3e-09  Score=76.18  Aligned_cols=159  Identities=21%  Similarity=0.368  Sum_probs=93.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      ++|..|=|.|+-||||||.++.|.+.|.++|+.+.+..       |.-||.-|-  +.-.++        -.||.+|+..
T Consensus        17 h~g~vlWlTGLSGsGKsTiA~Al~~~L~~~G~~~~~LD-------GDnvR~gL~--~dLGFS--------~~DR~eNIRR   79 (187)
T TIGR00455        17 HRGVVLWLTGLSGSGKSTIANALEKKLEKKGYRVYVLD-------GDNVRHGLN--KDLGFS--------EEDRKENIRR   79 (187)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEC-------CCEEECCCC--CCCCCC--------HHHHCCCCCE
T ss_conf             97389851168856357999999999996697499975-------863424778--888888--------5670568835


Q ss_pred             HH--HHHH-CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHH-HHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             56--5542-345258723542431000100344424577654-4420388984115665203487764432111110000
Q gi|254780218|r   82 VI--RPAL-MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL-QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        82 ~I--~p~L-~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l-~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      |-  -..+ ++|.|||. -++ |-  |     -.+.+.+..+ ...-..+    +=+|.+||-+++.+|        +  
T Consensus        80 igEVa~L~~~~G~i~lt-sfI-SP--y-----R~~R~~vR~~~~~~Gl~F----~Evfv~~PL~vcE~R--------D--  136 (187)
T TIGR00455        80 IGEVAKLLVRNGVIVLT-SFI-SP--Y-----RADRQMVRELIEEGGLEF----IEVFVKCPLEVCEQR--------D--  136 (187)
T ss_pred             EHHHHHHHHHCCEEEEE-EEE-CC--C-----HHHHHHHHHHHHCCCEEE----EEEECCCCHHHHCCC--------C--
T ss_conf             32646777647938998-421-77--6-----667899988754057368----997217886863268--------9--


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHH------HCCC-CEEEECC-CCCHHHHHHHHHHHH
Q ss_conf             0000211288999999999999999------7899-4999818-978899999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDIAR------NQPD-RCHIVDS-AHSFQSVATNILNIV  208 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~la~------~~~~-~~~~IDa-~~~~eei~~~I~~~i  208 (225)
                              ..-+++|.|++=.+-+.      +.|. .=+++|+ ..++++..++|++.+
T Consensus       137 --------PKGLYkKAR~GEIk~FTGID~pYE~P~~Pe~~~~tD~~~~~~~~~~i~~~L  187 (187)
T TIGR00455       137 --------PKGLYKKARNGEIKGFTGIDSPYEAPENPEVVLDTDQEDVEECVQQIIELL  187 (187)
T ss_pred             --------CCCHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHC
T ss_conf             --------850238864688865678788778699870688377233888999999719


No 64 
>PRK08118 topology modulation protein; Reviewed
Probab=98.91  E-value=5.1e-08  Score=68.11  Aligned_cols=144  Identities=22%  Similarity=0.220  Sum_probs=79.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999779819998778898441001100124445410134567778899999776
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      |+|   |.|=|..||||||.++.|++.+   |++++...            +++..++... .+..+.           .
T Consensus         1 M~r---I~IiG~~GsGKSTlAr~L~~~~---~ip~~~LD------------~l~w~~~w~~-~~~~e~-----------~   50 (167)
T PRK08118          1 MKK---IILIGSGGSGKSTLARQLGEKL---NIPVHHLD------------ALFWKPNWEG-VPKEEQ-----------R   50 (167)
T ss_pred             CCE---EEEECCCCCCHHHHHHHHHHHH---CCCEEECC------------CEEECCCCCC-CCHHHH-----------H
T ss_conf             967---9998899987999999999988---96979644------------3476689946-888999-----------9


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHH-----HH
Q ss_conf             3565542345258723542431000100344424577654442038898411566520348776443211111-----00
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSL-----RE  155 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~-----~~  155 (225)
                      ..++..+++..+|| |-.+.++                 +..   ..+..|.+||||.|..+++-|+.+|.-.     +.
T Consensus        51 ~~~~~~~~~~~WIi-dGny~~~-----------------~~~---r~~~aD~iI~Ld~p~~~~~~r~~kR~~~~~~~~r~  109 (167)
T PRK08118         51 TVQNELVKEDEWII-DGNYGGT-----------------MDI---RLNAADTIIFLDIPRTICLYRAFKRRVQYRGKTRP  109 (167)
T ss_pred             HHHHHHHHCCCEEE-ECCCHHH-----------------HHH---HHHHCCEEEEECCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999983898799-4771779-----------------987---79769999998598999999999999998177576


Q ss_pred             CCHHHHHHHCCHHHHHHH-------HHHHHHHHHHCC--CCEEEECCCC
Q ss_conf             000000211288999999-------999999999789--9499981897
Q gi|254780218|r  156 SACLDYFERKDVMIHEKR-------RQIFLDIARNQP--DRCHIVDSAH  195 (225)
Q Consensus       156 ~~~~d~~E~~~~~~~~kv-------~~~y~~la~~~~--~~~~~IDa~~  195 (225)
                      .-....-|+.+..|+.-+       +..+..+....+  .+++++.+.+
T Consensus       110 d~~~g~~E~~~~~fl~wi~~~~~~~r~~~~~~l~~~~~~~~vi~lks~~  158 (167)
T PRK08118        110 DMGEGCPEKFDLQFFKWIWEYPKTKRPSILKRLNQLKEDKNVVILKSRN  158 (167)
T ss_pred             CCCCCCCCCCCHHHHHHHHHCCHHCCHHHHHHHHHCCCCCCEEEECCHH
T ss_conf             5689993625099999998584010199999998556798199977999


No 65 
>PRK07667 uridine kinase; Provisional
Probab=98.91  E-value=1.1e-08  Score=72.00  Aligned_cols=140  Identities=14%  Similarity=0.091  Sum_probs=70.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      ++|+|.|..||||||.++.|++.|.+.|.++++.+--+ .-.....|.-.-........+  .    +-|..-...++++
T Consensus        15 ~iIgIaG~sgSGKTTla~~L~~~l~~~~~~v~v~~~Dd-~~~~~~~r~~~~~~~~~~~~~--~----~~D~~~L~~~ll~   87 (190)
T PRK07667         15 FILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDD-HIVERNKRYHTGFEEWYEYYY--L----QWDIEWLRQKFFR   87 (190)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCHHHHHCCCCCCHHHCCC--C----CCCHHHHHHHHHH
T ss_conf             99997798978899999999999866598379996662-426588873059854001254--3----1259999999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHC--CCC--CCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             54234525872354243100010034442457765444203--889--841156652034877644321111
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV--QEV--MPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~--~~~--~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      | |.+|.-|=.-.|-+++-........+....+--++-+..  ..+  .=|+.||+|+|.++++.|-.+|.+
T Consensus        88 ~-Lk~g~~i~~p~Yd~~t~~~~~~~~~v~p~~VIIvEGI~l~~~elrd~~D~kIfVD~~~d~r~~R~~~~~~  158 (190)
T PRK07667         88 K-LQNETKLTLPFYHDETDTCEMKKVQIPIVGVIVIEGVFLQRKEWRDFFHYMVYLDCPRETRFLRESEETQ  158 (190)
T ss_pred             H-HCCCCCEEEEEECCCCCCCCCCEEECCCCCEEEEECHHHCCHHHHHHCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             8-4389976752460233667764276699988999504438887897568799997899999887302023


No 66 
>PRK06762 hypothetical protein; Provisional
Probab=98.90  E-value=6.8e-08  Score=67.39  Aligned_cols=159  Identities=20%  Similarity=0.204  Sum_probs=93.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      +||+|-|.-||||||.++.|.+.|   |..+..+.       -..+|..+|..+.. ....+..         ++++.++
T Consensus         3 ~LIiiRGNSgSGKtT~Ak~L~~~~---G~g~lLvs-------QD~vRR~mLr~kD~-~g~~~i~---------Li~~~~~   62 (166)
T PRK06762          3 TLIIIRGNSGSGKTTIAKQLQERL---GRGTLLVS-------QDVVRRDMLRVKDG-PGNLSID---------LIEQLVR   62 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEE-------HHHHHHHHHHCCCC-CCCCCHH---------HHHHHHH
T ss_conf             289997888888789999999986---88857853-------75899998405577-9997868---------9999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             54234525872354243100010034442457765444203889841156652034877644321111100000000211
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFER  164 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~  164 (225)
                      -+++.+..||..--..+. .|        .   +.+........-+-+++|+|+|.++-++|-..|....+-        
T Consensus        63 yg~~~~~~VIlEGIL~a~-~Y--------g---~ml~~l~~~~~~~~~~YY~Di~FeETlrRH~tr~~~~~F--------  122 (166)
T PRK06762         63 YGLQHCEFVILEGILNSD-RY--------G---PMLKELIHLFGGNAYTYYFDLSFEETVRRHNTRPKSHEF--------  122 (166)
T ss_pred             HHHHCCCEEEEEEECCHH-HH--------H---HHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCCCCCCC--------
T ss_conf             998569989997410044-89--------9---999999986578669999948779999987467765676--------


Q ss_pred             CCHHHHHHHHHHHHH--HHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             288999999999999--999789949998189788999999999999
Q gi|254780218|r  165 KDVMIHEKRRQIFLD--IARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       165 ~~~~~~~kv~~~y~~--la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                       +.+   ..+.=|..  +. ..+ .=.+|+.+.+.++..+.|++.+.
T Consensus       123 -g~~---~mr~W~~~~D~L-~~~-~E~~~~~~~tl~~~v~~Il~di~  163 (166)
T PRK06762        123 -GED---DMRRWWLPHDTL-GVE-GETIFTDELSLNDIFDAILTDIG  163 (166)
T ss_pred             -CHH---HHHHHCCCCCCC-CCC-CCEEECCCCCHHHHHHHHHHHHC
T ss_conf             -989---999775554555-999-86785776788999999999743


No 67 
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=98.90  E-value=1.5e-07  Score=65.34  Aligned_cols=160  Identities=20%  Similarity=0.303  Sum_probs=93.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999977-9819998778898441001100124445410134567778899999776
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~-g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      ++|.-|=|.|+.||||||.++.|...|.+. |..|.+..       |..+|.-|- .. -.++        .+||.+++.
T Consensus       390 ~~G~tiwlTGLsgsGKsTiA~al~~~L~~~~~~~v~lLD-------GD~~R~~l~-~d-Lgfs--------~~dR~enir  452 (568)
T PRK05537        390 KQGFTVFFTGLSGAGKSTIAKALMAKLMEMRGRPVTLLD-------GDVVRKHLS-SE-LGFS--------KEDRDLNIL  452 (568)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEC-------CHHHHHHHC-CC-CCCC--------HHHHHHHHH
T ss_conf             586499984578887769999999999971892799954-------688874215-57-8989--------889999999


Q ss_pred             HH--HHHHH-CCCCEEEECCCCCCCEE-HHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             35--65542-34525872354243100-0100344424577654442038898411566520348776443211111000
Q gi|254780218|r   81 NV--IRPAL-MEGKILLCDRFLDSSYA-YQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        81 ~~--I~p~L-~~g~iVI~DRy~~S~lA-YQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                      ++  +...+ ++|-+|||-     .++ |.     -..++...+   . ...-.=+.+|+++|.+++.+|=.+       
T Consensus       453 R~~~va~~~~~~g~i~i~a-----~isP~~-----~~R~~~r~~---~-~~~~~f~ev~v~~ple~c~~RD~K-------  511 (568)
T PRK05537        453 RIGFVASEITKNGGIAICA-----PIAPYR-----ATRREVREM---I-EAFGAFIEVYVATPIEVCEQRDRK-------  511 (568)
T ss_pred             HHHHHHHHHHHCCCEEEEE-----ECCCCH-----HHHHHHHHH---H-CCCCCEEEEEECCCHHHHHHCCCC-------
T ss_conf             9999999998589789995-----069997-----999999998---5-237977999978989999772861-------


Q ss_pred             CHHHHHHHCCHHHHHHHHHH----HHHHHH--HCC-CCEEEECC-CCCHHHHHHHHHHHHHH
Q ss_conf             00000211288999999999----999999--789-94999818-97889999999999999
Q gi|254780218|r  157 ACLDYFERKDVMIHEKRRQI----FLDIAR--NQP-DRCHIVDS-AHSFQSVATNILNIVWE  210 (225)
Q Consensus       157 ~~~d~~E~~~~~~~~kv~~~----y~~la~--~~~-~~~~~IDa-~~~~eei~~~I~~~i~~  210 (225)
                               +  ++.|.+.+    |-.+..  +.| +.-.+||+ +.++++..++|+..+.+
T Consensus       512 ---------G--lY~ka~~G~i~~ftGi~~pye~P~~pdl~idt~~~~~~~~v~~ii~~L~~  562 (568)
T PRK05537        512 ---------G--LYKKAREGKIKEFTGISDPYEPPANPELVIDTTNITPDECAHKILLYLEE  562 (568)
T ss_pred             ---------H--HHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             ---------1--77898579978986689999999998079878999999999999999997


No 68 
>PRK07261 topology modulation protein; Provisional
Probab=98.86  E-value=1.5e-07  Score=65.35  Aligned_cols=147  Identities=17%  Similarity=0.199  Sum_probs=84.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844100110012444541013456777889999977635655
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP   85 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p   85 (225)
                      =|.|=|..||||||.++.|++.+   |++++...            .+...++-.. .+..+.           ...++.
T Consensus         2 rI~IiG~sGsGKSTlAr~L~~~~---~ip~~~LD------------~l~w~p~w~~-~~~~e~-----------~~~~~~   54 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARFLGQHY---NCPVLHLD------------QLHFSSNWQE-RDDDDM-----------IADISN   54 (171)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH---CCCEEEEC------------CEEECCCCEE-CCHHHH-----------HHHHHH
T ss_conf             89998899986899999999987---97979702------------2788899988-889999-----------999999


Q ss_pred             HHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHH-----HHCCHHH
Q ss_conf             42345258723542431000100344424577654442038898411566520348776443211111-----0000000
Q gi|254780218|r   86 ALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSL-----RESACLD  160 (225)
Q Consensus        86 ~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~-----~~~~~~d  160 (225)
                      .+++..+|| |-.+.+++.             +      ......|.+||||.|..+++-|+.+|.-.     +..-...
T Consensus        55 ~~~~~~WIi-DGny~~~~~-------------~------~rl~~aD~iI~Ld~p~~~~l~rvikR~l~~~~~~r~~m~~g  114 (171)
T PRK07261         55 FLLKQDWII-EGNYSNCLY-------------E------ERMAEADQIIFLNFSRFNCLYRAFKRYLKYRGKTRPSMAEN  114 (171)
T ss_pred             HHHCCCEEE-ECCCCCHHH-------------H------HHHHHCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             984898799-478512477-------------7------67977999999858499999999999999827758765789


Q ss_pred             HHHHCCHHHHHHH---------HHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             0211288999999---------99999999978994999818978899
Q gi|254780218|r  161 YFERKDVMIHEKR---------RQIFLDIARNQPDRCHIVDSAHSFQS  199 (225)
Q Consensus       161 ~~E~~~~~~~~kv---------~~~y~~la~~~~~~~~~IDa~~~~ee  199 (225)
                      .-|+.+.+|+.-+         +..|..+.+.++++++++...+.++.
T Consensus       115 ~~E~~~~~fl~wi~~~~~~k~~~~~~~~~~~~~~~kviilks~rev~~  162 (171)
T PRK07261        115 CPEKFDVEFVKWILLDGRSKKQKENYQSVVQKYSHKTIVLKNQKELDQ  162 (171)
T ss_pred             CCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCEEEECCHHHHHH
T ss_conf             934102999999973464411279999998746898899879999999


No 69 
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=98.84  E-value=1.9e-07  Score=64.67  Aligned_cols=156  Identities=17%  Similarity=0.190  Sum_probs=86.4

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-HHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH-
Q ss_conf             868998678887979999999999997798199987788984410-011001244454101345677788999997763-
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAE-AARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN-   81 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge-~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~-   81 (225)
                      ..+|++=|+-||||||..+.|++.|.   .+++   | |+..+.+ -+.++= .+     .|.+     -+||+-=+.. 
T Consensus         8 ~~iiVVMGVsGsGKSTig~~LA~~l~---~~fi---e-gDdfHp~~Ni~KM~-~G-----iPLt-----D~DR~pWL~~l   69 (177)
T PRK11545          8 HHIYVLMGVSGSGKSAVASAVAHQLH---AAFL---D-GDFLHPRCNIEKMA-SG-----EPLN-----DDDRKPWLQAL   69 (177)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHC---CCEE---C-CCCCCCHHHHHHHH-CC-----CCCC-----HHHHHHHHHHH
T ss_conf             75999984798999999999999819---9855---3-65558999999862-89-----9998-----68889999999


Q ss_pred             --HHHHHHCCCC-EEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC-EEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             --5655423452-5872354243100010034442457765444203889841-15665203487764432111110000
Q gi|254780218|r   82 --VIRPALMEGK-ILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD-CTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        82 --~I~p~L~~g~-iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD-l~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                        .+......+. .|+.    +|         .+...+-+.+..     -.|+ ..+||+.++++..+|+.+|.+..-  
T Consensus        70 ~~~~~~~~~~~~~~Vla----CS---------ALKr~YRd~Lr~-----~~~~~~fv~L~g~~~~i~~Rl~~R~~HFm--  129 (177)
T PRK11545         70 NDAAFAMQRTNKVSLIV----CS---------ALKKHYRDLLRE-----GNPNLSFIYLKGDFDVIESRLKARKGHFF--  129 (177)
T ss_pred             HHHHHHHHCCCCCEEEE----EC---------CCCHHHHHHHHH-----CCCCEEEEEECCCHHHHHHHHHHCCCCCC--
T ss_conf             99999997269966998----70---------111999999980-----69975999972999999999974646899--


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHCC----CCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             0000211288999999999999999789----9499981897889999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDIARNQP----DRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~la~~~~----~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                              ....+.   ..|..|  +.|    ..+.+||.+.|+|+|.++|++.+++
T Consensus       130 --------p~~LL~---SQf~tL--E~P~~~E~~~~~vdi~~~~e~iv~~il~~l~~  173 (177)
T PRK11545        130 --------KTQMLV---TQFETL--QEPGADETDVLVVDIDQPLEGVVASTIEVIKK  173 (177)
T ss_pred             --------CHHHHH---HHHHHH--CCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC
T ss_conf             --------878999---899981--79998889869997899999999999999975


No 70 
>PRK04040 adenylate kinase; Provisional
Probab=98.82  E-value=3.5e-07  Score=63.13  Aligned_cols=179  Identities=18%  Similarity=0.163  Sum_probs=88.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCC---CCHHH--HHHHHHHHHHHHH
Q ss_conf             868998678887979999999999997798199987788984410011001244454---10134--5677788999997
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD---EFGAE--AEAIVFAAARLDH   78 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~---~~~~~--~~~lLfaadr~~~   78 (225)
                      ++.|++-|+.|+||||.++.+.+.|+ .++.++..    |+..-+...+.-+-...+   .+++.  -++-.-||.    
T Consensus         2 ~k~VvvtGiPGvGKTTv~~~~~~~l~-~~~~~vn~----G~~M~e~A~~~glv~~RDemRkL~~~~q~~lQ~~Aa~----   72 (189)
T PRK04040          2 MKVVVVTGVPGVGKTTVLNKALEKLK-EDYKIVNF----GDVMLEVAKEEGLVEHRDEMRKLPLEEQKELQREAAE----   72 (189)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHC-CCCEEEEH----HHHHHHHHHHCCCCCCHHHHCCCCHHHHHHHHHHHHH----
T ss_conf             41899975898878999999999723-58759867----7999999998177347788747999999999999999----


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHH-HCC
Q ss_conf             7635655423452587235424310001003444245776544420388984115665203487764432111110-000
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR-ESA  157 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~-~~~  157 (225)
                         -|... .....||.|-+..-.--+ |+--|++.+.++.        +.||..+++..+|++.+.|..+...+. +..
T Consensus        73 ---~I~~~-~~~~~ViIDTHa~Iktp~-GylpGLP~~Vl~~--------L~P~~ivlieA~P~eIl~RR~~D~tR~RD~e  139 (189)
T PRK04040         73 ---RIAEM-AGEGPVIVDTHATIKTPG-GYLPGLPEWVLEE--------LNPDVIVLIEADPDEILMRRLRDPTRRRDVE  139 (189)
T ss_pred             ---HHHHH-CCCCCEEEECCCCCCCCC-CCCCCCCHHHHHH--------CCCCEEEEEECCHHHHHHHHHCCCCCCCCCC
T ss_conf             ---99983-578728994452002688-6778998999986--------6998899997588999998842556689878


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHH-HHHCCCCEEEECC-CCCHHHHHHHHHHHHH
Q ss_conf             00002112889999999999999-9978994999818-9788999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDI-ARNQPDRCHIVDS-AHSFQSVATNILNIVW  209 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~l-a~~~~~~~~~IDa-~~~~eei~~~I~~~i~  209 (225)
                      ..     +++..|+.+..++.-- +---...+.+|.. +.-+|+=..+|.+.+.
T Consensus       140 s~-----~~I~~hq~~nR~~a~ayavltga~Vkiv~N~e~~~e~Aa~~iv~~l~  188 (189)
T PRK04040        140 TE-----ESIEEHQEMNRAAAMAYAVLTGATVKIVENHEGLLEEAAEEIVEVLR  188 (189)
T ss_pred             CH-----HHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             89-----99999999999999999997398489997899988999999999861


No 71 
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=98.81  E-value=6.3e-08  Score=67.56  Aligned_cols=168  Identities=25%  Similarity=0.304  Sum_probs=83.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE---EECCCCCCCCCHHHHCCCCCCCCCCHHHHH---HHHH--HHHH
Q ss_conf             8689986788879799999999999977981999---877889844100110012444541013456---7778--8999
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV---TREPGGTPAAEAARHVLLSCGVDEFGAEAE---AIVF--AAAR   75 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~---~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~---~lLf--aadr   75 (225)
                      |+||+|-|+-|+||||.++.|.+... ....+.+   || |+. .-|+-  -.+++.  ..+..+..   ++++  +-..
T Consensus         2 G~LivvsgPSGaGK~Tli~~l~~~~~-~~~~~s~s~tTR-p~e-~~g~d--y~fvs~--eeF~~~i~~g~F~~~w~~~g~   74 (184)
T PRK10078          2 GKLIWLMGPSGSGKDSLLAALRQREQ-TQLLVAHRYITR-PAS-AGSEN--HIALSE--QEFFTRAGQNLFALSWHANGL   74 (184)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHCCC-CCEEEEEEECCC-CCC-CCCCC--CEECCH--HHHHHHHHCCCEEEEEEECCC
T ss_conf             70999989986999999999984489-988999872378-999-99968--288799--999999977982999986695


Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             99776356554234525872354243100010034442457765444203889841156652034877644321111100
Q gi|254780218|r   76 LDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE  155 (225)
Q Consensus        76 ~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~  155 (225)
                      .+-+...|..+|..|..||.|          |...+     +..+...+   |.-=++|++..|+++..+|+.+|+...+
T Consensus        75 ~YG~~~~v~~~l~~G~dVi~~----------g~~~~-----~~~~~~~~---~~~~~~~~i~ps~~~L~~RL~~RGtEs~  136 (184)
T PRK10078         75 YYGVGIEIDLWLHAGFDVVVN----------GSRAH-----LPQARARY---QSALLPVCLQVSPEILRQRLENRGRENA  136 (184)
T ss_pred             CCCCCHHHHHHHHCCCEEEEE----------CHHHH-----HHHHHHHC---CCCEEEEEECCCHHHHHHHHHHCCCCCH
T ss_conf             667078999999749949995----------17989-----99999867---9858999957999999999997299999


Q ss_pred             CCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             00000021128899999999999999978994999818978899999999999999
Q gi|254780218|r  156 SACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWEL  211 (225)
Q Consensus       156 ~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~  211 (225)
                      ..           ...|...+    ....+..+++|+.+.+.++=.+++.++|.+-
T Consensus       137 e~-----------I~~RL~~A----~~~~~~d~~vInnDg~le~av~~l~~ii~~~  177 (184)
T PRK10078        137 SE-----------INARLARA----ARYQPQDCHTLNNDGSLRQSVDTLLTLLHQK  177 (184)
T ss_pred             HH-----------HHHHHHHH----CCCCCCCEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             99-----------99999961----2157889999989988999999999999998


No 72 
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=98.81  E-value=1.3e-07  Score=65.67  Aligned_cols=109  Identities=19%  Similarity=0.233  Sum_probs=67.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH---H
Q ss_conf             9986788879799999999999977981999877889844100110012444541013456777889999977635---6
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENV---I   83 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~---I   83 (225)
                      |=|.|+.||||||.++.|.+.|.+.|.++++..       |..+|+.+-. . ..++.        .+|.++...+   .
T Consensus         2 iW~tGLsgsGKTTlA~~l~~~L~~~~~~~~~lD-------GD~iR~~l~~-~-lgys~--------~~R~~n~~r~~~la   64 (149)
T cd02027           2 IWLTGLSGSGKSTIARALEEKLFQRGRPVYVLD-------GDNVRHGLNK-D-LGFSR--------EDREENIRRIAEVA   64 (149)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CHHHHHHHCC-C-CCCCH--------HHHHHHHHHHHHHH
T ss_conf             898799999999999999999998699759977-------4889977365-5-59887--------88999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHH
Q ss_conf             554234525872354243100010034442457765444203889841156652034877644
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKR  146 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~R  146 (225)
                      .-...+|.+|||.     .++       ...+..+|..+...  ...=+-+|+++|.+++.+|
T Consensus        65 k~l~~qg~~VIvs-----~is-------p~~~~R~~~r~~i~--~~~y~eIyl~~~le~~~~R  113 (149)
T cd02027          65 KLLADAGLIVIAA-----FIS-------PYREDREAARKIIG--GGDFLEVFVDTPLEVCEQR  113 (149)
T ss_pred             HHHHHCCCEEEEE-----CCC-------CCHHHHHHHHHHCC--CCCEEEEEECCCHHHHHHC
T ss_conf             9998379827884-----167-------88999999998747--7766999971878999873


No 73 
>PRK00023 cmk cytidylate kinase; Provisional
Probab=98.81  E-value=6.4e-08  Score=67.55  Aligned_cols=34  Identities=26%  Similarity=0.387  Sum_probs=30.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             9888689986788879799999999999977981999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      |.+...|+|.|+-||||||.++.|++.|   |+.++-
T Consensus         1 m~~~iIIaIDGpagSGKST~ak~lA~~L---~~~yld   34 (225)
T PRK00023          1 MMKAPVIAIDGPAGSGKGTVAKILAKKL---GFHYLD   34 (225)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEC
T ss_conf             9989789965898678789999999993---988764


No 74 
>PTZ00301 uridine kinase; Provisional
Probab=98.78  E-value=1.5e-07  Score=65.26  Aligned_cols=194  Identities=15%  Similarity=0.153  Sum_probs=91.4

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHC-CC-CEEEEECCCC-CCCCCHHHHCCCCCCCCCC-HHHHHHHHHHHHHHHHH
Q ss_conf             8689986788879799999999999977-98-1999877889-8441001100124445410-13456777889999977
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRK-NY-DVHVTREPGG-TPAAEAARHVLLSCGVDEF-GAEAEAIVFAAARLDHV   79 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~-g~-~v~~~~eP~~-t~~ge~ir~~l~~~~~~~~-~~~~~~lLfaadr~~~~   79 (225)
                      ..+|.|.|.-||||||.++.+.+.|..+ |. .+.+...=.. ...+..-..   .....++ +|.+.-       ++++
T Consensus         3 ~~iIgIaGgSgSGKTT~a~~i~~~l~~~~~~~~v~ii~~D~Yy~d~~~~~~~---~~~~~NfDhP~a~D-------~dLl   72 (210)
T PTZ00301          3 CTVIGISGASGSGKSSLSTNIVSELMAHCGPVSIGVICEDFYYRDQSNIPES---ERAYTNYDHPKSLE-------HDLL   72 (210)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHH---HCCCCCCCCCCCCC-------HHHH
T ss_conf             8899996887678999999999998761499807998367667787658865---62788999823036-------9999


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCH---HHHHHHHHHHCCCC--CCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             63565542345258723542431000100344424---57765444203889--84115665203487764432111110
Q gi|254780218|r   80 ENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQH---LFLDSLQEISVQEV--MPDCTIILDLPVDIGLKRVQNRYSLR  154 (225)
Q Consensus        80 ~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~---~~i~~l~~~~~~~~--~PDl~i~Ldv~~e~a~~Ri~~R~~~~  154 (225)
                      .+.+. +|.+|+-|-+=-|-+++-.-.+....+..   -.++-+.-++....  .=|+.||+|+|.++.+.|...|.-.+
T Consensus        73 ~~~L~-~Lk~Gk~I~~P~Ydf~~h~R~~~~~~i~p~~vIIvEGi~~l~~~~lr~l~DlkIFvd~~~dirl~RRi~RDv~e  151 (210)
T PTZ00301         73 TTHLR-ELKSGKTVQIPQYDYVHHTRSDTAVTMTPKSVLIVEGILLFTNAELRNEMDCLIFVDTPLDICLIRRAKRDMRE  151 (210)
T ss_pred             HHHHH-HHHCCCCEECCCCCCCCCCCCCCEEEECCCCEEEEEEEHHCCCHHHHHHHCEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             99999-99769963446655567766797089668856999710430789899774245773487237889988877887


Q ss_pred             HCCHHHHHHHCCHHHHHHHHHHHHHHH---HHCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             000000021128899999999999999---97899499981897889999999999999998
Q gi|254780218|r  155 ESACLDYFERKDVMIHEKRRQIFLDIA---RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ  213 (225)
Q Consensus       155 ~~~~~d~~E~~~~~~~~kv~~~y~~la---~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~  213 (225)
                      .+...+..-   ..|.+.|+-.|.+..   +.+-+  ++|....+-+.-.+-|.+.|+..|+
T Consensus       152 RGr~~e~Vi---~qy~~~V~P~~~~fI~P~k~~AD--iIIp~~~~n~va~~~i~~~i~~~l~  208 (210)
T PTZ00301        152 RGRTFESVI---EQYEATVRPMYYAYVEPSKVYAD--IIVPSWKDNSVAVGVLRAKLNHDLE  208 (210)
T ss_pred             HCCCHHHHH---HHHHHHHCCCHHHHCCHHHHCCC--EEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             588999999---99996623058876805163361--8978999863199999999999985


No 75 
>PRK00081 coaE dephospho-CoA kinase; Reviewed
Probab=98.75  E-value=8.2e-07  Score=60.92  Aligned_cols=172  Identities=23%  Similarity=0.311  Sum_probs=89.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC-------CCCCCCCCHHHHCCCC---CCCCCCHHHHHH-HHHH-
Q ss_conf             689986788879799999999999977981999877-------8898441001100124---445410134567-7788-
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE-------PGGTPAAEAARHVLLS---CGVDEFGAEAEA-IVFA-   72 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e-------P~~t~~ge~ir~~l~~---~~~~~~~~~~~~-lLfa-   72 (225)
                      +.|.+.|.-||||||.++.|.    +.|++|+-...       |+ ....+.|.+.+-.   ...+.++....+ ..|. 
T Consensus         3 ~~IgiTG~igsGKStv~~~l~----~~G~~vidaD~i~~~l~~~~-~~~~~~i~~~fg~~i~~~~g~idr~~L~~~vF~d   77 (199)
T PRK00081          3 LIIGLTGGIGSGKSTVANIFA----ELGVPVIDADKIAHQVLEPG-GPALEAIVEHFGSEILLADGELDRRKLRERVFSN   77 (199)
T ss_pred             EEEEEECCCCCCHHHHHHHHH----HCCCCEEEHHHHHHHHHHHC-HHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCC
T ss_conf             899957888777999999999----88993996379999999707-5999999998536313777875699999998679


Q ss_pred             HHHHHHHHHHHHHHHCC------------CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECH
Q ss_conf             99999776356554234------------525872354243100010034442457765444203889841156652034
Q gi|254780218|r   73 AARLDHVENVIRPALME------------GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPV  140 (225)
Q Consensus        73 adr~~~~~~~I~p~L~~------------g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~  140 (225)
                      ......+++++-|....            ..+|+.+               .+.     +.. ......-|.+++.++|.
T Consensus        78 ~~~~~~Le~iiHP~V~~~i~~~~~~~~~~~~~iv~e---------------~pL-----L~E-~~~~~~~d~vi~V~a~~  136 (199)
T PRK00081         78 PEERKWLEAILHPLIREEIQEQLQQAESPEKYVVLD---------------IPL-----LFE-NGLYKWFDRVLVVDVPP  136 (199)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE---------------CHH-----HHH-CCCHHCCCEEEEEECCH
T ss_conf             899999999877999999999999864699789994---------------316-----765-36012078579998699


Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             87764432111110000000021128899999999999999978994999818978899999999999999986
Q gi|254780218|r  141 DIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       141 e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
                      ++..+|+.+|.+........++..+     .. .+.....    .+  .+|+.+.+.+++.++|.+.+.++++-
T Consensus       137 ~~r~~Rl~~R~~~~~~~~~~r~~~Q-----~~-~~~k~~~----aD--~vI~N~~s~e~l~~qi~~il~~i~~~  198 (199)
T PRK00081        137 EIQLERLMARDGLSEEEAEAILASQ-----MS-REEKLAR----AD--DVIDNNGDLEDLRKQVERLLAELLKL  198 (199)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHC-----CC-HHHHHHH----CC--EEEECCCCHHHHHHHHHHHHHHHHHC
T ss_conf             9999999974899899999999958-----99-8999996----99--99989999999999999999999961


No 76 
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]
Probab=98.73  E-value=4.1e-07  Score=62.71  Aligned_cols=164  Identities=20%  Similarity=0.205  Sum_probs=86.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH----HH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997----76
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDH----VE   80 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~----~~   80 (225)
                      +=|++-|+-||||||..+.|++.|   +++.+-+    +    +.|-+-.     +    .+-+-.|...-++-    =.
T Consensus         3 ~~IvLiG~mGaGKSTIGr~LAk~L---~~~F~D~----D----~~Ie~~~-----g----~sI~eIF~~~GE~~FR~~E~   62 (172)
T COG0703           3 MNIVLIGFMGAGKSTIGRALAKAL---NLPFIDT----D----QEIEKRT-----G----MSIAEIFEEEGEEGFRRLET   62 (172)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHC---CCCCCCC----H----HHHHHHH-----C----CCHHHHHHHHHHHHHHHHHH
T ss_conf             618997179997768999999981---9980224----6----9999997-----9----69999999982899999999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             35655423452587235424310001003444245776544420388984115665203487764432111110000000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD  160 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d  160 (225)
                      ++|...+..+..||+-          |.+.-...+....+...       -.++||++|+++..+|+.....+.-....+
T Consensus        63 ~vl~~l~~~~~~ViaT----------GGG~v~~~enr~~l~~~-------g~vv~L~~~~e~l~~Rl~~~~~RPll~~~~  125 (172)
T COG0703          63 EVLKELLEEDNAVIAT----------GGGAVLSEENRNLLKKR-------GIVVYLDAPFETLYERLQRDRKRPLLQTED  125 (172)
T ss_pred             HHHHHHHHCCCEEEEC----------CCCCCCCHHHHHHHHHC-------CEEEEEECCHHHHHHHHCCCCCCCCCCCCC
T ss_conf             9999986269959977----------98611689999999848-------858999699999999823466798656777


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             0211288999999999999999789949998189788999999999999999
Q gi|254780218|r  161 YFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV  212 (225)
Q Consensus       161 ~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l  212 (225)
                      .-+.- .+++++-.--|.+.+      ..+++++...+++..+|.+.+...+
T Consensus       126 ~~~~l-~~L~~~R~~~Y~e~a------~~~~~~~~~~~~v~~~i~~~l~~~~  170 (172)
T COG0703         126 PREEL-EELLEERQPLYREVA------DFIIDTDDRSEEVVEEILEALEGSL  170 (172)
T ss_pred             HHHHH-HHHHHHHHHHHHHHC------CEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             68999-999999899999727------4884489984899999999998732


No 77 
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=98.72  E-value=5.2e-08  Score=68.10  Aligned_cols=34  Identities=26%  Similarity=0.487  Sum_probs=29.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             9888689986788879799999999999977981999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      |+..+.|+|.|+-||||||.++.|++.|   |+.++-
T Consensus         1 m~~~~~IAIDGPagsGKsTvak~lA~~L---g~~yld   34 (222)
T COG0283           1 MKAAIIIAIDGPAGSGKSTVAKILAEKL---GFHYLD   34 (222)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH---CCCEEC
T ss_conf             9976499976887568478999999980---986664


No 78 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=98.71  E-value=1.3e-07  Score=65.72  Aligned_cols=166  Identities=20%  Similarity=0.242  Sum_probs=80.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCC-EEEEECCCCCC-CCC--------HHHHCCCCCCCCCCHHHHH--HHHH
Q ss_conf             8689986788879799999999999977981-99987788984-410--------0110012444541013456--7778
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYD-VHVTREPGGTP-AAE--------AARHVLLSCGVDEFGAEAE--AIVF   71 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~-v~~~~eP~~t~-~ge--------~ir~~l~~~~~~~~~~~~~--~lLf   71 (225)
                      |++|++-|+.||||+|.++.|.+......+. .++||-|.... -|+        .....+..+   .+--+.+  -..|
T Consensus         1 G~livl~GpsG~GK~tl~~~l~~~~~~~~~~vs~TTR~~R~gE~dG~dY~Fvs~~~F~~~i~~~---~FlE~~~~~g~~Y   77 (180)
T TIGR03263         1 GLLIVISGPSGVGKSTLVKALLEEDPNLKFSISATTRKPRPGEVDGVDYFFVSKEEFEEMIAAG---EFLEWAEVHGNYY   77 (180)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCEEEECHHHHHHHHHCC---EEEEEEEECCCCC
T ss_conf             9399998999889999999999768994488704468979987788734785089999998649---6488767716763


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEE-CHHHHHHHHHHH
Q ss_conf             8999997763565542345258723542431000100344424577654442038898411566520-348776443211
Q gi|254780218|r   72 AAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDL-PVDIGLKRVQNR  150 (225)
Q Consensus        72 aadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv-~~e~a~~Ri~~R  150 (225)
                      -.     ..+.|...+++|++||+|=      -.||+         ..+....   +.| .+||+.. +.++..+|+.+|
T Consensus        78 Gt-----~~~~i~~~~~~gk~vil~i------d~~G~---------~~lk~~~---~~~-~~IfI~pps~~~L~~RL~~R  133 (180)
T TIGR03263        78 GT-----PKSPVEEALAAGKDVLLEI------DVQGA---------RQVKKKF---PDA-VSIFILPPSLEELERRLRKR  133 (180)
T ss_pred             CC-----CHHHHHHHHHHCCCEEEEC------CHHHH---------HHHHHHC---CCE-EEEEEECCCHHHHHHHHHHC
T ss_conf             57-----4799999996099899987------89999---------9999758---864-89999688999999999964


Q ss_pred             HHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             11100000000211288999999999999999789949998189788999999999999
Q gi|254780218|r  151 YSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       151 ~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      +.....           ....|+..+-.++.....--+++++  .+.++-.+++.++|.
T Consensus       134 g~e~~~-----------~i~~Rl~~a~~E~~~~~~fD~vIvN--ddle~a~~~l~~ii~  179 (180)
T TIGR03263       134 GTDSEE-----------VIERRLAKAKKEIAHADEFDYVIVN--DDLEKAVEELKSIIL  179 (180)
T ss_pred             CCCCHH-----------HHHHHHHHHHHHHHHHHCCCEEEEC--CCHHHHHHHHHHHHC
T ss_conf             899989-----------9999999999999877439999989--799999999999971


No 79 
>pfam01202 SKI Shikimate kinase.
Probab=98.71  E-value=1.9e-07  Score=64.70  Aligned_cols=156  Identities=23%  Similarity=0.199  Sum_probs=75.8

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             88797999999999999779819998778898441001100124445410134567778899999776356554234525
Q gi|254780218|r   13 EGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKI   92 (225)
Q Consensus        13 DGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p~L~~g~i   92 (225)
                      -||||||..+.|++.|   |++++-+..-=-...|..+.+++...+        +.. |   | +.=.+++...+.....
T Consensus         1 mGsGKstigk~LA~~L---~~~fiD~D~~ie~~~g~si~eif~~~G--------e~~-F---R-~~E~~~l~~l~~~~~~   64 (158)
T pfam01202         1 MGAGKTTIGRLLAKAL---GLPFIDTDQEIEKRTGMSIAEIFEEEG--------EEG-F---R-RLESEVLKELLAEHNA   64 (158)
T ss_pred             CCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCHHHHHHHHC--------HHH-H---H-HHHHHHHHHHHCCCCE
T ss_conf             9897799999999996---999788729999887889999999819--------899-9---9-9999999999716994


Q ss_pred             EEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHH
Q ss_conf             87235424310001003444245776544420388984115665203487764432111110000000021128899999
Q gi|254780218|r   93 LLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK  172 (225)
Q Consensus        93 VI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~k  172 (225)
                      ||+=          |.+.-...+..+.+.+       -..+|||++|+++..+|+.++..+.--...+..+. -..++..
T Consensus        65 VIst----------GGG~v~~~~~~~~L~~-------~g~vi~L~~~~~~i~~Rl~~~~~RPll~~~~~~~~-~~~l~~~  126 (158)
T pfam01202        65 VIAT----------GGGAVLSEENRDLLRE-------NGIVVYLDADPEVLLERLKADKTRPLLQDKDPEEE-LLELLFE  126 (158)
T ss_pred             EEEE----------CCCCCCCHHHHHHHHH-------CCEEEEEECCHHHHHHHHCCCCCCCCCCCCCHHHH-HHHHHHH
T ss_conf             9980----------7860258999999995-------79279984999999999717999998989987999-9999999


Q ss_pred             HHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHH
Q ss_conf             999999999978994999818-978899999999999
Q gi|254780218|r  173 RRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIV  208 (225)
Q Consensus       173 v~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i  208 (225)
                      -...|.+.+      -.+||+ +.+++++.++|.+.+
T Consensus       127 R~~~Y~~~a------~~~i~~~~~~~~ei~~~Ii~~l  157 (158)
T pfam01202       127 RCPLYEEAA------DIVVDTDESSPEEVAEEILEAL  157 (158)
T ss_pred             HHHHHHHHC------CEEEECCCCCHHHHHHHHHHHH
T ss_conf             999999869------9998799999999999999975


No 80 
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=98.68  E-value=6.7e-07  Score=61.45  Aligned_cols=76  Identities=9%  Similarity=0.122  Sum_probs=44.7

Q ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHH--HHHHHHHHHHCC----CCEEEECC-CCCHHH
Q ss_conf             89841156652034877644321111100000000211288999999--999999999789----94999818-978899
Q gi|254780218|r  127 EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKR--RQIFLDIARNQP----DRCHIVDS-AHSFQS  199 (225)
Q Consensus       127 ~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv--~~~y~~la~~~~----~~~~~IDa-~~~~ee  199 (225)
                      +|..++=|||++++++..+|.-.- ....  .   ++.    ..+.+  |+.-.. -...|    +-.++||+ +.++||
T Consensus       148 fPdA~~KifLtAs~e~RA~RR~~q-~~~~--~---~~~----~~~~v~~RD~~DS-r~~spl~~A~da~~iDss~l~~ee  216 (714)
T PRK09518        148 APDAEVKIFLTASEEVRAARRSGQ-AVSG--V---GAA----VLEDVAARDEADS-KVTSFLSAAEGVTTLDTSDLDFAE  216 (714)
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHH-HHCC--C---HHH----HHHHHHHHHHHCC-CCCCCCCCCCCEEEEECCCCCHHH
T ss_conf             589985799979989999887764-4322--0---678----9999986413203-235765358980898689897999


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999998
Q gi|254780218|r  200 VATNILNIVWELVQ  213 (225)
Q Consensus       200 i~~~I~~~i~~~l~  213 (225)
                      +.+.|++.+.+...
T Consensus       217 vvd~i~~lv~~~~~  230 (714)
T PRK09518        217 TLDLLIGLIEDAIE  230 (714)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999987543


No 81 
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=98.66  E-value=6.8e-07  Score=61.42  Aligned_cols=171  Identities=15%  Similarity=0.098  Sum_probs=77.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889-84410011001244454101345677788999997763565
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGG-TPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~-t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      +|.|.|.-||||||.++.|++.|...  .+.+++.=+- -+....-+..-  ...+--+|.+..       ++.+.+.+.
T Consensus         1 iIgI~G~sgsGKTT~a~~L~~~l~~~--~v~~i~~D~yy~~~~~~~~~~~--~~~~fd~p~a~d-------~~~l~~~L~   69 (198)
T cd02023           1 IIGIAGGSGSGKTTVAEEIIEQLGNP--KVVIISQDSYYKDLSHEELEER--KNNNYDHPDAFD-------FDLLISHLQ   69 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCHHHH--CCCCCCCCCHHH-------HHHHHHHHH
T ss_conf             98988999885999999999980999--8589978888879860438784--367878922644-------999999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCC---CHHHHHHHHHHHCCC--CCCCEEEEEEECHHHHHHHHHHHHHHHHCCHH
Q ss_conf             5423452587235424310001003444---245776544420388--98411566520348776443211111000000
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSS---QHLFLDSLQEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSLRESACL  159 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~---~~~~i~~l~~~~~~~--~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~  159 (225)
                       .|.+|.-|-.=.|-+++--.......+   +--.++-+.-+....  ..=|+.+|+|+|.++.+.|...|.-.+.+...
T Consensus        70 -~L~~g~~i~~p~Yd~~t~~r~~~~~~i~~~~iiIvEGi~~l~~~~lr~~~D~kIfid~~~d~rl~Rri~RD~~eRg~~~  148 (198)
T cd02023          70 -DLKNGKSVEIPVYDFKTHSRLKETVTVYPADVIILEGILALYDKELRDLMDLKIFVDTDADVRLIRRIERDIVERGRDL  148 (198)
T ss_pred             -HHHCCCCCCCCCEECCCCCCCCCCEEECCCCEEEEECHHHCCCHHHHHHHHCEEEEECCHHHHHHHHHHHHHHHHCCCH
T ss_conf             -9864897612310034575467727965886599825343068888867402378617899999999987698858999


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHCCCCE-EEE
Q ss_conf             00211288999999999999999789949-998
Q gi|254780218|r  160 DYFERKDVMIHEKRRQIFLDIARNQPDRC-HIV  191 (225)
Q Consensus       160 d~~E~~~~~~~~kv~~~y~~la~~~~~~~-~~I  191 (225)
                      +.   --..|...++-.|.+.......+. ++|
T Consensus       149 ~~---v~~~~~~~v~p~~~~~i~P~k~~ADlIi  178 (198)
T cd02023         149 ES---VINQYLKFVKPMHEQFIEPTKRYADVII  178 (198)
T ss_pred             HH---HHHHHHHHHHHHHHHHCCCCHHCCCEEE
T ss_conf             99---9999998607879986524151473897


No 82 
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=98.66  E-value=4.4e-06  Score=56.60  Aligned_cols=184  Identities=18%  Similarity=0.254  Sum_probs=91.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCC-----CCCH--------HHH--
Q ss_conf             8886899867888797999999999999779819998778898441001100124445-----4101--------345--
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV-----DEFG--------AEA--   66 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~-----~~~~--------~~~--   66 (225)
                      +++.+|-+-|.-|+||||.+..|+.+|   |++.+..    ...+-|.+|.++-....     +.+.        +..  
T Consensus        90 ~~pliILigGtsGvGKSTlA~~LA~rL---gI~~vis----TD~IREVmR~~~~~el~P~Lh~SSy~Awk~l~~~~~~~~  162 (306)
T PRK04220         90 KEPIIILIGGASGVGTSTIAFELASRL---GIRSVIG----TDSIREVMRKIISKELLPTLHESSYTAWKSLRRPPWEEP  162 (306)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHH---CCCEEEC----CHHHHHHHHHCCCCCCCCHHHCCCHHHHHCCCCCCCCCH
T ss_conf             998799985899887899999999970---9883422----216999998524830175132275131002367877865


Q ss_pred             HHHHHHHHHHH----HHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCE-EEEEEEC-H
Q ss_conf             67778899999----7763565542345258723542431000100344424577654442038898411-5665203-4
Q gi|254780218|r   67 EAIVFAAARLD----HVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDC-TIILDLP-V  140 (225)
Q Consensus        67 ~~lLfaadr~~----~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl-~i~Ldv~-~  140 (225)
                      ..+.=..+.++    -++.+|..++.+|.-+|..          |. +-++. ++   ..+..  ..|+. .|.|.++ .
T Consensus       163 ~~I~Gf~~Q~~~V~~gI~aiI~Ra~~eg~slIIE----------GV-HlvP~-~i---~~~~~--~~~~vi~fll~i~dE  225 (306)
T PRK04220        163 DHILGFERHVEPVLVGVEAVIERALKEGISVIIE----------GV-HIVPG-FI---KEKYL--NMPNVFMFVLTLSDE  225 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE----------EE-CCCHH-HH---HHHHH--CCCCEEEEEEEECCH
T ss_conf             7999999999999999999999999729968998----------43-03778-87---77764--388389999997888


Q ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             87764432111110000000021128899999999999999978994999818978899999999999999986
Q gi|254780218|r  141 DIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       141 e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
                      +.-.+|...|...... ..++|=+ ...-...+++...+-|+++.  +-+||+. ++++-.+.|++.|.+.+.+
T Consensus       226 e~H~~RF~~Ra~~~~R-~~~rYl~-~f~~IR~IQ~yLv~~A~~~~--vPiI~N~-~id~tv~~i~~~i~~r~~~  294 (306)
T PRK04220        226 ETHKARFYARARVSKR-PAERYLK-HFDEIREIQDYIVEKAKEHG--VPVIENV-SIEETVDKILEIITERLSE  294 (306)
T ss_pred             HHHHHHHHHHCCCCCC-CHHHHHH-HHHHHHHHHHHHHHHHHHHC--CCEECCC-CHHHHHHHHHHHHHHHHHH
T ss_conf             9999999985044789-8789999-79999999999999988809--9810686-6899999999999999999


No 83 
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed
Probab=98.65  E-value=2.8e-06  Score=57.76  Aligned_cols=167  Identities=18%  Similarity=0.179  Sum_probs=85.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      .=|++=|+-||||||.-++|++.|   |++++-+..-=-...|..|.+++.        .+.+..    -|. .=.+.+.
T Consensus       134 ~rIaLIGlmGaGKSTvGr~LA~~L---g~pFvDlD~~IEk~aG~sI~eIFa--------~~GE~~----FR~-~E~~~L~  197 (304)
T PRK08154        134 PRIALIGLRGAGKSTLGRMLAARL---GVPFVELNREIEREAGLSVSEIFA--------LYGQEG----YRR-LERRALE  197 (304)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCHHHHHH--------HHCHHH----HHH-HHHHHHH
T ss_conf             847988999998889999999995---989778779999992999999999--------868899----999-9999999


Q ss_pred             HHHCC-CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHC-CHHHHH
Q ss_conf             54234-5258723542431000100344424577654442038898411566520348776443211111000-000002
Q gi|254780218|r   85 PALME-GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES-ACLDYF  162 (225)
Q Consensus        85 p~L~~-g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~-~~~d~~  162 (225)
                      ..+.. +..||+-          |.+--...+..+.+...       -.||||+++|++.++|+...+..+.. ...+..
T Consensus       198 ~ll~~~~~~VIAt----------GGGiV~~~~n~~~L~~~-------g~vVwL~aspe~l~~Rv~~~gd~RPLl~~~~a~  260 (304)
T PRK08154        198 RLIAEHEEMVLAT----------GGGIVSEPATFDLLLSH-------CYTVWLKASPEEHMARVRAQGDLRPMADNREAM  260 (304)
T ss_pred             HHHHCCCCEEEEE----------CCCCCCCHHHHHHHHHC-------CEEEEEECCHHHHHHHHHCCCCCCCCCCCCCHH
T ss_conf             9871169989972----------87212788999999968-------989999799999999986489999999998889


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHHHHH
Q ss_conf             1128899999999999999978994999818-9788999999999999999
Q gi|254780218|r  163 ERKDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVWELV  212 (225)
Q Consensus       163 E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~~~l  212 (225)
                      |.-. ..++.-...|.+     -+  ++||+ .+++++..+++.+.+.+.+
T Consensus       261 e~L~-~ll~~R~plY~~-----AD--~~IdTsg~tvees~~~L~~lv~~~~  303 (304)
T PRK08154        261 EDLR-RILASREPLYAR-----AD--AVVDTSGLTVEASLARLRELVRPAL  303 (304)
T ss_pred             HHHH-HHHHHHHHHHHH-----CC--EEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             9999-999987889986-----89--8987999999999999999999860


No 84 
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=98.65  E-value=3.1e-06  Score=57.50  Aligned_cols=171  Identities=19%  Similarity=0.208  Sum_probs=84.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHC-CCC-EEEEECCC-CCCCCCHHHHC-CCCCCCCCCHHHHH---HHHHHHHH-
Q ss_conf             8689986788879799999999999977-981-99987788-98441001100-12444541013456---77788999-
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRK-NYD-VHVTREPG-GTPAAEAARHV-LLSCGVDEFGAEAE---AIVFAAAR-   75 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~-g~~-v~~~~eP~-~t~~ge~ir~~-l~~~~~~~~~~~~~---~lLfaadr-   75 (225)
                      .++|++-|+.||||+|.++.|.+..... ... .++||.|. |..-|.   +. +.+  ...+.....   ++-|..-+ 
T Consensus         2 ~r~iil~Gpsg~GK~tl~~~l~~~~~~~~~~~v~~TTR~~r~gE~~G~---dY~Fvs--~~~F~~~i~~~~flE~~~~~g   76 (184)
T smart00072        2 RRPIVLSGPSGVGKGTLLAELIQEIPDAFERVVSHTTRPPRPGEVNGV---DYHFVS--REEFEDDIKSGLFLEWGEYSG   76 (184)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCC---EEEEEE--HHHHHHHHHCCHHHHHHHHCC
T ss_conf             977999999999999999999863964505778767279988999996---369971--799999987274178887478


Q ss_pred             --HHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHH
Q ss_conf             --997763565542345258723542431000100344424577654442038898411566520348776443211111
Q gi|254780218|r   76 --LDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSL  153 (225)
Q Consensus        76 --~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~  153 (225)
                        .-.....|..++++|++||+|=      -+||+         ..+...   .+.|=.+|+...++++..+|+..|+..
T Consensus        77 ~~YGt~~~~I~~~~~~g~~~ildi------~~~g~---------~~l~~~---~~~~~~Ifi~pps~e~L~~RL~~Rg~~  138 (184)
T smart00072       77 NYYGTSKETIRQVAEQGKHCLLDI------DPQGV---------KQLRKA---QLYPIVIFIAPPSSEELERRLRGRGTE  138 (184)
T ss_pred             CCCCCHHHHHHHHHCCCCEEEEEE------CHHHH---------HHHHHH---CCCCEEEEEECCCHHHHHHHHHCCCCC
T ss_conf             775410678999872698699996------29999---------999985---888079999389999999999716999


Q ss_pred             HHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             000000002112889999999999999997899499981897889999999999999
Q gi|254780218|r  154 RESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       154 ~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      ....           ...++..+-.++.....-.+++++.  +.++-.+++.++|..
T Consensus       139 ~~~~-----------i~~Rl~~a~~e~~~~~~fd~vIvN~--dl~~a~~~l~~iI~~  182 (184)
T smart00072      139 TAER-----------IQKRLAAAQKEAQEYHLFDYVIVND--DLEDAYEELKEILEA  182 (184)
T ss_pred             CHHH-----------HHHHHHHHHHHHHHHHHCCEEEECC--CHHHHHHHHHHHHHH
T ss_conf             9999-----------9999999999996473399999898--999999999999985


No 85 
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents eukaryotic proteins with this activity.
Probab=98.63  E-value=1.8e-07  Score=64.90  Aligned_cols=177  Identities=20%  Similarity=0.277  Sum_probs=86.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHC-CCCEEEEEC----CC------CCC----CCCHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             9986788879799999999999977-981999877----88------984----41001100124445410134567778
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTRE----PG------GTP----AAEAARHVLLSCGVDEFGAEAEAIVF   71 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~-g~~v~~~~e----P~------~t~----~ge~ir~~l~~~~~~~~~~~~~~lLf   71 (225)
                      -|+.|+.||||||.++.|.+++... |..+.++..    |.      +++    -.+.-|+.++        ...|.|+-
T Consensus         2 CVLcGLPaAGKTTLar~L~~~l~~~~gw~v~vI~YDdlIp~~~~e~e~~~~~~s~WK~~Rq~lL--------k~LE~fl~   73 (340)
T TIGR03575         2 CVLCGLPAAGKSTLARSLSATLRRERGWAVAVITYDDIIPEAAFELDQSREIPSQWKQFRQELL--------KYLEHFLV   73 (340)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEHHHHCCHHHHCCCCCCCCHHHHHHHHHHHH--------HHHHHHHH
T ss_conf             0432698787368999999998644476058986212142545312357766137999999999--------99999999


Q ss_pred             H-H-----------------HHHHHHHH-----------------HHHHHHCCCCEEEEC-CCCCCCEEHHCCCCCCCHH
Q ss_conf             8-9-----------------99997763-----------------565542345258723-5424310001003444245
Q gi|254780218|r   72 A-A-----------------ARLDHVEN-----------------VIRPALMEGKILLCD-RFLDSSYAYQGERDSSQHL  115 (225)
Q Consensus        72 a-a-----------------dr~~~~~~-----------------~I~p~L~~g~iVI~D-Ry~~S~lAYQ~~~~~~~~~  115 (225)
                      + .                 +....+++                 ...+++..--++|+| -|+|++|-|.         
T Consensus        74 al~n~~~~~~p~~~t~~~w~~fi~cL~eqgL~i~~~~~~~~~~~~l~~~~~~~pl~iiLDDNfyY~SMRye---------  144 (340)
T TIGR03575        74 AVINGSELSAPPGKTEGMWEDFVDCLKEQGLIISSGASEAQGCHSLTKPAVSRPLCLVLDDNFYYQSMRYE---------  144 (340)
T ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHH---------
T ss_conf             98453336787556752157777776522543345655344322002445677537995461488888999---------


Q ss_pred             HHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCC--CE----E
Q ss_conf             77654442038898411566520348776443211111000000002112889999999999999997899--49----9
Q gi|254780218|r  116 FLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPD--RC----H  189 (225)
Q Consensus       116 ~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~--~~----~  189 (225)
                       +..+..-+   -..-..+|+++|.+.+++|...|..+-..+              .++....++-..+|.  .|    .
T Consensus       145 -~yqLark~---~~gf~qi~l~c~le~cl~RN~~R~~pvp~~--------------tI~~M~~k~E~P~p~kn~WE~~Sl  206 (340)
T TIGR03575       145 -VYQLARKY---SLGFCQLFLDCPVESCLLRNKQRPVPLPDE--------------TIQLMGRKIEKPNPEKNAWEHNSL  206 (340)
T ss_pred             -HHHHHHHH---CCCEEEEEECCCHHHHHHHCCCCCCCCCHH--------------HHHHHHHCCCCCCCCCCCCHHCEE
T ss_conf             -99999981---875279886287999997402589999889--------------999999606899977676111236


Q ss_pred             EECCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98189788999999999999999864264
Q gi|254780218|r  190 IVDSAHSFQSVATNILNIVWELVQKRVSP  218 (225)
Q Consensus       190 ~IDa~~~~eei~~~I~~~i~~~l~k~~~~  218 (225)
                      +|+....+.+-..+|.+.+...|+.-+.+
T Consensus       207 ~i~s~~~~~e~~~~i~~ll~taL~nPv~~  235 (340)
T TIGR03575       207 VIQSSACISEDSLEVTDLLNTALENPIKC  235 (340)
T ss_pred             EECCCCCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             73267876415599999999997295645


No 86 
>pfam00625 Guanylate_kin Guanylate kinase.
Probab=98.62  E-value=3.9e-06  Score=56.91  Aligned_cols=169  Identities=20%  Similarity=0.246  Sum_probs=82.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHC-CCCE-EEEECCCCCCCCCHH-HHCCCCCCCCCCHHHHH--HHHHHHHHHHH-
Q ss_conf             689986788879799999999999977-9819-998778898441001-10012444541013456--77788999997-
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRK-NYDV-HVTREPGGTPAAEAA-RHVLLSCGVDEFGAEAE--AIVFAAARLDH-   78 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~-g~~v-~~~~eP~~t~~ge~i-r~~l~~~~~~~~~~~~~--~lLfaadr~~~-   78 (225)
                      ++|+|-|+-||||+|.++.|.+.+... .+.+ ++||-|.   .||.- .+.. .-....+.....  .++..+....+ 
T Consensus         2 klivl~GPSG~GK~tl~~~L~~~~~~~~~~~vs~TTR~~R---~~E~~G~dY~-Fvs~~~F~~~i~~~~FlE~~~~~g~~   77 (182)
T pfam00625         2 RPIVLSGPSGVGKSHIKKALLDEYPEKFGYSVSHTTRPPR---PGEVDGKDYH-FVSKEEMENDISANEFLEHAEFNGNY   77 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCC---CCCCCCCEEE-EECHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             8699989899999999999998486673445765547999---8787896579-96589999987543777626407972


Q ss_pred             ---HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEE-CHHHHHHHHHHHHHHH
Q ss_conf             ---763565542345258723542431000100344424577654442038898411566520-3487764432111110
Q gi|254780218|r   79 ---VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDL-PVDIGLKRVQNRYSLR  154 (225)
Q Consensus        79 ---~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv-~~e~a~~Ri~~R~~~~  154 (225)
                         ....|..++++|++||+|=      -.||+         ..+...   .+.| ++||+.. ++++..+|+.+|+...
T Consensus        78 YGt~~~~I~~~~~~g~~vvl~i------d~~g~---------~~lk~~---~~~~-~~IfI~pps~~~L~~RL~~Rg~~~  138 (182)
T pfam00625        78 YGTSKEAIEQIAESGKICILDV------DIQGV---------KQLRKA---ELSP-ISVFIKPPSLKVLQRRLKGRGTEQ  138 (182)
T ss_pred             EEECHHHHHHHHHCCCEEEEEE------CHHHH---------HHHHHH---CCCC-EEEEEECCCHHHHHHHHHHCCCCC
T ss_conf             5640277799986799699997------28999---------999874---9574-899993879999999998148888


Q ss_pred             HCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             0000000211288999999999999999789949998189788999999999999
Q gi|254780218|r  155 ESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       155 ~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      ..           ....|+..+-.++.....--++++  |.+.|+-.++|.++|.
T Consensus       139 ~~-----------~i~~Rl~~a~~e~~~~~~fD~vIv--Nddle~a~~~l~~ii~  180 (182)
T pfam00625       139 EE-----------KINKRMEAAEQEFQHYAEFDYIIV--NDDLDEAYKKLKEILE  180 (182)
T ss_pred             HH-----------HHHHHHHHHHHHHHHHHHCCEEEE--CCCHHHHHHHHHHHHH
T ss_conf             99-----------999999999999734861999998--9899999999999997


No 87 
>COG2326 Uncharacterized conserved protein [Function unknown]
Probab=98.62  E-value=1.2e-06  Score=59.89  Aligned_cols=166  Identities=14%  Similarity=0.118  Sum_probs=97.1

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999977981999877889844100110012444541013456777889999977635
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      +-.+|+|||-|.|||.-.++.+.+.|.-+|+.|+-..-|+++.-+.               .      |.       ...
T Consensus        73 ~~vvivfEGrDAAGKgG~Ikri~~~lNPR~~rvval~aPt~~E~~q---------------w------Y~-------qRy  124 (270)
T COG2326          73 QRVVIVFEGRDAAGKGGAIKRITEALNPRGARVVALPAPTDRERGQ---------------W------YF-------QRY  124 (270)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCHHHHCC---------------H------HH-------HHH
T ss_conf             8599999625445798516777650697526776248978476322---------------8------99-------999


Q ss_pred             HHHHHCCCCEEEECCCCCCCE-EHHCCCCCCCHHHH---HHHHHH---HCCCCCCCEEEEEEECHHHHHHHHHHHHHHH-
Q ss_conf             655423452587235424310-00100344424577---654442---0388984115665203487764432111110-
Q gi|254780218|r   83 IRPALMEGKILLCDRFLDSSY-AYQGERDSSQHLFL---DSLQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLR-  154 (225)
Q Consensus        83 I~p~L~~g~iVI~DRy~~S~l-AYQ~~~~~~~~~~i---~~l~~~---~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~-  154 (225)
                      +.-.=+.|.+||.||.+|--. +=--++...+.++.   ..++.+   ....=.-=+-|||+++.++-++|-.+|.... 
T Consensus       125 ~~~lPa~GeiviFdRSwYnr~gVeRVmGfct~~q~~rfl~eip~FE~mL~~~Gi~l~Kfwl~Is~eeQ~~RF~~R~~dP~  204 (270)
T COG2326         125 VAHLPAAGEIVIFDRSWYNRAGVERVMGFCTPKQYKRFLREIPEFERMLVESGIILVKFWLSISREEQLERFLERRNDPL  204 (270)
T ss_pred             HHHCCCCCEEEEECHHHCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCEEEEEEEEECCHHHHHHHHHHHHCCHH
T ss_conf             98678887389865122133271440256798999999987069999998688399999985798999999999750988


Q ss_pred             HCCHHHHHHHCCHHHHHHHHHHHHHHHHHC---CCCEEEECCCCC
Q ss_conf             000000021128899999999999999978---994999818978
Q gi|254780218|r  155 ESACLDYFERKDVMIHEKRRQIFLDIARNQ---PDRCHIVDSAHS  196 (225)
Q Consensus       155 ~~~~~d~~E~~~~~~~~kv~~~y~~la~~~---~~~~~~IDa~~~  196 (225)
                      ...+..-.+-++......+-.+|.++...-   -..|.+|.|+.-
T Consensus       205 K~WKlSp~D~~~r~~WddYt~A~~em~~~T~T~~APW~vV~addK  249 (270)
T COG2326         205 KQWKLSPMDLESRDRWDDYTKAKDEMFARTSTPEAPWYVVPADDK  249 (270)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCH
T ss_conf             606888788988876888999999999603899997589867717


No 88 
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]
Probab=98.61  E-value=2.3e-07  Score=64.21  Aligned_cols=184  Identities=21%  Similarity=0.210  Sum_probs=93.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-------CCCCCCCCCHHHHCCCCC---CCCCCHHHHHH-HHHH-
Q ss_conf             68998678887979999999999997798199987-------788984410011001244---45410134567-7788-
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-------EPGGTPAAEAARHVLLSC---GVDEFGAEAEA-IVFA-   72 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-------eP~~t~~ge~ir~~l~~~---~~~~~~~~~~~-lLfa-   72 (225)
                      +.|.+.|..||||||.++.++    +.|++|+...       +|| ++..+.+...+-..   ..+.++..... ..|. 
T Consensus         3 ~iIglTG~igsGKStva~~~~----~~G~~vidaD~v~r~~~~~~-~~~~~~i~~~fG~~i~~~dg~~~r~~L~~~vf~~   77 (201)
T COG0237           3 LIIGLTGGIGSGKSTVAKILA----ELGFPVIDADDVAREVVEPG-GEALQEIAERFGLEILDEDGGLDRRKLREKVFND   77 (201)
T ss_pred             EEEEEECCCCCCHHHHHHHHH----HCCCEEEECCHHHHHHHHCC-CHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             499995788778899999999----77993998869999988456-3578999998499765665105899999997389


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             99999776356554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   73 AARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        73 adr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      +.....++.++.|...+.-.+. -.+.-|.++.         ..+.-+.... ..-..|.+++.++|+++-++|+.+|.+
T Consensus        78 ~~~~~~Le~i~hPli~~~~~~~-~~~~~~~~~~---------~eiplL~e~~-~~~~~d~Vi~V~a~~e~r~eRl~~R~~  146 (201)
T COG0237          78 PEARLKLEKILHPLIRAEIKVV-IDGARSPYVV---------LEIPLLFEAG-GEKYFDKVIVVYAPPEIRLERLMKRDG  146 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCEE---------EEEHHHHHHC-CCCCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             9999999966558999999999-9974167638---------8707888726-666688899998999999999983379


Q ss_pred             HHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             1000000002112889999999999999997899499981897889999999999999998642
Q gi|254780218|r  153 LRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV  216 (225)
Q Consensus       153 ~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~~  216 (225)
                      ... +..+....    .|.-..+   +++.  .  =.++|++.+++...+++...+..++....
T Consensus       147 ~~~-e~~~~~~~----~Q~~~~e---k~~~--a--d~vi~n~~~i~~l~~~i~~~~~~~~~~~~  198 (201)
T COG0237         147 LDE-EDAEARLA----SQRDLEE---KLAL--A--DVVIDNDGSIENLLEQIEKLLKELLGLVL  198 (201)
T ss_pred             CCH-HHHHHHHH----HCCCHHH---HHHH--C--CCHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             999-99999998----7389999---8631--4--64766487799999999999999987643


No 89 
>PRK09270 frcK putative fructose transport system kinase; Reviewed
Probab=98.58  E-value=7.1e-07  Score=61.28  Aligned_cols=36  Identities=22%  Similarity=0.250  Sum_probs=29.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCC--EEEE
Q ss_conf             88689986788879799999999999977981--9998
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYD--VHVT   38 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~--v~~~   38 (225)
                      +-.+|.|-|..||||||.++.|.+.|.+.+..  ++.+
T Consensus        33 rR~lIgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~v   70 (230)
T PRK09270         33 RRTVVGIAGPPGAGKSTLAETLWEALSQQGPELPAIQV   70 (230)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             71899998999889999999999998623799857997


No 90 
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  This family includes the cell division ABC transporter and the periplasmic substrate-binding protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In Escherichia coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.; GO: 0005525 GTP binding.
Probab=98.54  E-value=6.7e-07  Score=61.43  Aligned_cols=113  Identities=24%  Similarity=0.302  Sum_probs=75.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHC----------CCCCCCCCCHHHHHHHHH
Q ss_conf             8886899867888797999999999999779819998778898441001100----------124445410134567778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHV----------LLSCGVDEFGAEAEAIVF   71 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~----------l~~~~~~~~~~~~~~lLf   71 (225)
                      +++..|.|-|+.|+||||=+.+|+++|.++|++|+.--  |+|.-+..+-++          +-.++.++-+|-+-+  |
T Consensus        80 ~kp~Vil~VGVNG~GKTTTIaKLA~~l~~~Gk~V~laA--gDTFRAAA~EQL~~Wa~R~gv~vi~~~~gn~DPAaV~--f  155 (284)
T TIGR00064        80 KKPNVILFVGVNGVGKTTTIAKLANKLKKQGKSVLLAA--GDTFRAAAIEQLEVWAKRLGVDVIKQKEGNADPAAVI--F  155 (284)
T ss_pred             CCCEEEEEEEEECCCHHHHHHHHHHHHHHCCCEEEEEC--CCHHHHHHHHHHHHHHHHHCCEEEECCCCCCCCHHHH--H
T ss_conf             89779999844088601028899999987499089982--7524799999999989883875540788988717899--9


Q ss_pred             HHHHHHHHHHHHHHHHCCC-CEEEECCCCCCCEEHHCCCCC----CCHHHHHHHHHHHCCCCC---CCEEEE-EE
Q ss_conf             8999997763565542345-258723542431000100344----424577654442038898---411566-52
Q gi|254780218|r   72 AAARLDHVENVIRPALMEG-KILLCDRFLDSSYAYQGERDS----SQHLFLDSLQEISVQEVM---PDCTII-LD  137 (225)
Q Consensus        72 aadr~~~~~~~I~p~L~~g-~iVI~DRy~~S~lAYQ~~~~~----~~~~~i~~l~~~~~~~~~---PDl~i~-Ld  137 (225)
                               +-|..|-++| ++||||          -|+|-    .-++.++.+.+.....-.   |+.+++ ||
T Consensus       156 ---------DAi~~Ak~~niDvvliD----------TAGRLqnk~NLm~EL~KI~RV~~k~~~~~aP~e~lLVlD  211 (284)
T TIGR00064       156 ---------DAIQAAKARNIDVVLID----------TAGRLQNKVNLMDELKKIKRVIKKVDPVDAPDEVLLVLD  211 (284)
T ss_pred             ---------HHHHHHHHCCCCEEEEE----------CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEH
T ss_conf             ---------98999987499789973----------475454662039999999998732102578755754220


No 91 
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family. In Arabidopsis the region carries two binding domains, a phosphoribosylpyrophosphate-binding domain and, at the very C-terminus, a uracil-binding domain.
Probab=98.51  E-value=8.4e-07  Score=60.86  Aligned_cols=165  Identities=18%  Similarity=0.144  Sum_probs=82.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE----CCCC---CCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8998678887979999999999997798199987----7889---84410011001244454101345677788999997
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR----EPGG---TPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDH   78 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~----eP~~---t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~   78 (225)
                      +|.|.|.-||||||.++.|.+.|...|..+....    ...+   .+.+..-+.--.....+-.+|.+.-       ++.
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~~~~~~~d~~~~~d~~~~~~~~~~~~~~~~~~~~~d~P~a~d-------~~l   73 (196)
T pfam00485         1 IIGVAGSSGAGKTTVARTFVSIFGREGVPAAGIEGDSFHRYDRFYMDLHMEDRKRAGNNHYSFFSPEAND-------FDL   73 (196)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECHHCCCCCHHHHHHCCCCCCCCCCCCCCC-------HHH
T ss_conf             9899899857199999999999660587764124317986041024437576765145788978966235-------999


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCC---CHHHHHHHHHHHCCC--CCCCEEEEEEECHHHHHHHHHHHHHH
Q ss_conf             7635655423452587235424310001003444---245776544420388--98411566520348776443211111
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSS---QHLFLDSLQEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSL  153 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~---~~~~i~~l~~~~~~~--~~PDl~i~Ldv~~e~a~~Ri~~R~~~  153 (225)
                      +.+.+. .|.+|+-|-.-.|-+++--.......+   +--.++-+.-+....  ...|+.||+|++.++.+.|...|...
T Consensus        74 l~~~l~-~Lk~g~~i~~P~Ydf~~~~r~~~~~~i~p~~viIvEGi~~l~~~~ir~l~D~kIfid~~~d~rl~RRi~RD~~  152 (196)
T pfam00485        74 LYEQFK-ELKEGGSGDKPIYNHVTGEADPWPELIEGADILFIEGLHGLYDERVAQLLDLKIYVDPDIDLELIQKIQRDMA  152 (196)
T ss_pred             HHHHHH-HHHCCCCEEEEEEECCCCCCCCCCEECCCCCEEEEECHHHCCCHHHHHHHCEEEEEECCCCHHHHHHHHHCHH
T ss_conf             999999-9708994576567513453367736617885699943333032778876384799726801999999873457


Q ss_pred             HHCCHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             00000000211288999999999999999
Q gi|254780218|r  154 RESACLDYFERKDVMIHEKRRQIFLDIAR  182 (225)
Q Consensus       154 ~~~~~~d~~E~~~~~~~~kv~~~y~~la~  182 (225)
                      ..+...+..    ...+..|+-.|.+...
T Consensus       153 eRgrs~~~v----~~q~~~v~p~~~~fI~  177 (196)
T pfam00485       153 ERGHSLEGV----TDSIERRKPDYVNYIC  177 (196)
T ss_pred             HHCCCHHHH----HHHHHHHHHHHHHHCC
T ss_conf             519999999----9999997253896474


No 92 
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=98.48  E-value=1e-06  Score=60.40  Aligned_cols=149  Identities=21%  Similarity=0.174  Sum_probs=70.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99867888797999999999999779819998778898441001100124445410134567778899999776356554
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPA   86 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p~   86 (225)
                      |++-|+.||||||..+.|++.|   +++++-+..-=-...|..|.+++...+...+            |. .=.+++...
T Consensus         2 I~LiG~~G~GKstigk~la~~l---~~~fiD~D~~Ie~~~g~si~eif~~~Ge~~F------------R~-~E~~~l~~~   65 (154)
T cd00464           2 IVLIGMMGAGKTTVGRLLAKAL---GLPFVDLDELIEQRAGMSIPEIFAEEGEEGF------------RE-LEREVLLLL   65 (154)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH---CCCEEECCHHHHHHHCCCHHHHHHHCCHHHH------------HH-HHHHHHHHH
T ss_conf             8998899998899999999997---9897968599999949999999987493878------------99-999999998


Q ss_pred             HCCCCEEEECCCCCCCEEHHCCCCCCC--HHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             234525872354243100010034442--457765444203889841156652034877644321111100000000211
Q gi|254780218|r   87 LMEGKILLCDRFLDSSYAYQGERDSSQ--HLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFER  164 (225)
Q Consensus        87 L~~g~iVI~DRy~~S~lAYQ~~~~~~~--~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~  164 (225)
                      +.....||+=          |  .+..  .+..+.+.       .-..+|||++|+++..+|+.....+.--...+. +.
T Consensus        66 ~~~~~~VIs~----------G--GG~v~~~~~~~~l~-------~~~~vI~L~~~~~~l~~Rl~~~~~RPll~~~~~-~~  125 (154)
T cd00464          66 LTKENAVIAT----------G--GGAVLREENRRLLL-------ENGIVVWLDASPEELLERLARDKTRPLLQDEDP-ER  125 (154)
T ss_pred             HCCCCEEEEC----------C--CCCCCCHHHHHHHH-------HCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCH-HH
T ss_conf             5689859973----------8--97336899999999-------579089995799999999607999998889999-99


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHH
Q ss_conf             28899999999999999978994999818-97889
Q gi|254780218|r  165 KDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQ  198 (225)
Q Consensus       165 ~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~e  198 (225)
                       -..++.+-+..|.+.|.      .+||+ +++++
T Consensus       126 -l~~l~~~R~~~Y~~~Ad------~~i~~~~~s~~  153 (154)
T cd00464         126 -LRELLEEREPLYREVAD------LTIDTDELSPE  153 (154)
T ss_pred             -HHHHHHHHHHHHHHHCC------EEEECCCCCCC
T ss_conf             -99999999999998799------99979898999


No 93 
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family; InterPro: IPR006001    This family of proteins includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases (IPR000577 from INTERPRO).; GO: 0016301 kinase activity, 0005975 carbohydrate metabolic process.
Probab=98.46  E-value=4.1e-06  Score=56.73  Aligned_cols=162  Identities=22%  Similarity=0.253  Sum_probs=86.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCHHHHCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9986788879799999999999977981999877889844-1001100124---44541013456777889999977635
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-AEAARHVLLS---CGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~-ge~ir~~l~~---~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      ||+=|+=||||||.+..|++.|.+--.+..++ | |+..+ .+-|.++=.+   +..+ --|+...          +.+.
T Consensus         1 ~VlmGvaG~GKs~~a~~l~~~lg~iyPd~~yi-e-GDdLHP~~Ni~KMs~GiPL~DdD-R~pWL~~----------l~~~   67 (175)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHRLGDIYPDAKYI-E-GDDLHPAANIEKMSRGIPLNDDD-RWPWLKN----------LADA   67 (175)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHHHHCCCCCCC-C-CCCCCCHHHHHHHCCCCCCCCCC-CHHHHHH----------HHHH
T ss_conf             96760278628899999999854315788756-8-86667877798731788887012-0437999----------9999


Q ss_pred             HHHHHCCCC----EEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCE-EEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             655423452----58723542431000100344424577654442038898411-5665203487764432111110000
Q gi|254780218|r   83 IRPALMEGK----ILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDC-TIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        83 I~p~L~~g~----iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl-~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                      .....++++    +|-|     |         .+...+-|-|.+- .....|.+ .|||..+.++..+|...|.+.--. 
T Consensus        68 ~~~~~~~~~~~~~~~~C-----S---------ALKr~YRD~LR~s-~~~~~~~~~FiyL~~~~~~~~~R~~~RkGHFMk-  131 (175)
T TIGR01313        68 LAQAAAKNKVHLVIITC-----S---------ALKRKYRDILRSS-LEEAEPELHFIYLSGSKEVILKRMKSRKGHFMK-  131 (175)
T ss_pred             HHHHHHCCCCCCEEEEE-----E---------CCHHHHHHHHHHH-HCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCC-
T ss_conf             99998457745447884-----0---------1113555665422-026898437886368989999996107899862-


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHH--HHH-CCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             00002112889999999999999--997-89949998189788999999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDI--ARN-QPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~l--a~~-~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                               ..+.+   ..|..|  ... ....+++||.+.++|.+.++..+.+.
T Consensus       132 ---------a~m~~---SQf~~LE~P~~nDE~d~~~vd~~~~~e~~~~~~~~~v~  174 (175)
T TIGR01313       132 ---------ADMLE---SQFEALEEPTANDETDVVTVDIDQPLEAVEEDCLAVVL  174 (175)
T ss_pred             ---------CHHHH---HHHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH
T ss_conf             ---------04789---99997278888888543786068865789999999982


No 94 
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=98.45  E-value=3.2e-06  Score=57.43  Aligned_cols=117  Identities=16%  Similarity=0.149  Sum_probs=60.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-HHHHCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8998678887979999999999997798199987788984410-0110012444541--013456777889999977635
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAE-AARHVLLSCGVDE--FGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge-~ir~~l~~~~~~~--~~~~~~~lLfaadr~~~~~~~   82 (225)
                      +|++-|+-||||||.++.|++.|   |..++-    |+..+.. .+.++-.+...+.  -.++...+         ....
T Consensus         1 liiv~GvsGsGKSTia~~La~~l---g~~~i~----~D~~h~~~n~~km~~G~pL~d~dr~~wl~~l---------~~~~   64 (150)
T cd02021           1 IIVVMGVSGSGKSTVGKALAERL---GAPFID----GDDLHPPANIAKMAAGIPLNDEDRWPWLQAL---------TDAL   64 (150)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH---CCCEEC----CCCCCCHHHHHHHHCCCCCCCCCHHHHHHHH---------HHHH
T ss_conf             98999189999999999999971---995641----5433547689998679998852378999999---------9999


Q ss_pred             HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             6554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   83 IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        83 I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      ....+..|..||.|=   |         .+....-+++.....  -.+-..+||++|+++..+|+.+|.+
T Consensus        65 ~~~~~~~g~~vVv~c---S---------aLk~~yR~~l~~~~~--~~~v~fi~L~~~~~~l~~Rl~~R~~  120 (150)
T cd02021          65 LAKLASAGEGVVVAC---S---------ALKRIYRDILRGGAA--NPRVRFVHLDGPREVLAERLAARKG  120 (150)
T ss_pred             HHHHHHCCCCEEEEE---H---------HHHHHHHHHHHHHCC--CCCEEEEEEECCHHHHHHHHHHCCC
T ss_conf             999984499879984---3---------323999999995276--8985899986999999999984635


No 95 
>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=98.44  E-value=2e-05  Score=52.59  Aligned_cols=166  Identities=17%  Similarity=0.155  Sum_probs=84.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCC---CHHHHHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999977981999877889844100110012444541---01345677788999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE---FGAEAEAIVFAAARLDH   78 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~---~~~~~~~lLfaadr~~~   78 (225)
                      .+++.|.+-|..||||||.++.+...+...|+  +.+       .+..+|..+-  ....   -++...+-++..+-...
T Consensus        10 ~~Pkai~laG~pGAGKS~~~~~~~~~~~~~~~--v~I-------n~D~~r~~~P--~y~~l~~~~~~~~~~~~~~~a~~~   78 (191)
T pfam06414        10 ERPVAVLLGGQPGAGKTELARALLEELGGGNV--VRI-------DPDELRTYHP--DYDELQKADPKDASELTQPDASRW   78 (191)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCCCC--EEE-------CCHHHHHHHH--HHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             69879999579988889999999875378993--897-------1358788777--478655407677899989999999


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             76356554234525872354243100010034442457765444203889841156652034877644321111100000
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
                      .+..+..+++.+.-+|.|-    |+.      . .......+..+...+. .-.++|+.+||++|..|+..|.......+
T Consensus        79 ~~~~~~~a~~~r~n~iieg----T~~------~-~~~~~~~~~~lk~~GY-~v~v~~Va~~~e~S~~r~~~Ry~~~~~~g  146 (191)
T pfam06414        79 VEKLIDYAIERGYNIILEG----TLR------S-PDVARKLARKLKAAGY-EVEVYVVAVPPELSWLGVLDRYEEELAAG  146 (191)
T ss_pred             HHHHHHHHHHCCCCEEEEC----CCC------C-HHHHHHHHHHHHHCCC-EEEEEEEECCHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999997599989857----778------9-7999999999997899-79999998899999999999998510578


Q ss_pred             HHHHHHCCHHHHHH----HHHHHHHHHHHC-CCCEEEECCC
Q ss_conf             00021128899999----999999999978-9949998189
Q gi|254780218|r  159 LDYFERKDVMIHEK----RRQIFLDIARNQ-PDRCHIVDSA  194 (225)
Q Consensus       159 ~d~~E~~~~~~~~k----v~~~y~~la~~~-~~~~~~IDa~  194 (225)
                        |+-  +...|..    +.+....+.+.. -+++.+.|-+
T Consensus       147 --R~v--~~~~hd~~~~~~~~~~~~l~~~~~~d~i~i~~r~  183 (191)
T pfam06414       147 --RRV--PKEVHDAAYNGLPESVEALEREKLFDRILIKDRD  183 (191)
T ss_pred             --CCC--CHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             --748--9999999998599999999966997559998799


No 96 
>PRK06547 hypothetical protein; Provisional
Probab=98.41  E-value=1.2e-06  Score=59.91  Aligned_cols=121  Identities=17%  Similarity=0.138  Sum_probs=66.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      .+|+|.|..||||||++..|++.+.  +..|+.+.            +++ .+. +.++       +...+  ..++++.
T Consensus        16 ~iVaIDG~sGaGKTTLA~~La~~~~--~~~vvHmD------------D~Y-~GW-~gl~-------~~~~~--l~~~VL~   70 (184)
T PRK06547         16 ITVLIDGRSGSGKTTLAGELAACWE--GSQLVHLD------------DLY-PGW-DGLA-------AASEH--VREALLD   70 (184)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCC--CCCEEEEC------------CCC-CCC-CCCH-------HHHHH--HHHHHHH
T ss_conf             9999868998888999999997457--98289705------------777-776-5404-------68999--9999864


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHC----CCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             54234525872354243100010034442457765444203----889841156652034877644321111
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV----QEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~----~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      | |.+|.-+---||-+.+-.+-.. ..++...+--++-...    .-+..|+++|+++|+++.++|...|.+
T Consensus        71 P-l~~G~~~~yr~~DW~~~~~~~~-~~v~~~~~lIvEGvga~~~~~r~~~d~~IWve~~~~~r~~R~l~RDG  140 (184)
T PRK06547         71 P-RALGRPGRWRRWDWANNCPGGW-VTVEPGRRLIIEGVGALTAANRALADLTVWLEGPEALRKQRALTRDP  140 (184)
T ss_pred             H-HCCCCCCEEECCCCCCCCCCCC-EECCCCCCEEEECCCCCCHHHCCCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             6-4189973660621578997875-67378881899662315631314123777774898999999986095


No 97 
>KOG3062 consensus
Probab=98.40  E-value=1.9e-05  Score=52.81  Aligned_cols=163  Identities=15%  Similarity=0.185  Sum_probs=85.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981-99987788984410011001244454101345677788999997763565
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~-v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      +|||.|...|||||.++.|.+.|+++|.+ ++.+..-  -..|      +- ......+...|-    +-|.+..+. +.
T Consensus         3 LVvi~G~P~SGKstrA~~L~~~l~~~~~K~~v~ii~d--eslg------~~-~ns~y~~s~~EK----~lRg~L~S~-v~   68 (281)
T KOG3062           3 LVVICGLPCSGKSTRAVELREALKERGTKQSVRIIDD--ESLG------IE-KNSNYGDSQAEK----ALRGKLRSA-VD   68 (281)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECH--HHCC------CC-CCCCCCCCHHHH----HHHHHHHHH-HH
T ss_conf             6999378888820679999999986255514999541--3217------88-742224457788----889989999-98


Q ss_pred             HHHCCCCEEEECCCCC-CCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             5423452587235424-310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   85 PALMEGKILLCDRFLD-SSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~-S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
                      ..|.++++||||---| -++-||-+-          +.+.+   -.--.+++-+||++.+.+=..+|..+.+.+    | 
T Consensus        69 R~Lsk~~iVI~DslNyIKGfRYeLyC----------~ak~~---~tt~Cvv~t~vp~e~~r~~Ns~~~~p~e~g----y-  130 (281)
T KOG3062          69 RSLSKGDIVIVDSLNYIKGFRYELYC----------EAKAA---RTTYCVVHTAVPQELCREWNSEREDPGEDG----Y-  130 (281)
T ss_pred             HHCCCCCEEEEECCCCCCCCEEEEEE----------EHHCC---CEEEEEEEECCCHHHHHHHCCCCCCCCCCC----C-
T ss_conf             53356868998144411220203655----------10105---446899985279899987514689988899----9-


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCE-----EEE--CCCCCHHHHHHHH
Q ss_conf             1288999999999999999789949-----998--1897889999999
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDRC-----HIV--DSAHSFQSVATNI  204 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~~-----~~I--Da~~~~eei~~~I  204 (225)
                        +.+.++..-..|.+-  +..++|     .++  +.+.+++.|-+.+
T Consensus       131 --~~e~le~L~~RyEeP--~s~NRWDsPLf~ll~~~~~~~~~~I~~al  174 (281)
T KOG3062         131 --DDELLEALVQRYEEP--NSRNRWDSPLFTLLPDVITLPIDDILKAL  174 (281)
T ss_pred             --CHHHHHHHHHHHHCC--CCCCCCCCCCEEEECCCCCCCHHHHHHHH
T ss_conf             --979999999986187--75566668615772465778689999998


No 98 
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism]
Probab=98.40  E-value=8.1e-06  Score=55.00  Aligned_cols=149  Identities=21%  Similarity=0.241  Sum_probs=80.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCHHHHCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             788879799999999999977981999877889844-1001100124445--4101345677788999997763565542
Q gi|254780218|r   11 GIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-AEAARHVLLSCGV--DEFGAEAEAIVFAAARLDHVENVIRPAL   87 (225)
Q Consensus        11 GiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~-ge~ir~~l~~~~~--~~~~~~~~~lLfaadr~~~~~~~I~p~L   87 (225)
                      |.-||||||....|++.|-   .+.+-    |+..+ -+-|.++=.+...  +.--|..+.          +.+.+....
T Consensus         2 GVsG~GKStvg~~lA~~lg---~~fid----GDdlHp~aNi~KM~~GiPL~DdDR~pWL~~----------l~~~~~~~~   64 (161)
T COG3265           2 GVSGSGKSTVGSALAERLG---AKFID----GDDLHPPANIEKMSAGIPLNDDDRWPWLEA----------LGDAAASLA   64 (161)
T ss_pred             CCCCCCHHHHHHHHHHHCC---CCEEC----CCCCCCHHHHHHHHCCCCCCCCHHHHHHHH----------HHHHHHHHH
T ss_conf             8776577799999999809---82333----565699889998727998984112479999----------999999864


Q ss_pred             CCCC--EEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCE-EEEEEECHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             3452--58723542431000100344424577654442038898411-56652034877644321111100000000211
Q gi|254780218|r   88 MEGK--ILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDC-TIILDLPVDIGLKRVQNRYSLRESACLDYFER  164 (225)
Q Consensus        88 ~~g~--iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl-~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~  164 (225)
                      +.|.  +|.|     |.         +...+-+.|..     .-|++ .+||+.++++.++|.+.|.+..-         
T Consensus        65 ~~~~~~vi~C-----SA---------LKr~YRD~LR~-----~~~~~~Fv~L~g~~~~i~~Rm~~R~gHFM---------  116 (161)
T COG3265          65 QKNKHVVIAC-----SA---------LKRSYRDLLRE-----ANPGLRFVYLDGDFDLILERMKARKGHFM---------  116 (161)
T ss_pred             CCCCCEEEEC-----HH---------HHHHHHHHHHC-----CCCCEEEEEECCCHHHHHHHHHHCCCCCC---------
T ss_conf             2798169962-----78---------87889999854-----59973899963889999999876056778---------


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCC---CEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             2889999999999999997899---499981897889999999999999
Q gi|254780218|r  165 KDVMIHEKRRQIFLDIARNQPD---RCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       165 ~~~~~~~kv~~~y~~la~~~~~---~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                       ..+.   +...|..|  +.|.   .++.||.+.++++|.+++.+.+.+
T Consensus       117 -~~~l---l~SQfa~L--E~P~~de~vi~idi~~~~e~vv~~~~~~l~~  159 (161)
T COG3265         117 -PASL---LDSQFATL--EEPGADEDVLTIDIDQPPEEVVAQALAWLKE  159 (161)
T ss_pred             -CHHH---HHHHHHHH--CCCCCCCCEEEEECCCCHHHHHHHHHHHHHC
T ss_conf             -8899---99899983--5899998879864899989999999999861


No 99 
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional
Probab=98.39  E-value=6.1e-06  Score=55.72  Aligned_cols=113  Identities=18%  Similarity=0.254  Sum_probs=61.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      |=|++=|+-||||||.-+.|++.|   |++++-+..-=-...|..|.+++-.        ..|.. |   | +.=.+++.
T Consensus         1 m~I~LiG~mGaGKTtvGr~LA~~L---~~~FvD~D~~Ie~~~G~sI~eIF~~--------~GE~~-F---R-~~E~~~l~   64 (488)
T PRK13951          1 MRIFLVGMMGSGKSTIGKRISEVL---DLQFIDMDEEIERREGRSVRRIFEE--------DGEEY-F---R-LKEKELLR   64 (488)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCEEECHHHHHHHHCCCHHHHHHH--------HCHHH-H---H-HHHHHHHH
T ss_conf             949998999998779999999983---9795647799999859988899988--------78899-9---9-99999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             5423452587235424310001003444245776544420388984115665203487764432111
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRY  151 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~  151 (225)
                      ..+.....||+-          |.+.-++.+....+.+        ..++||++||++..+|+..+.
T Consensus        65 ~l~~~~~~Viat----------GGGavl~~~nr~~L~~--------~~vV~L~a~~e~l~~R~~~~~  113 (488)
T PRK13951         65 ELVERDNVVVAT----------GGGVVIDPENRELLKK--------EKTLFLYAPPEVLMERVTTEN  113 (488)
T ss_pred             HHHCCCCEEEEC----------CCCCCCCHHHHHHHHC--------CCEEEEECCHHHHHHHHCCCC
T ss_conf             986089969976----------9823289999999964--------988999899999999837899


No 100
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional
Probab=98.39  E-value=5.3e-05  Score=50.12  Aligned_cols=173  Identities=15%  Similarity=0.189  Sum_probs=94.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99867888797999999999999779819998778898441001100124---445410134567778899999776356
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS---CGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~---~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      |||-|..-+||||+++.|++++..             +..-|..|+.+-.   +....+.+ .+....|....+..... 
T Consensus       234 VvIlG~ESTGKTTL~~~LA~~ynT-------------~~v~EYgReY~~ek~~~~e~~l~~-~D~~~IA~gQ~~~e~~a-  298 (411)
T PRK08099        234 VAILGGESSGKSTLVNKLANIFNT-------------TSAWEYGRDYVFSHLGGDEIALQY-SDYDKIALGHAQYIDFA-  298 (411)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCC-------------CCCHHHHHHHHHHHHCCCCCCCCH-HHHHHHHHHHHHHHHHH-
T ss_conf             999899988889999999999789-------------951898999999971897456888-89999999999999998-


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             55423452587235424310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
                        +..++++++||=-..+|.+|.-.-.+-...+++.+..    ..+.|++|+++.+..  .   ...+.+..+...+   
T Consensus       299 --~~~AnklLFcDTD~ltT~vyse~Y~g~~~P~l~~~a~----~~~yDL~Lll~~Dvp--w---VdDGlRd~~~~~~---  364 (411)
T PRK08099        299 --VKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALID----EYRFDLVILLENNTP--W---VADGLRSLGSSVD---  364 (411)
T ss_pred             --HHCCCCEEEEECCHHHHHHHHHHHCCCCCHHHHHHHH----HCCCCEEEEECCCCC--C---CCCCCCCCCCHHH---
T ss_conf             --7505976998384999999999973899889999986----358778998089987--5---5678766678889---


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             1288999999999999999789949998189788999999999999999864
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR  215 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~  215 (225)
                            ..+..+.+.++..++...++.|++ .+-.+-..+..+.|+++|+.+
T Consensus       365 ------R~~f~~~lk~lL~k~ni~yv~I~~-~~y~eR~~kAi~~Id~lL~~~  409 (411)
T PRK08099        365 ------RKRFQNLLVEMLEENNIEYVRVES-PDYDARFLRCVELVDQMLGEQ  409 (411)
T ss_pred             ------HHHHHHHHHHHHHHCCCCEEEEEC-CCHHHHHHHHHHHHHHHHHCC
T ss_conf             ------999999999999981997699717-888999999999999997148


No 101
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]
Probab=98.37  E-value=4.3e-05  Score=50.67  Aligned_cols=175  Identities=19%  Similarity=0.215  Sum_probs=85.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCH--------HHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             9888689986788879799999999999977981999877889844100--------11001244454101345677788
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEA--------ARHVLLSCGVDEFGAEAEAIVFA   72 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~--------ir~~l~~~~~~~~~~~~~~lLfa   72 (225)
                      |+--|.+|+-|+.|+||||..+.+.+.|  -+++.+-.    |+-..|.        .|+-+.   ..+...+.+.-.-|
T Consensus         1 mk~~kvvvitGVpGvGKTTVl~~~~~~l--~~~~ivNy----G~~Mle~A~k~glve~rD~~R---klp~e~Q~~lq~~A   71 (189)
T COG2019           1 MKGRKVVVITGVPGVGKTTVLKIALKEL--VKHKIVNY----GDLMLEIAKKKGLVEHRDEMR---KLPLENQRELQAEA   71 (189)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH--HHCEEEEH----HHHHHHHHHHHCCCCCHHHHH---CCCHHHHHHHHHHH
T ss_conf             9975599997579887266999999877--52200007----699999999838720289885---29888999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCC-CCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             9999977635655423452587235424-310001003444245776544420388984115665203487764432111
Q gi|254780218|r   73 AARLDHVENVIRPALMEGKILLCDRFLD-SSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRY  151 (225)
Q Consensus        73 adr~~~~~~~I~p~L~~g~iVI~DRy~~-S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~  151 (225)
                      |-|       |.. ... . ||.|-... -|=+  |+--+++.    |+    ...+.||..+.|-.+|++.+.|..+..
T Consensus        72 a~r-------I~~-~~~-~-iivDtH~~IkTP~--GylpgLP~----~V----l~~l~pd~ivllEaDp~~Il~RR~~D~  131 (189)
T COG2019          72 AKR-------IAE-MAL-E-IIVDTHATIKTPA--GYLPGLPS----WV----LEELNPDVIVLLEADPEEILERRLRDS  131 (189)
T ss_pred             HHH-------HHH-HHC-C-EEEECCCEECCCC--CCCCCCCH----HH----HHHCCCCEEEEEECCHHHHHHHHHCCC
T ss_conf             999-------997-420-6-5873241114787--66778839----99----975298879999379899999872261


Q ss_pred             HHHHCCHHHHHHH-CCHHHHHHH-HHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHH
Q ss_conf             1100000000211-288999999-99999999978994999818-9788999999999999
Q gi|254780218|r  152 SLRESACLDYFER-KDVMIHEKR-RQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVW  209 (225)
Q Consensus       152 ~~~~~~~~d~~E~-~~~~~~~kv-~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~  209 (225)
                      .+..    | +|+ +++.-|+.. |-+--..|-.....+.+|.. +..+|+-..+|...+.
T Consensus       132 ~r~R----d-~es~e~i~eHqe~nR~aA~a~A~~~gatVkIV~n~~~~~e~Aa~eiv~~l~  187 (189)
T COG2019         132 RRDR----D-VESVEEIREHQEMNRAAAMAYAILLGATVKIVENHEGDPEEAAEEIVELLD  187 (189)
T ss_pred             CCCC----C-CCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             2046----6-210899999999999999999997088489974788887888999999985


No 102
>TIGR00017 cmk cytidylate kinase; InterPro: IPR003136   This family consists of cytidylate kinase (2.7.4.14 from EC), which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors .; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=98.35  E-value=1e-05  Score=54.38  Aligned_cols=31  Identities=29%  Similarity=0.446  Sum_probs=26.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             8868998678887979999999999997798199
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      +.|.|+|.||-||||||.|+.+++.|   +|..+
T Consensus         1 ~~~~IAIDGPs~aGKStvak~~A~~L---~y~yl   31 (223)
T TIGR00017         1 MKMIIAIDGPSGAGKSTVAKAVAEKL---GYKYL   31 (223)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHC---CCEEE
T ss_conf             98637623776465578999999862---95021


No 103
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN; InterPro: IPR012699   Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds , including phosphites as well as phosphonates. PhnN in Escherichia coli shows considerable homology to guanylate kinases (2.7.4.8 from EC), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP..
Probab=98.34  E-value=5.2e-06  Score=56.13  Aligned_cols=170  Identities=21%  Similarity=0.313  Sum_probs=96.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE-----EECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHH----
Q ss_conf             8689986788879799999999999977981999-----8778898441001100124445410134567778899----
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-----TREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAA----   74 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~-----~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaad----   74 (225)
                      |.||.+=|+-||||-|+.....+.|.... .+++     || |. +--||- -.++-   ...|......-+||-.    
T Consensus         1 G~li~vvGPSGaGKDtLl~~AR~~l~~~~-r~~F~rRvITR-~a-~AggEn-H~Als---~~EF~~~~~~G~FAl~W~AH   73 (183)
T TIGR02322         1 GRLIYVVGPSGAGKDTLLDYARARLAGDP-RVHFVRRVITR-PA-DAGGEN-HDALS---TEEFDAREDGGAFALSWQAH   73 (183)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHCCCC-CEEEEEEEEEC-CC-CCCCCC-CCCCC---HHHHHHHHHCCCEEEEEECC
T ss_conf             93789970778867789999999704899-65883127743-75-224667-64047---78999997189818986136


Q ss_pred             -HHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC-EEEEEEECHHHHHHHHHHHHH
Q ss_conf             -999776356554234525872354243100010034442457765444203889841-156652034877644321111
Q gi|254780218|r   75 -RLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD-CTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        75 -r~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD-l~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                       -.+=+--.|..+|.+|..|+..               .....+..+..-+     |. +++.|+++|++.-+|...|+.
T Consensus        74 GL~YGiP~eid~wL~~G~~Vv~N---------------GSRa~Lp~ar~rY-----p~L~~V~Ita~~dVLa~RL~~RgR  133 (183)
T TIGR02322        74 GLSYGIPVEIDQWLEAGDVVVVN---------------GSRAVLPEARQRY-----PNLLVVNITASPDVLAQRLAARGR  133 (183)
T ss_pred             CCCCCCCHHHHHHHHCCCEEEEE---------------CHHHHHHHHHHHH-----HCCEEEEEECCHHHHHHHHHHHCC
T ss_conf             74357830378787549989997---------------5288999998743-----246027874581289999997589


Q ss_pred             HHHCCHHHHHHHCCHHHHHHHHHHHH-HHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             10000000021128899999999999-99997899499981897889999999999999
Q gi|254780218|r  153 LRESACLDYFERKDVMIHEKRRQIFL-DIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       153 ~~~~~~~d~~E~~~~~~~~kv~~~y~-~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      .....-..|.+.         .+.|. .|.-. |..|++||.+.+.+.=-+.++..|.+
T Consensus       134 E~~~~I~~RL~R---------s~~~~~dll~~-~~dv~~i~NsG~~~~ag~~L~~ll~~  182 (183)
T TIGR02322       134 ESAEEIEERLAR---------SARFAGDLLLE-PADVTTIDNSGSLEVAGETLLRLLRK  182 (183)
T ss_pred             CCHHHHHHHHHH---------HHHHCCHHHCC-CCCEEEEECCHHHHHHHHHHHHHHHC
T ss_conf             898899999887---------75311022005-98727984680278999999999853


No 104
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=98.34  E-value=1e-05  Score=54.38  Aligned_cols=100  Identities=21%  Similarity=0.164  Sum_probs=53.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899867888797999999999999779819998778898441001100124445410--134567778899999776356
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF--GAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~--~~~~~~lLfaadr~~~~~~~I   83 (225)
                      .|+|.|+-||||||.++.|++.|   |+.++-+        | .||..-.+.....+  .|.....        .... .
T Consensus         1 iIaIdGpagsGKsT~ak~lA~~l---~~~~ldt--------G-~ir~~ev~~~~s~ia~~~~VR~~--------l~~~-Q   59 (147)
T cd02020           1 IIAIDGPAGSGKSTVAKLLAKKL---GLPYLDT--------G-GIRTEEVGKLASEVAAIPEVRKA--------LDER-Q   59 (147)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH---CCEEECC--------C-CCCCHHHHHHHHHHCCCHHHHHH--------HHHH-H
T ss_conf             98886899789899999999990---9907766--------5-42548998999998197889999--------9999-9


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHH
Q ss_conf             554234525872354243100010034442457765444203889841156652034877644321
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQN  149 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~  149 (225)
                      +..-..+.+| +|              |-+.-   |+     -+|..|+=|||++++++..+|...
T Consensus        60 r~~~~~~~~V-~e--------------GRDig---tv-----V~P~A~lKifL~As~e~RA~RR~~  102 (147)
T cd02020          60 RELAKKPGIV-LE--------------GRDIG---TV-----VFPDADLKIFLTASPEVRAKRRAK  102 (147)
T ss_pred             HHHHHCCCEE-EE--------------CCCCC---CE-----ECCCCCEEEEEECCHHHHHHHHHH
T ss_conf             9997669968-97--------------13101---02-----446747677775898999999999


No 105
>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional
Probab=98.34  E-value=1.9e-05  Score=52.75  Aligned_cols=168  Identities=18%  Similarity=0.199  Sum_probs=87.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-------ECCCCCCCCCHHHHCC----CCCCCCCCHHHHHH-HHHHH
Q ss_conf             899867888797999999999999779819998-------7788984410011001----24445410134567-77889
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-------REPGGTPAAEAARHVL----LSCGVDEFGAEAEA-IVFAA   73 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-------~eP~~t~~ge~ir~~l----~~~~~~~~~~~~~~-lLfaa   73 (225)
                      .|.+.|.-||||||.++.|.    +.|..|+-.       -+||+ +.-+.|.+.+    ++ ..+.++..... ..|.-
T Consensus         3 ~IGLTGGIgsGKStv~~~l~----~~G~~viDaD~iar~v~~pg~-~~~~~iv~~FG~~il~-~dG~ldR~~L~~~vF~d   76 (394)
T PRK03333          3 RIGLTGGIGAGKSTVSATLA----QLGAVVVDGDVLAREVVEPGT-EGLAALVEAFGDDILL-ADGALDRPALAAKAFAD   76 (394)
T ss_pred             EEEEECCCCCCHHHHHHHHH----HCCCEEEEHHHHHHHHHCCCH-HHHHHHHHHHCHHHHC-CCCCCCHHHHHHHHHCC
T ss_conf             99830675557999999999----879949985799999943986-8999999985989638-89735699999888389


Q ss_pred             -HHHHHHHHHHHHHH-----------CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHH
Q ss_conf             -99997763565542-----------345258723542431000100344424577654442038898411566520348
Q gi|254780218|r   74 -ARLDHVENVIRPAL-----------MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVD  141 (225)
Q Consensus        74 -dr~~~~~~~I~p~L-----------~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e  141 (225)
                       .....++.++-|..           ....+|+.|==.                    |.. .-....-|.++..++|++
T Consensus        77 ~~~~~~Ln~I~HP~Vr~~~~~~~~~~~~~~vvv~DiPL--------------------L~E-~~~~~~~d~VvvV~~p~e  135 (394)
T PRK03333         77 DEARAVLNGIVHPLVAARRAELIAAAPEDAVVVEDIPL--------------------LVE-SGMAPLFPLVVVVHADVE  135 (394)
T ss_pred             HHHHHHHHHHHCHHHHHHHHHHHHHCCCCCEEEEEECH--------------------HEE-CCCCCCCCEEEEEECCHH
T ss_conf             99999998615899999999999855799779994001--------------------132-263036997999989889


Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             77644321111100000000211288999999999999999789949998189788999999999999999
Q gi|254780218|r  142 IGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV  212 (225)
Q Consensus       142 ~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l  212 (225)
                      +.++|...|.+..+....-|+..+--. -+       +.+  .-+  ++||.+.+++++.+++-..-...|
T Consensus       136 ~qv~RL~~r~gls~~~A~aRIaaQ~~~-e~-------r~a--~AD--~VIDNsGt~~~l~~~v~~lW~~rl  194 (394)
T PRK03333        136 VRVRRLVEQRGMAEADARARIAAQASD-EQ-------RRA--AAD--VWLDNSGTPEELVEAVRDLWADRL  194 (394)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHCCCH-HH-------HHH--HCC--EEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             999999863798999999999947999-99-------998--599--999698999999999999999742


No 106
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional
Probab=98.30  E-value=7.4e-06  Score=55.21  Aligned_cols=81  Identities=10%  Similarity=0.084  Sum_probs=43.0

Q ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHH-----CCCCEEEECC-CCCHHHH
Q ss_conf             898411566520348776443211111000000002112889999999999999997-----8994999818-9788999
Q gi|254780218|r  127 EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN-----QPDRCHIVDS-AHSFQSV  200 (225)
Q Consensus       127 ~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~-----~~~~~~~IDa-~~~~eei  200 (225)
                      +|..++=|||++++++.-+|.-.--.  ..+..-.||.  +...-+-|+.- ...+.     -+.--.+||+ +.++|||
T Consensus       571 fPdA~~K~fl~As~~~RA~RR~~ql~--~~g~~~~~~~--v~~~i~~RD~~-D~~R~~sPL~~a~dAi~iDts~l~i~ev  645 (662)
T PRK11860        571 FPDAALKVFLTASAEARAERRYKQLI--SKGISANIAS--LRADLEARDAR-DANRSVAPLKPAQDALLLDNSDLTIEEA  645 (662)
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHH--HCCCCCCHHH--HHHHHHHHHHH-HCCCCCCCCCCCCCEEEEECCCCCHHHH
T ss_conf             88998559998999999999999999--7699889999--99999986042-2447768875589818997989999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q gi|254780218|r  201 ATNILNIVWELV  212 (225)
Q Consensus       201 ~~~I~~~i~~~l  212 (225)
                      .++|++.+++.+
T Consensus       646 v~~il~~~~~~~  657 (662)
T PRK11860        646 VNQVLDWWQERQ  657 (662)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999557


No 107
>KOG3354 consensus
Probab=98.30  E-value=1.4e-05  Score=53.58  Aligned_cols=163  Identities=20%  Similarity=0.225  Sum_probs=86.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC----CHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             899867888797999999999999779819998778898441----0011001244454101345677788999997763
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAA----EAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~g----e~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      .|++-|.-||||||..+.|.+.|.-.-++       |++.+.    |.+++-+--+..+.+ |+          .+.+..
T Consensus        14 ~i~vmGvsGsGKSTigk~L~~~l~~~F~d-------gDd~Hp~~NveKM~~GipLnD~DR~-pW----------L~~i~~   75 (191)
T KOG3354          14 VIVVMGVSGSGKSTIGKALSEELGLKFID-------GDDLHPPANVEKMTQGIPLNDDDRW-PW----------LKKIAV   75 (191)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCCC-------CCCCCCHHHHHHHHCCCCCCCCCCC-HH----------HHHHHH
T ss_conf             59998358877445999999985886245-------5557987889988369988853211-79----------999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHH---HHCCCCCCC---EEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             56554234525872354243100010034442457765444---203889841---156652034877644321111100
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE---ISVQEVMPD---CTIILDLPVDIGLKRVQNRYSLRE  155 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~---~~~~~~~PD---l~i~Ldv~~e~a~~Ri~~R~~~~~  155 (225)
                      ..+.++++|.-|+        +|+.    .+...+-+-+..   .....-.|.   ..+||.++.|+..+|..+|.+..-
T Consensus        76 ~~~~~l~~~q~vV--------lACS----aLKk~YRdILr~sl~~gk~~~~~~~~l~fi~l~~s~evi~~Rl~~R~gHFM  143 (191)
T KOG3354          76 ELRKALASGQGVV--------LACS----ALKKKYRDILRHSLKDGKPGKCPESQLHFILLSASFEVILKRLKKRKGHFM  143 (191)
T ss_pred             HHHHHHHCCCEEE--------EEHH----HHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCCC
T ss_conf             9998763278189--------9728----888999999973211478667864058886330429999999840666668


Q ss_pred             CCHHHHHHHCCHHHHHHHHHHHHHHHHHCC--CCEEEECCC-CCHHHHHHHHHHHHHHH
Q ss_conf             000000211288999999999999999789--949998189-78899999999999999
Q gi|254780218|r  156 SACLDYFERKDVMIHEKRRQIFLDIARNQP--DRCHIVDSA-HSFQSVATNILNIVWEL  211 (225)
Q Consensus       156 ~~~~d~~E~~~~~~~~kv~~~y~~la~~~~--~~~~~IDa~-~~~eei~~~I~~~i~~~  211 (225)
                                ..+.++   ..|..|-....  ..++.|+.. .++|++...|.+.+...
T Consensus       144 ----------p~~lle---SQf~~LE~p~~~e~div~isv~~~~~e~iv~tI~k~~~~~  189 (191)
T KOG3354         144 ----------PADLLE---SQFATLEAPDADEEDIVTISVKTYSVEEIVDTIVKMVALN  189 (191)
T ss_pred             ----------CHHHHH---HHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             ----------878999---8887526999982466888603478999999999999853


No 108
>pfam01121 CoaE Dephospho-CoA kinase. This family catalyses the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form Coenzyme A EC:2.7.1.24. This enzyme uses ATP in its reaction.
Probab=98.28  E-value=2.1e-06  Score=58.44  Aligned_cols=135  Identities=19%  Similarity=0.285  Sum_probs=68.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC-------CCCCCCCCHHHHCCCC---CCCCCCHHHHHH-HHHH-
Q ss_conf             689986788879799999999999977981999877-------8898441001100124---445410134567-7788-
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE-------PGGTPAAEAARHVLLS---CGVDEFGAEAEA-IVFA-   72 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e-------P~~t~~ge~ir~~l~~---~~~~~~~~~~~~-lLfa-   72 (225)
                      |+|++.|.-||||||.++.|.    +.|++|+-...       |+ ++.-+.+++.+-.   ...+.++..... ++|. 
T Consensus         1 ~iIgiTG~IgsGKStv~~~l~----~~G~~vidaD~i~~~l~~~~-~~~~~~i~~~fg~~i~~~~g~idr~~L~~~vF~d   75 (179)
T pfam01121         1 LIVGLTGGIGSGKSTVANLFA----DLGVPIVDADVIARQVVEPG-SPALAAIVDHFGPDILLADGQLDRRALRELVFSD   75 (179)
T ss_pred             CEEEEECCCCCCHHHHHHHHH----HCCCCEEECHHHHHHHHHCC-HHHHHHHHHHHCHHHCCCCCCCCHHHHHHHHHCC
T ss_conf             989985786478999999999----87991991809999998658-5899999998199860778865799999998548


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             99999776356554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   73 AARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        73 adr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      ......++.++-|...+...-.+...-.+..++     ..+..+    +  ......-|.+++..+|.++..+|+.+|.+
T Consensus        76 ~~~~~~Le~iiHP~v~~~~~~~i~~~~~~~~v~-----eipLL~----E--~~~~~~~D~ii~V~a~~~~r~~Rl~~R~~  144 (179)
T pfam01121        76 PEEKQWLNAILHPLIRREMFKQLAQLTSPYVLL-----DVPLLF----E--SGLTKLCHRVLVVDAPVELQVERLMQRDG  144 (179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE-----ECCCHH----C--CCCCCCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             799999998625999999999998668996999-----445022----0--67653477599998799999999998059


Q ss_pred             HHH
Q ss_conf             100
Q gi|254780218|r  153 LRE  155 (225)
Q Consensus       153 ~~~  155 (225)
                      ..+
T Consensus       145 ~s~  147 (179)
T pfam01121       145 LSR  147 (179)
T ss_pred             CCH
T ss_conf             999


No 109
>PRK07429 phosphoribulokinase; Provisional
Probab=98.26  E-value=1.3e-05  Score=53.77  Aligned_cols=145  Identities=17%  Similarity=0.227  Sum_probs=77.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      +|+.+|.|-|--||||||.++.|.+.|....  |.++..=+.-..-..-|..   .+...++|.+.-+       +.+.+
T Consensus         6 ~rP~IIGIAGgSGSGKTTv~r~I~~~fg~~~--VtvI~~DdYhk~dr~~r~~---~~~t~lhP~And~-------dLl~e   73 (331)
T PRK07429          6 DRPVIIGVAGDSGCGKSTFLRRLADLFGEEL--VTVICLDDYHSLDRKQRKE---IGITALDPRANNF-------DLMYE   73 (331)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHCCCC--EEEEECCCCCCCCHHHHHH---CCCCCCCCCHHCH-------HHHHH
T ss_conf             9998999857887789999999999838887--7999478677788788987---1898789640059-------99999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCCCCC---CHHHHHHHHHHHCCCC--CCCEEEEEEECHHHHHHHHHHHHHHHHC
Q ss_conf             5655423452587235424310001003444---2457765444203889--8411566520348776443211111000
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGERDSS---QHLFLDSLQEISVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRES  156 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~---~~~~i~~l~~~~~~~~--~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~  156 (225)
                      .+ .+|.+|+.|-.=-|-+++=-.... ..+   +--.++-+.-+.....  .-|+.||+|+|.++.+.|...|.-.+.+
T Consensus        74 ~L-~~Lk~Gk~I~~PvYdh~tg~~~~~-~~I~P~~vIIvEGLh~L~~~~lR~l~DlKIFVD~d~diR~~rRI~RDv~ERG  151 (331)
T PRK07429         74 QL-KALKTGQPILKPIYNHETGKIDPP-EYIKPNKIVVVEGLHPLYDERVRDLYDFKVYLDPPDEVKIAWKIKRDMAERG  151 (331)
T ss_pred             HH-HHHHCCCCCCCCCCCCCCCCCCCC-EEECCCCEEEEECCHHCCCHHHHHHCCEEEEECCCHHHHHHHHHHHHHHHHC
T ss_conf             99-999859972565235647877886-6606886799916121287989975493799648788999998887786618


Q ss_pred             CHHH
Q ss_conf             0000
Q gi|254780218|r  157 ACLD  160 (225)
Q Consensus       157 ~~~d  160 (225)
                      ...+
T Consensus       152 ~s~E  155 (331)
T PRK07429        152 HTYE  155 (331)
T ss_pred             CCHH
T ss_conf             9999


No 110
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=98.17  E-value=1.7e-05  Score=53.05  Aligned_cols=163  Identities=17%  Similarity=0.128  Sum_probs=71.1

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      +.+|.|-|.-||||||.++.|.+.|...  .+.++++=+--. ...-+..-..+..+.-+|.+.-       ++.+.+.+
T Consensus         8 ~iiIgIaG~SgSGKTTv~~~l~~~~~~~--~~~~I~~D~YYk-~~~~~~~~~~~~~n~d~p~A~D-------~dLl~~~L   77 (218)
T COG0572           8 VIIIGIAGGSGSGKTTVAKELSEQLGVE--KVVVISLDDYYK-DQSHLPFEERNKINYDHPEAFD-------LDLLIEHL   77 (218)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHCCC--CCEEEECCCCCC-CHHHCCHHHCCCCCCCCHHHHC-------HHHHHHHH
T ss_conf             6999986798778899999999982867--524765223202-5301667553785744823436-------89999999


Q ss_pred             HHHHCCCCEEEECCCCCCCEEH--HCCCCC-CCHHHHHHHHHHHCCC--CCCCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             5542345258723542431000--100344-4245776544420388--9841156652034877644321111100000
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAY--QGERDS-SQHLFLDSLQEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAY--Q~~~~~-~~~~~i~~l~~~~~~~--~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
                      . .|.+|+.|-.==|-+-+--.  +..... .+--.++-+.-+.-..  ..=|+-+|+|+|.++.+.|...|.-...+..
T Consensus        78 ~-~L~~g~~v~~P~yd~~~~~r~~~~i~~~p~~VIIvEGi~~l~d~~lr~~~d~kIfvdt~~D~RliRri~RD~~~rg~~  156 (218)
T COG0572          78 K-DLKQGKPVDLPVYDYKTHTREPETIKVEPNDVVIVEGILLLYDERLRDLMDLKIFVDTDADVRLIRRIKRDVQERGRD  156 (218)
T ss_pred             H-HHHCCCCCCCCCCCHHCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             9-997699224564203136325773313897289994230015076776606789997783278899888779881999


Q ss_pred             HH-HHHHCCHHHHHHHHHHHHHHH
Q ss_conf             00-021128899999999999999
Q gi|254780218|r  159 LD-YFERKDVMIHEKRRQIFLDIA  181 (225)
Q Consensus       159 ~d-~~E~~~~~~~~kv~~~y~~la  181 (225)
                      .+ .++    .|...|+-.|.+..
T Consensus       157 ~~~vi~----qy~~~vkp~~~~fI  176 (218)
T COG0572         157 LESVIE----QYVKTVRPMYEQFI  176 (218)
T ss_pred             HHHHHH----HHHHHHCHHHHHCC
T ss_conf             899999----99986174146015


No 111
>KOG3220 consensus
Probab=98.16  E-value=1.8e-05  Score=52.97  Aligned_cols=164  Identities=20%  Similarity=0.302  Sum_probs=84.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-------ECCCCCCCCCHHHHC-----CCCCCCCCCHHHH-------
Q ss_conf             899867888797999999999999779819998-------778898441001100-----1244454101345-------
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-------REPGGTPAAEAARHV-----LLSCGVDEFGAEA-------   66 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-------~eP~~t~~ge~ir~~-----l~~~~~~~~~~~~-------   66 (225)
                      ++.+.|.-||||||.++.+    ++.|++|+-.       -+||. |--..|++.     |+..  +.++...       
T Consensus         3 iVGLTGgiatGKStVs~~f----~~~G~~vIDaD~vaR~vv~PG~-p~~~~ive~FG~eiLl~~--G~inR~~LG~~vF~   75 (225)
T KOG3220           3 IVGLTGGIATGKSTVSQVF----KALGIPVIDADVVAREVVEPGT-PAYRRIVEAFGTEILLED--GEINRKVLGKRVFS   75 (225)
T ss_pred             EEEEECCCCCCHHHHHHHH----HHCCCCEECHHHHHHHHHCCCC-HHHHHHHHHHCCEEECCC--CCCCHHHHHHHHHC
T ss_conf             9994056566737999999----9749957627899999855998-078999998484000568--84168998678708


Q ss_pred             ----HH----HHHHHHHHHHHHHHHHHHHCCCC-EEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             ----67----77889999977635655423452-5872354243100010034442457765444203889841156652
Q gi|254780218|r   67 ----EA----IVFAAARLDHVENVIRPALMEGK-ILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILD  137 (225)
Q Consensus        67 ----~~----lLfaadr~~~~~~~I~p~L~~g~-iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ld  137 (225)
                          ..    ..+-+-|.+-.++ +...+..|+ +|+.|               .+.-+-..+.++.      ..|+...
T Consensus        76 ~~~~r~~Ln~IthP~Ir~em~ke-~~~~~l~G~r~ivlD---------------iPLLFE~~~~~~~------~~tvvV~  133 (225)
T KOG3220          76 DPKKRQALNKITHPAIRKEMFKE-ILKLLLRGYRVIVLD---------------IPLLFEAKLLKIC------HKTVVVT  133 (225)
T ss_pred             CHHHHHHHHHCCCHHHHHHHHHH-HHHHHHCCCEEEEEE---------------CHHHHHHHHHHHE------EEEEEEE
T ss_conf             98899998731338999999999-999996688289992---------------2688887677453------2589999


Q ss_pred             ECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             0348776443211111000000002112889999999999999997899499981897889999999999999
Q gi|254780218|r  138 LPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       138 v~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      ||-+..++|...|.+..+.+...|..+. ....+++     ++      .=++||.+.++++..+++......
T Consensus       134 cd~~~Ql~Rl~~Rd~lse~dAe~Rl~sQ-mp~~~k~-----~~------a~~Vi~Nng~~~~l~~qv~~v~~~  194 (225)
T KOG3220         134 CDEELQLERLVERDELSEEDAENRLQSQ-MPLEKKC-----EL------ADVVIDNNGSLEDLYEQVEKVLAL  194 (225)
T ss_pred             ECCHHHHHHHHHHCCCCHHHHHHHHHHC-CCHHHHH-----HH------HHEEECCCCCHHHHHHHHHHHHHH
T ss_conf             8908999999874464699999898732-9878999-----86------316421799868999999999998


No 112
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional
Probab=98.13  E-value=8.9e-05  Score=48.77  Aligned_cols=30  Identities=27%  Similarity=0.412  Sum_probs=25.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             689986788879799999999999977981999
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      .+|+|.|+-||||||.++.|++.|   |+.++-
T Consensus        35 iIIAIDGPAGSGKSTVAk~lA~~L---G~~yLD   64 (863)
T PRK12269         35 VIIALDGPAGSGKSSVCRLLASRL---GAQCLN   64 (863)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHH---CCEEEC
T ss_conf             899986898678899999999982---995887


No 113
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=98.10  E-value=4.2e-05  Score=50.69  Aligned_cols=135  Identities=19%  Similarity=0.212  Sum_probs=61.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCCC-CCCCCHHHHCCCCCCCCCCHHHHH-HHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977--981999877889-844100110012444541013456-77788999997763
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREPGG-TPAAEAARHVLLSCGVDEFGAEAE-AIVFAAARLDHVEN   81 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~--g~~v~~~~eP~~-t~~ge~ir~~l~~~~~~~~~~~~~-~lLfaadr~~~~~~   81 (225)
                      +|.|-|.-||||||.++.|.+.|.+.  +..|.++..=|- -+..+....-+...+ +  .|.+. .-++    .+++. 
T Consensus         1 IIGIaG~sgSGKST~a~~l~~~l~~~~~~~~v~ii~~D~f~~~~~~l~~~~~~~~~-g--~P~afD~~ll----~~~L~-   72 (220)
T cd02025           1 IIGIAGSVAVGKSTTARVLQALLSRWPDHPNVELITTDGFLYPNKELIERGLMDRK-G--FPESYDMEAL----LKFLK-   72 (220)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHC-C--CCHHCCHHHH----HHHHH-
T ss_conf             98978899877999999999986002699948999787875785228886466516-9--9302159999----99999-


Q ss_pred             HHHHHHCCCC-EEE---ECCCCCCCEEHHCC-CCCCCHHHHHHHHHHHCCC-C------CCCEEEEEEECHHHHHHHHHH
Q ss_conf             5655423452-587---23542431000100-3444245776544420388-9------841156652034877644321
Q gi|254780218|r   82 VIRPALMEGK-ILL---CDRFLDSSYAYQGE-RDSSQHLFLDSLQEISVQE-V------MPDCTIILDLPVDIGLKRVQN  149 (225)
Q Consensus        82 ~I~p~L~~g~-iVI---~DRy~~S~lAYQ~~-~~~~~~~~i~~l~~~~~~~-~------~PDl~i~Ldv~~e~a~~Ri~~  149 (225)
                          .|.+|+ .|-   -|+-.++-..-+-. ....+--.++-++-+.... +      .=|+.+|+|+|.++..+|...
T Consensus        73 ----~Lk~G~~~V~~PvYd~~~~~r~~~~~~~i~~~~IiIvEGi~~L~~~~~~~~~i~dl~D~kIfvD~d~d~~~~r~i~  148 (220)
T cd02025          73 ----DIKSGKKNVKIPVYSHLTYDVIPGEKQTVDQPDILIIEGLNVLQTGQNPRLFVSDFFDFSIYVDADEDDIEKWYIK  148 (220)
T ss_pred             ----HHHCCCCCEEEEECCCHHCCCCCCCEEEECCCCEEEEEEEEEECCCCCCHHHHHHHCCEEEEECCCHHHHHHHHHH
T ss_conf             ----9975998534010121212578984287269986998323220165211145675465789807998999999999


Q ss_pred             HHH
Q ss_conf             111
Q gi|254780218|r  150 RYS  152 (225)
Q Consensus       150 R~~  152 (225)
                      |-.
T Consensus       149 R~~  151 (220)
T cd02025         149 RFL  151 (220)
T ss_pred             HHH
T ss_conf             999


No 114
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=98.05  E-value=0.0004  Score=44.88  Aligned_cols=175  Identities=17%  Similarity=0.198  Sum_probs=84.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCH------------HHHHHHHH
Q ss_conf             868998678887979999999999997798199987788984410011001244454101------------34567778
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG------------AEAEAIVF   71 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~------------~~~~~lLf   71 (225)
                      ..+|-|-|.-|+||||.+..|+.+|   |+..+..    ...+-|.+|.++-  ....+.            |..+..+-
T Consensus         3 ~~iiligG~sGvGKStla~~lA~rl---gi~~vis----TD~IRevlR~~i~--~eP~L~~Ssy~A~~~~~~~~~~~ii~   73 (197)
T PRK12339          3 STIHFIGGIPGVGKTSISGYIARHR---AIDIVLS----GDYLREFLRPYVD--DEPVLAKSVYDAWEFYGSMTDENIVK   73 (197)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHC---CCCEEEC----CHHHHHHHHHHCC--CCCCHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             4799985799887899999999974---9975534----3479999998668--87400330467988708965278999


Q ss_pred             -HHHHHH----HHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEC-HHHHHH
Q ss_conf             -899999----77635655423452587235424310001003444245776544420388984115665203-487764
Q gi|254780218|r   72 -AAARLD----HVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLP-VDIGLK  145 (225)
Q Consensus        72 -aadr~~----~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~-~e~a~~  145 (225)
                       ..+.++    -++.+|..++.+|.-+|..          |. +-++. .++..   .....   ..|+|.++ .+.-.+
T Consensus        74 Gf~~q~~~V~~gi~avi~Ra~~eg~slIIE----------GV-HlvP~-~i~~~---~~~~~---~~~~l~i~dee~H~~  135 (197)
T PRK12339         74 GYLDQARAIMPGINRVIRRALLNGEDLVIE----------SL-YFHPP-MIDEN---RTNNI---RAFYLYIRDAELHRS  135 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEE----------EE-EECHH-HHHHH---HHCCE---EEEEEEECCHHHHHH
T ss_conf             999999999999999999999739977998----------52-11778-87788---76595---899999788899999


Q ss_pred             HHHHHHHHHHCC-HHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             432111110000-0000211288999999999999999789949998189788999999999999
Q gi|254780218|r  146 RVQNRYSLRESA-CLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVW  209 (225)
Q Consensus       146 Ri~~R~~~~~~~-~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~  209 (225)
                      |...|....... ..++|-+ .......+++...+-|+++.  |.+||++. +++-.+.|.+.+.
T Consensus       136 Rf~~R~~~~~~~~p~~ry~~-~f~~IR~Iq~ylv~~A~~~~--ipvI~n~~-~d~s~~~i~~~i~  196 (197)
T PRK12339        136 RLADRINYTHKNSPGKRLAE-HLPEYRTIMDYSIADARGYN--IKVIDTDN-YREARNPLLDPIS  196 (197)
T ss_pred             HHHHHHHHCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHCC--CCEECCCC-HHHHHHHHHHHHH
T ss_conf             99998543126771669999-89999999999999888739--98553772-8999999999840


No 115
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=98.05  E-value=2.7e-05  Score=51.91  Aligned_cols=135  Identities=16%  Similarity=0.092  Sum_probs=65.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844100110012444541013456777889999977635655
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP   85 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p   85 (225)
                      +|.|.|.-||||||.++.|.+.|...|..+.++..  +.-.-..  ........+.-+|.+.      | ++.+.+.+. 
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~~~vis~--D~yy~~~--~~~~~~~~n~D~p~a~------d-~~ll~~~L~-   68 (179)
T cd02028           1 VVGIAGPSGSGKTTFAKKLSNQLRVNGIGPVVISL--DDYYVPR--KTPRDEDGNYDFESIL------D-LDLLNKNLH-   68 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC--CCCCCCC--CCCCCCCCCCCCHHHH------H-HHHHHHHHH-
T ss_conf             98998989778999999999998464885399954--6664576--5200014688981353------4-999999999-


Q ss_pred             HHCCCCEEEECCCCCCCEEHHC-CCCCCCH---HHHHHHHHHHC-CCCCCCEEEEEEECHHH-HHHHHHHHHH
Q ss_conf             4234525872354243100010-0344424---57765444203-88984115665203487-7644321111
Q gi|254780218|r   86 ALMEGKILLCDRFLDSSYAYQG-ERDSSQH---LFLDSLQEISV-QEVMPDCTIILDLPVDI-GLKRVQNRYS  152 (225)
Q Consensus        86 ~L~~g~iVI~DRy~~S~lAYQ~-~~~~~~~---~~i~~l~~~~~-~~~~PDl~i~Ldv~~e~-a~~Ri~~R~~  152 (225)
                      .|.+|+-|-.=.|-+++-.... .......   -.++-+.-+.. -...-|+.+|+|++.+. .+.|...|.-
T Consensus        69 ~L~~g~~v~~P~YDf~t~~r~~~~~~~~~p~~vIIvEGi~~l~~~lr~~~D~kIfvd~~~~~~Rl~RRi~RD~  141 (179)
T cd02028          69 DLLNGKEVELPIYDFRTGKRRGYRKLKLPPSGVVILEGIYALNERLRSLLDIRVAVSGGVHLNRLLRRVVRDI  141 (179)
T ss_pred             HHHCCCCEEEEEEECCCCCCCCCCEEEECCCCEEEEECHHHCCHHHHHHCCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9977995575420043786069805960899789992434389989976686999978836888899999779


No 116
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]
Probab=98.04  E-value=0.00022  Score=46.47  Aligned_cols=170  Identities=14%  Similarity=0.130  Sum_probs=86.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCC---C-CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244---4-5410134567778899999776
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSC---G-VDEFGAEAEAIVFAAARLDHVE   80 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~---~-~~~~~~~~~~lLfaadr~~~~~   80 (225)
                      +.++|-|...|||||+++.|++.+..             +..+|-.|......   . .-..+.+...-+   -...-.+
T Consensus         9 K~VailG~ESsGKStLv~kLA~~fnt-------------~~~wEY~Re~v~~~l~gdeal~y~Dy~~ia~---Gq~~~~d   72 (187)
T COG3172           9 KTVAILGGESSGKSTLVNKLANIFNT-------------TSAWEYGREYVFEHLGGDEALQYSDYAKIAL---GQAAYED   72 (187)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCC-------------CCHHHHHHHHHHHHHCCCHHHHHCCHHHHHH---HHHHHHH
T ss_conf             13556457665717999999999688-------------7312778999999848964231043899986---1578888


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCEEHH--CCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             35655423452587235424310001--0034442457765444203889841156652034877644321111100000
Q gi|254780218|r   81 NVIRPALMEGKILLCDRFLDSSYAYQ--GERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        81 ~~I~p~L~~g~iVI~DRy~~S~lAYQ--~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
                      -.   .-...+++|||--+.+|.||-  ..++..+  +++.+-.-    -+=|++++|  +|++..   ...+.+.-+..
T Consensus        73 ~a---v~~a~~v~fiDTD~itT~~~~~~y~gr~~P--~~~~~i~~----~r~DL~lLl--~p~t~w---vaDG~R~~~~~  138 (187)
T COG3172          73 AA---VRYANKVAFIDTDFLTTQAFCKKYEGREHP--FLQALIAE----YRFDLTLLL--EPNTPW---VADGLRSLGSS  138 (187)
T ss_pred             HH---HHCCCCEEEEECCHHHHHHHHHHHCCCCCC--HHHHHHHH----CCCCEEEEC--CCCCCE---ECCCCCCCCCH
T ss_conf             98---727784599734078899999997466784--57788861----666359973--899850---07774536427


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             00021128899999999999999978994999818978899999999999999986
Q gi|254780218|r  159 LDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK  214 (225)
Q Consensus       159 ~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k  214 (225)
                      .+     -..||..+.    ++.+++..++++|++. +-++=..+..+.+.++++.
T Consensus       139 ~~-----R~~F~~~l~----~~L~~~~~~~v~i~~~-~y~eR~~~~~~aV~ell~~  184 (187)
T COG3172         139 VQ-----RQEFQNLLE----QMLEENNIPFVVIEGE-DYLERYLQAVEAVEELLGE  184 (187)
T ss_pred             HH-----HHHHHHHHH----HHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHHHHC
T ss_conf             67-----999999999----9999819967997687-7899999999999999724


No 117
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=98.04  E-value=7.8e-05  Score=49.12  Aligned_cols=169  Identities=18%  Similarity=0.265  Sum_probs=91.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCC-CE---EEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHH-H--
Q ss_conf             8868998678887979999999999997798-19---998778898441001100124445410134567778899-9--
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNY-DV---HVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAA-R--   75 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~-~v---~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaad-r--   75 (225)
                      .|.||++=|+.|+||-|....+...|..... .+   +.|| |.+ .-||- -+.+-   .-.+...+..-+|+-+ .  
T Consensus         4 ~G~lI~vvGPSGAGKDtl~~~ar~~l~~~~r~~fvrRvITR-pa~-ag~Ed-H~avs---~~eF~~~a~~g~FAlsWqAh   77 (192)
T COG3709           4 MGRLIAVVGPSGAGKDTLLDAARARLAGRPRLHFVRRVITR-PAD-AGGED-HDALS---EAEFNTRAGQGAFALSWQAH   77 (192)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECC-CCC-CCCCC-CCCCC---HHHHHHHHHCCCEEEEEHHC
T ss_conf             75499998888777677999999872668745999998646-677-77655-43458---89999885357626773104


Q ss_pred             --HHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC-EEEEEEECHHHHHHHHHHHHH
Q ss_conf             --99776356554234525872354243100010034442457765444203889841-156652034877644321111
Q gi|254780218|r   76 --LDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD-CTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        76 --~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD-l~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                        .+-+--.|..+|+.|.+||..-          -+..+     -....-     .|. +++-+.++|++.-+|..+|+.
T Consensus        78 GL~Ygip~eId~wl~~G~vvl~Ng----------SRa~L-----p~arrr-----y~~Llvv~ita~p~VLaqRL~~RGR  137 (192)
T COG3709          78 GLSYGIPAEIDLWLAAGDVVLVNG----------SRAVL-----PQARRR-----YPQLLVVCITASPEVLAQRLAERGR  137 (192)
T ss_pred             CCCCCCCHHHHHHHHCCCEEEEEC----------CHHHH-----HHHHHH-----HHCCEEEEEECCHHHHHHHHHHHCC
T ss_conf             822257165999985798899826----------27660-----889986-----0032369972487899999998654


Q ss_pred             HHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             1000000002112889999999999999997899499981897889999999999999
Q gi|254780218|r  153 LRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE  210 (225)
Q Consensus       153 ~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~  210 (225)
                      ....         +  ...+....=.  ....+.-|..||.+.+++.--++....+.+
T Consensus       138 Es~e---------e--I~aRL~R~a~--~~~~~~dv~~idNsG~l~~ag~~ll~~l~~  182 (192)
T COG3709         138 ESRE---------E--ILARLARAAR--YTAGPGDVTTIDNSGELEDAGERLLALLHQ  182 (192)
T ss_pred             CCHH---------H--HHHHHHHHCC--CCCCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             7999---------9--9999975143--435899868973898677899999999975


No 118
>COG0645 Predicted kinase [General function prediction only]
Probab=98.03  E-value=8.8e-05  Score=48.81  Aligned_cols=120  Identities=18%  Similarity=0.192  Sum_probs=70.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCC------CCCCCCHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124------445410134567778899999
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS------CGVDEFGAEAEAIVFAAARLD   77 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~------~~~~~~~~~~~~lLfaadr~~   77 (225)
                      ++|+.+-|..|+||||.++-|++.|-.   -.+.         ...+|+-|.+      ...+..++.....-|.     
T Consensus         1 ~~l~l~~Gl~GsGKstlA~~l~~~lgA---~~lr---------sD~irk~L~g~p~~~r~~~g~ys~~~~~~vy~-----   63 (170)
T COG0645           1 GRLVLVGGLPGSGKSTLARGLAELLGA---IRLR---------SDVIRKRLFGVPEETRGPAGLYSPAATAAVYD-----   63 (170)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCC---EEEE---------HHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHH-----
T ss_conf             947997258886586887898853486---6874---------17899872388610148878876788999999-----


Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             776356554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   78 HVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        78 ~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      .....-.-.|..|..||.|--++.            ...-+.....+...-.|-..|.+++|+++...|+.+|..
T Consensus        64 ~l~~~A~l~l~~G~~VVlDa~~~r------------~~~R~~~~~~A~~~gv~~~li~~~ap~~v~~~rl~aR~~  126 (170)
T COG0645          64 ELLGRAELLLSSGHSVVLDATFDR------------PQERALARALARDVGVAFVLIRLEAPEEVLRGRLAARKG  126 (170)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCC------------HHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCC
T ss_conf             999889999967991898443378------------888999999875038854888758829999989998179


No 119
>KOG3347 consensus
Probab=98.03  E-value=0.00013  Score=47.82  Aligned_cols=109  Identities=18%  Similarity=0.260  Sum_probs=65.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      ++=|.+.|-.|+||||.++.|++.+   |++.+-        +|..+++--+-   ..++-.-.+.++--|   .+-+.+
T Consensus         7 ~PNILvtGTPG~GKstl~~~lae~~---~~~~i~--------isd~vkEn~l~---~gyDE~y~c~i~DEd---kv~D~L   69 (176)
T KOG3347           7 RPNILVTGTPGTGKSTLAERLAEKT---GLEYIE--------ISDLVKENNLY---EGYDEEYKCHILDED---KVLDEL   69 (176)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHH---CCCEEE--------HHHHHHHHCCH---HCCCCCCCCCCCCHH---HHHHHH
T ss_conf             7887986799988025999999973---985674--------55677661102---102322367545678---999888


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
                      .|.+..|..| .|        |.    +.+...-.          .=|++|.|.+|.++..+|.++|+=
T Consensus        70 e~~m~~Gg~I-VD--------yH----gCd~Fper----------wfdlVvVLr~~~s~LY~RL~sRgY  115 (176)
T KOG3347          70 EPLMIEGGNI-VD--------YH----GCDFFPER----------WFDLVVVLRTPNSVLYDRLKSRGY  115 (176)
T ss_pred             HHHHHCCCCE-EE--------EC----CCCCCCHH----------HEEEEEEEECCCHHHHHHHHHCCC
T ss_conf             8987568848-86--------00----56765011----------355799994684599999997588


No 120
>KOG0635 consensus
Probab=98.02  E-value=0.00013  Score=47.86  Aligned_cols=159  Identities=22%  Similarity=0.325  Sum_probs=87.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      .+|+.|=+.|+.||||||.+-.|.+.|-++|.-.....       |.-+|.-|    ...+..      -+-||.+++.+
T Consensus        29 qkGcviWiTGLSgSGKStlACaL~q~L~qrgkl~Y~LD-------GDNvRhGL----N~DL~F------~a~dR~ENIRR   91 (207)
T KOG0635          29 QKGCVIWITGLSGSGKSTLACALSQALLQRGKLTYILD-------GDNVRHGL----NKDLGF------KAEDRNENIRR   91 (207)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEC-------CCCCCCCC----CCCCCC------CHHHHHHHHHH
T ss_conf             89968997425778802599999999986586589854-------85401043----445676------50334465788


Q ss_pred             H--HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCC-CCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             5--65542345258723542431000100344424577654442038898-41156652034877644321111100000
Q gi|254780218|r   82 V--IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVM-PDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        82 ~--I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~-PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
                      +  +.+..++ .-|||=-.+.|-  |   +  .+.   +....+.   |. +-+-+|.|||.+++..|--          
T Consensus        92 igeVaKLFAD-ag~iciaSlISP--Y---R--~dR---dacRel~---~~~~FiEvfmdvpl~vcE~RDP----------  147 (207)
T KOG0635          92 IGEVAKLFAD-AGVICIASLISP--Y---R--KDR---DACRELL---PEGDFIEVFMDVPLEVCEARDP----------  147 (207)
T ss_pred             HHHHHHHHHC-CCEEEEEHHCCC--H---H--CCH---HHHHHHC---CCCCEEEEEECCCHHHHHCCCC----------
T ss_conf             8999998732-540310021580--0---2--057---9999736---6898588875286878641484----------


Q ss_pred             HHHHHHCCHHHHHHHHHH----HHHHHH--HCCCCEEEE---CCCCCHHHHHHHHHHHHH
Q ss_conf             000211288999999999----999999--789949998---189788999999999999
Q gi|254780218|r  159 LDYFERKDVMIHEKRRQI----FLDIAR--NQPDRCHIV---DSAHSFQSVATNILNIVW  209 (225)
Q Consensus       159 ~d~~E~~~~~~~~kv~~~----y~~la~--~~~~~~~~I---Da~~~~eei~~~I~~~i~  209 (225)
                              ..++++.|.+    |-.+..  +-|-++.++   +...++++....|..-+.
T Consensus       148 --------KGLYK~ARaGkIKgFTGIddPYEaP~~cEi~l~~~~~~sp~~mae~iv~YL~  199 (207)
T KOG0635         148 --------KGLYKLARAGKIKGFTGIDDPYEAPLNCEIVLKSHESSSPEEMAEIIVSYLD  199 (207)
T ss_pred             --------HHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             --------0478887456523544678866688786789745788887999999999986


No 121
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=98.01  E-value=5.7e-06  Score=55.90  Aligned_cols=31  Identities=32%  Similarity=0.355  Sum_probs=25.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             899867888797999999999999779819998
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      .|+++|..||||||.++.|++.|  .+..+.+.
T Consensus         1 ~I~I~G~~gsGKsT~a~~l~~~l--~~~~~~~~   31 (69)
T cd02019           1 IIAITGGSGSGKSTVAKKLAEQL--GGRSVVVL   31 (69)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHH--CCCEEEEE
T ss_conf             97883688887258999999995--89549996


No 122
>PRK10416 cell division protein FtsY; Provisional
Probab=97.99  E-value=2e-05  Score=52.59  Aligned_cols=47  Identities=32%  Similarity=0.450  Sum_probs=38.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHH
Q ss_conf             8886899867888797999999999999779819998778898441001
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAA   50 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~i   50 (225)
                      +++..|.+-|+.||||||-+.+|+.+|+++|++|.+..  ++|.-...+
T Consensus       293 ~~P~VIl~vGvNG~GKTTTigKLA~~~~~~gkkVllaA--~DTfRaAAi  339 (499)
T PRK10416        293 KTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAA--GDTFRAAAV  339 (499)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE--ECCCCHHHH
T ss_conf             99879999747878789899999999997799537884--066756899


No 123
>pfam00693 Herpes_TK Thymidine kinase from herpesvirus.
Probab=97.95  E-value=0.00022  Score=46.38  Aligned_cols=162  Identities=20%  Similarity=0.213  Sum_probs=90.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---CCCC-CCHHHHCCCC---CCCCCCHHHHHH-------HHHHHHHH
Q ss_conf             78887979999999999997798199987788---9844-1001100124---445410134567-------77889999
Q gi|254780218|r   11 GIEGAGKTTHISLLKRFLQRKNYDVHVTREPG---GTPA-AEAARHVLLS---CGVDEFGAEAEA-------IVFAAARL   76 (225)
Q Consensus        11 GiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~---~t~~-ge~ir~~l~~---~~~~~~~~~~~~-------lLfaadr~   76 (225)
                      |.=|.||||-.+.|.+.... +-.++.+-||=   .+-+ .+.|..++--   ...++++.....       ..|++= .
T Consensus         1 G~~GiGKTTt~~~l~~~~~~-~~~~lyvpEPMaYWR~~f~~D~I~~Iy~tq~R~~~geis~~~A~~~~a~~Q~~f~~P-y   78 (279)
T pfam00693         1 GAHGIGKTTTARALAAASSA-GGPILYVPEPMAYWRTLFGTDAISGIYDTQTRKARGELSAEDAAVITAHLQARFATP-Y   78 (279)
T ss_pred             CCCCCCHHHHHHHHHHHCCC-CCCEEECCCHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC-H
T ss_conf             99763577799999861367-897576276289999875115999998888888658877888999999987762561-9


Q ss_pred             HHHHHHHHHHH----C-----CCCEEEECCCCC-CCEEHHCCCCCCCHHHHHHHHHHHC---CCCCCCEEEEEEECHHHH
Q ss_conf             97763565542----3-----452587235424-3100010034442457765444203---889841156652034877
Q gi|254780218|r   77 DHVENVIRPAL----M-----EGKILLCDRFLD-SSYAYQGERDSSQHLFLDSLQEISV---QEVMPDCTIILDLPVDIG  143 (225)
Q Consensus        77 ~~~~~~I~p~L----~-----~g~iVI~DRy~~-S~lAYQ~~~~~~~~~~i~~l~~~~~---~~~~PDl~i~Ldv~~e~a  143 (225)
                      -.+...|.+.+    .     -..++|.||.-. |.+.|--++.-+..-.+..+-.+..   ..|..--.+.-|+|+++-
T Consensus        79 ~~lh~~l~~~~g~~~~~~~~~P~~~lifDRHPvAa~lCfP~ARYl~G~~s~~~llsl~a~lP~eppG~NLVv~~L~~~Eh  158 (279)
T pfam00693        79 LILHERLSPLVGGELAQPGAAPDVTLVFDRHPVAATLCFPLARYLLGDMSLEALLSLIATLPPEPPGTNLVVCTLPEAEH  158 (279)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCEEEEECCHHHH
T ss_conf             99999998761777789999987799984670288876489999846688999999998588999997479885888999


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             644321111100000000211288999999999999999
Q gi|254780218|r  144 LKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR  182 (225)
Q Consensus       144 ~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~  182 (225)
                      .+|+.+|....        |.-+..|..-+|+.|.-|++
T Consensus       159 ~~RL~~R~RpG--------E~~D~~~l~alRnvY~~L~N  189 (279)
T pfam00693       159 ARRLRARARPG--------ERVDLTMLAALRNVYAMLVN  189 (279)
T ss_pred             HHHHHHCCCCC--------CCCCHHHHHHHHHHHHHHHH
T ss_conf             99999627996--------20159999999999999999


No 124
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=97.94  E-value=1.1e-05  Score=54.27  Aligned_cols=81  Identities=30%  Similarity=0.500  Sum_probs=53.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHC----------CCCCCCCCCHHHHHHHHH
Q ss_conf             8886899867888797999999999999779819998778898441001100----------124445410134567778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHV----------LLSCGVDEFGAEAEAIVF   71 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~----------l~~~~~~~~~~~~~~lLf   71 (225)
                      +++..|.|-|+.|+||||-+.+|+.+|.++|++|+...  ++|.-+..+-++          +.... ..-+|-+  ..|
T Consensus       137 ~~p~Vil~vGVNG~GKTTTIaKLA~~l~~~g~~VllaA--~DTFRAaAiEQL~~w~er~gv~vI~~~-~G~DpAa--Vaf  211 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTIAKLAKYLKQQGKSVLLAA--GDTFRAAAIEQLEVWGERLGVPVISGK-EGADPAA--VAF  211 (340)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEE--CCHHHHHHHHHHHHHHHHHCCEEECCC-CCCCCHH--HHH
T ss_conf             98679999934888637179999999997898699982--334789999999999999599278259-9998089--999


Q ss_pred             HHHHHHHHHHHHHHHHCCC-CEEEEC
Q ss_conf             8999997763565542345-258723
Q gi|254780218|r   72 AAARLDHVENVIRPALMEG-KILLCD   96 (225)
Q Consensus        72 aadr~~~~~~~I~p~L~~g-~iVI~D   96 (225)
                               +-|+.+-++| ++||||
T Consensus       212 ---------DAi~~Akar~~DvvliD  228 (340)
T COG0552         212 ---------DAIQAAKARGIDVVLID  228 (340)
T ss_pred             ---------HHHHHHHHCCCCEEEEE
T ss_conf             ---------99999997699999996


No 125
>pfam07931 CPT Chloramphenicol phosphotransferase-like protein. The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT) expressed by Streptomyces venezuelae. Chloramphenicol (Cm) is a metabolite produced by this bacterium that can inhibit ribosomal peptidyl transferase activity and therefore protein production. By transferring a phosphate group to the C-3 hydroxyl group of Cm, CPT inactivates this potentially lethal metabolite.
Probab=97.94  E-value=0.00038  Score=45.04  Aligned_cols=166  Identities=16%  Similarity=0.112  Sum_probs=84.1

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC----CC-CCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8689986788879799999999999977981999877----88-984410011001244454101345677788999997
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE----PG-GTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDH   78 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e----P~-~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~   78 (225)
                      |++|.+-|.--|||||.++.|.+.|..--+.+-+-.|    |. ....++.++-.   .......+.... ++ +..   
T Consensus         1 G~II~LNG~SSsGKSsiAraLQ~~l~~p~~h~~vD~f~~~~p~~~~~~~~gl~~~---~~~~~~g~~~~~-~~-~~~---   72 (174)
T pfam07931         1 GRIILLNGGSSSGKSSIARALQDILDGPWLHFGVDAFVEAMPPKRQDSGDGLEWS---TVGPVIGPEFPL-FE-AAF---   72 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHHHHHHCCCCCCCCCCCCCCC---CCCCCHHHHHHH-HH-HHH---
T ss_conf             9199974899888799999999847474676428588876771125887776636---666523566999-99-999---


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHH-HHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCC
Q ss_conf             763565542345258723542431000100344424577-6544420388984115665203487764432111110000
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFL-DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i-~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~  157 (225)
                       ...|.-....|..||.|-.+...            .++ +.+.+...  ..|-+.+=..||.++..+|-..|+++..+.
T Consensus        73 -~~~iaa~a~~G~nvIvD~v~~~~------------~~l~d~~~~~L~--g~~v~~VGV~Cpleil~~RE~~RgDR~~G~  137 (174)
T pfam07931        73 -YEAVAAMARAGNNVIVDDVILSG------------EWLQDCLQRLLS--GLDVLFVGVRCPLEVLERREIERGDRVPGL  137 (174)
T ss_pred             -HHHHHHHHHCCCCEEEEECCCCC------------HHHHHHHHHHHC--CCCEEEEEEECCHHHHHHHHHHCCCCCCCH
T ss_conf             -99999999779998996546693------------789999999858--981799998789999999987369999655


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCC-CCHHHHHHHHHHHH
Q ss_conf             0000211288999999999999999789949998189-78899999999999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSA-HSFQSVATNILNIV  208 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~-~~~eei~~~I~~~i  208 (225)
                      .               +..|..+- .....=..||++ .++++..++|.+.+
T Consensus       138 A---------------~~q~~~VH-~~~~YDlevDTs~~s~~ecA~~I~~~l  173 (174)
T pfam07931       138 A---------------AWQAEAVH-AGVEYDLEVDTSHQTPEECARRIRSRL  173 (174)
T ss_pred             H---------------HHHHHHHC-CCCCCCEEEECCCCCHHHHHHHHHHHH
T ss_conf             5---------------78998602-599986686799999999999999973


No 126
>KOG3078 consensus
Probab=97.93  E-value=0.0002  Score=46.63  Aligned_cols=185  Identities=18%  Similarity=0.205  Sum_probs=96.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH--
Q ss_conf             886899867888797999999999999779819998778898441001100124445410134567778899999776--
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVE--   80 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~--   80 (225)
                      ++.=.+|-|..||||+||+..+.+.+....           ...|.++|+.+.++  ..+..+....   .|.-.++.  
T Consensus        14 ~~~~~v~~G~pg~gkgt~a~~l~~~~~~~h-----------l~tGdllr~~ia~~--telg~~~~~~---~~~g~lvpDe   77 (235)
T KOG3078          14 KGVRAVLLGAPGSGKGTQAPRLTKNFGVIH-----------ISTGDLLRDEIASG--TELGKEAKEA---IDKGKLVPDE   77 (235)
T ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHCCCCC-----------CHHHHHHHHHHHCC--CCHHHHHHHH---HHHCCCCCHH
T ss_conf             464799971899997743779998447750-----------03478899998515--8178999999---9732767599


Q ss_pred             ---HHHHHHHCCC---CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             ---3565542345---2587235424310001003444245776544420388984115665203487764432111110
Q gi|254780218|r   81 ---NVIRPALMEG---KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR  154 (225)
Q Consensus        81 ---~~I~p~L~~g---~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~  154 (225)
                         .++...|.+.   +-.|.|-|          .+....  .+.+.+   ....||++|.|.+|.+...+|+..|....
T Consensus        78 iv~~~l~~~l~~~~~~~~~ildg~----------Prt~~q--a~~l~~---~~~~~d~Vi~l~vp~~~L~~ri~~r~ihp  142 (235)
T KOG3078          78 VVVRLLEKRLENPRCQKGFILDGF----------PRTVQQ--AEELLD---RIAQIDLVINLKVPEEVLVDRITGRRIHP  142 (235)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCC----------CCCHHH--HHHHHH---CCCCCCEEEEECCCHHHHHHHHHCCCCCC
T ss_conf             999999860256422256004788----------863488--999997---06883337884388899999975023357


Q ss_pred             HCCH-------------HHH-----HHHCCHH---HHHHHHHHHHHHH----HHC--CCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             0000-------------000-----2112889---9999999999999----978--99499981897889999999999
Q gi|254780218|r  155 ESAC-------------LDY-----FERKDVM---IHEKRRQIFLDIA----RNQ--PDRCHIVDSAHSFQSVATNILNI  207 (225)
Q Consensus       155 ~~~~-------------~d~-----~E~~~~~---~~~kv~~~y~~la----~~~--~~~~~~IDa~~~~eei~~~I~~~  207 (225)
                      ..+.             .|.     +.+...+   -..+.-+.|.+.+    ..+  .+.|..++++. .++|...|.+.
T Consensus       143 ~sG~~Yh~~~~pPk~~~~dDitgepL~qr~dD~~e~v~~rL~~y~~~~~pv~eyY~k~~~l~~~~~~~-~~~v~~~v~~~  221 (235)
T KOG3078         143 ASGRVYHLEFNPPKVPGKDDITGEPLIQREDDKPEVVKKRLKAYKEQTKPVLEYYKKKGVLIEFSGEK-PEEVFPNVYAF  221 (235)
T ss_pred             CCCCEECCCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHCCEEEECCCCC-HHHHHHHHHHH
T ss_conf             53320010026976556111234733328555699999999998640367999998557255316863-25757999999


Q ss_pred             HHHHHHHHCCCC
Q ss_conf             999998642645
Q gi|254780218|r  208 VWELVQKRVSPL  219 (225)
Q Consensus       208 i~~~l~k~~~~~  219 (225)
                      +.+.+.++....
T Consensus       222 l~~~~~~~~~~~  233 (235)
T KOG3078         222 LSKKVPEREQKE  233 (235)
T ss_pred             HHHHHHHHHHHC
T ss_conf             876525544312


No 127
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=97.92  E-value=0.00024  Score=46.24  Aligned_cols=174  Identities=15%  Similarity=0.183  Sum_probs=82.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC--CCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844--1001100124445410134567778899999776356
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA--AEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~--ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      +|.|-|--||||||.++.+.+.|...+..++..    +.-+  ...-|..   .....++|.+.-+       +.+.+.+
T Consensus         1 IIgVaG~SGSGKTTv~~~i~~ifg~~~v~vI~~----D~Yhr~dr~~r~~---~~~t~~~P~And~-------dll~~~l   66 (273)
T cd02026           1 IIGVAGDSGCGKSTFLRRLTSLFGSDLVTVICL----DDYHSLDRKGRKE---TGITALDPRANNF-------DLMYEQL   66 (273)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEC----CCCCCCCHHHHHH---HCCCCCCCCHHHH-------HHHHHHH
T ss_conf             989978887869999999999858487699965----7778899899987---1877689752349-------9999999


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCC--CCCCHHHHHHHHHHHCCC--CCCCEEEEEEECHHHHHHHHHHHHHHHHCCHH
Q ss_conf             55423452587235424310001003--444245776544420388--98411566520348776443211111000000
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGER--DSSQHLFLDSLQEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSLRESACL  159 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~--~~~~~~~i~~l~~~~~~~--~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~  159 (225)
                       .+|.+|+.|-.--|-+.+=.+....  ...+--.++-+.-+....  -.-|+.||+|++.++.+.|...|...+.+...
T Consensus        67 -~~Lk~Gk~i~~PvYdh~tg~~~~~e~i~p~diII~EGLh~l~~~~lrdl~DLkIfVD~d~dlr~~rKI~RD~~ERGyS~  145 (273)
T cd02026          67 -KALKEGQAIEKPIYNHVTGLIDPPELIKPTKIVVIEGLHPLYDERVRELLDFSVYLDISDEVKFAWKIQRDMAERGHSL  145 (273)
T ss_pred             -HHHHCCCCCCCCCCCCCCCCCCCCEEECCCCEEEEECEECCCCHHHHHHHCEEEEECCCHHHHHHHHHHHHHHHHCCCH
T ss_conf             -9998599534322214589657756506874799922000266889866074688568764799998776676648899


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHCC----CCEEEECCCCCHH
Q ss_conf             00211288999999999999999789----9499981897889
Q gi|254780218|r  160 DYFERKDVMIHEKRRQIFLDIARNQP----DRCHIVDSAHSFQ  198 (225)
Q Consensus       160 d~~E~~~~~~~~kv~~~y~~la~~~~----~~~~~IDa~~~~e  198 (225)
                      +.-    .+-..+...-|.+....+.    -.+.++.+...++
T Consensus       146 E~V----~~~I~rR~pDy~~yI~PQk~~ADI~iq~vPt~l~~~  184 (273)
T cd02026         146 EDV----LASIEARKPDFEAYIDPQKQYADVVIQVLPTQLIPD  184 (273)
T ss_pred             HHH----HHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCC
T ss_conf             999----999986047889750757500128999527667888


No 128
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=97.92  E-value=0.00066  Score=43.59  Aligned_cols=165  Identities=15%  Similarity=0.023  Sum_probs=85.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCC-------CCCCCCHHHHHH-HHHHHH
Q ss_conf             886899867888797999999999999779819998778898441001100124-------445410134567-778899
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS-------CGVDEFGAEAEA-IVFAAA   74 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~-------~~~~~~~~~~~~-lLfaad   74 (225)
                      .|++|.+-|.--|||||.++.|.+.|..-   ...+  +-++. -+.+..-..+       .......+.... .++++-
T Consensus         1 ~G~II~LNG~SSSGKSsiAraLQ~~l~~p---~~h~--~vD~f-~~~~p~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~   74 (175)
T cd00227           1 TGRIIILNGGSSAGKSSIARALQSVLAEP---WLHF--GVDSF-IEALPLKCQDAEGGIEFDGDGGVSPGPEFRLLEGAW   74 (175)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHCCCC---EEEE--EHHHH-HHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             97499986899898899999999847675---6884--18589-886763136875422348776635415699999999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             99977635655423452587235424310001003444245776544420388984115665203487764432111110
Q gi|254780218|r   75 RLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR  154 (225)
Q Consensus        75 r~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~  154 (225)
                           .+.|.-....|..||.|-=+.            +..++..+.....  +.|-+.+=..||.+++.+|=..|+.+.
T Consensus        75 -----~~~iaa~a~aG~nvIvD~v~~------------~~~~l~d~~~~L~--g~~v~~VGV~C~l~~l~~RE~~RgDR~  135 (175)
T cd00227          75 -----YEAVAAMARAGANVIADDVFL------------GRAALQDCWRSFV--GLDVLWVGVRCPGEVAEGRETARGDRV  135 (175)
T ss_pred             -----HHHHHHHHHCCCCEEEEEEEC------------CCHHHHHHHHHHC--CCCEEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             -----999999997799889863123------------8088999999857--992799998789999999987458999


Q ss_pred             HCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHH
Q ss_conf             000000021128899999999999999978994999818-978899999999999
Q gi|254780218|r  155 ESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIV  208 (225)
Q Consensus       155 ~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i  208 (225)
                      .+..        ..-+..|.+        .-..=..||+ ..++++..++|.+.+
T Consensus       136 ~G~A--------~~q~~~VH~--------~~~YDleVDTs~~sp~eCA~~I~~~l  174 (175)
T cd00227         136 PGQA--------RKQARVVHA--------GVEYDLEVDTTHKTPIECARAIAARV  174 (175)
T ss_pred             CCHH--------HHHHHHHHC--------CCCCCEEEECCCCCHHHHHHHHHHHH
T ss_conf             6467--------889998435--------99885687799999999999999971


No 129
>PRK12338 hypothetical protein; Provisional
Probab=97.91  E-value=0.00089  Score=42.80  Aligned_cols=174  Identities=16%  Similarity=0.138  Sum_probs=85.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCC-----------------CCH
Q ss_conf             988868998678887979999999999997798199987788984410011001244454-----------------101
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-----------------EFG   63 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~-----------------~~~   63 (225)
                      |+++..|-+-|.-|+||||.+..|+.+|   |++.+..    ...+-+.+|.++-.....                 ...
T Consensus         1 mr~PliILiGGtSGvGKSTlAseLAsRL---gI~tvIs----TDsIRevmR~~is~e~~P~L~~STY~A~~~Lr~~~~~~   73 (320)
T PRK12338          1 MRKPYVILIGSASGIGKSTIASEVARRL---NIKHLIE----TDFIREVVRGIIGKEYAPALHMSSYNAYTALRDKDHFV   73 (320)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHC---CCCEEEC----CHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             9976799970688876888999999851---9871103----34799999983380415345542026788726742357


Q ss_pred             HHH-HHHHHHHHHH-------HHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             345-6777889999-------97763565542345258723542431000100344424577654442038898411566
Q gi|254780218|r   64 AEA-EAIVFAAARL-------DHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTII  135 (225)
Q Consensus        64 ~~~-~~lLfaadr~-------~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~  135 (225)
                      |.. +-. ..+..-       .-++.+|..++.+|.-||..          |. +-++. ++..+.. .   ..+++-|+
T Consensus        74 ~~~~~~~-vi~Gfe~q~e~V~~~le~vI~r~~~~~~sivIE----------GV-HLvPg-fi~~~~~-~---~~~~i~F~  136 (320)
T PRK12338         74 PKRFEEL-VIAGFEEHASFVIPAIEKVIKRAVTDADDIVIE----------GV-HLVPG-LINIEQF-Y---EYANIHFF  136 (320)
T ss_pred             CCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE----------EE-EECHH-HCCHHHH-C---CCCCCEEE
T ss_conf             7411678-999999998999999999999998648867998----------45-30555-5057662-2---66663699


Q ss_pred             -EEECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHH---HHHHHHHHHHHCCCCEEEECC---CCCHHHHHHHHHH
Q ss_conf             -5203487764432111110000000021128899999---999999999978994999818---9788999999999
Q gi|254780218|r  136 -LDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK---RRQIFLDIARNQPDRCHIVDS---AHSFQSVATNILN  206 (225)
Q Consensus       136 -Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~k---v~~~y~~la~~~~~~~~~IDa---~~~~eei~~~I~~  206 (225)
                       +-++.+.-.+|--.|.......  ++|    +.|++.   +++.+.+-|.++.  +-+|+.   ++++..++.-|.+
T Consensus       137 i~~~~E~kH~eRF~~Rak~m~r~--~Ky----vkyf~niR~Iqd~L~~~Adeh~--iP~I~N~nid~sV~~i~~~I~~  206 (320)
T PRK12338        137 ILYADEEEHKERFVKRAMEIKRG--GKH----LEYFRENRIIHDFLVSQADEHG--IPVIKNDDIDRTVSKVLSVIRE  206 (320)
T ss_pred             EEECCHHHHHHHHHHHHHHHHCC--CCH----HHHHHHHHHHHHHHHHHHHHCC--CCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99817689999999999885026--508----9999988999999984167619--9730476355689999999998


No 130
>KOG0780 consensus
Probab=97.84  E-value=7.2e-05  Score=49.33  Aligned_cols=115  Identities=22%  Similarity=0.329  Sum_probs=64.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC----------HHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             8868998678887979999999999997798199987788984410----------011001244454101345677788
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAE----------AARHVLLSCGVDEFGAEAEAIVFA   72 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge----------~ir~~l~~~~~~~~~~~~~~lLfa   72 (225)
                      ++-.|.|-|+-||||||-|.+|+-+++.+|+++....  ++|.-+.          ..|-.++. .+...+|-..+.   
T Consensus       100 kpsVimfVGLqG~GKTTtc~KlA~y~kkkG~K~~Lvc--aDTFRagAfDQLkqnA~k~~iP~yg-syte~dpv~ia~---  173 (483)
T KOG0780         100 KPSVIMFVGLQGSGKTTTCTKLAYYYKKKGYKVALVC--ADTFRAGAFDQLKQNATKARVPFYG-SYTEADPVKIAS---  173 (483)
T ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHHCCCCEEEEE--ECCCCCCHHHHHHHHHHHHCCEEEE-CCCCCCHHHHHH---
T ss_conf             9708999830578863008999999984687245776--0224530689999876740770684-036655589999---


Q ss_pred             HHHHHHHHHHHHHHH-CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEE-EEECHH
Q ss_conf             999997763565542-345258723542431000100344424577654442038898411566-520348
Q gi|254780218|r   73 AARLDHVENVIRPAL-MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTII-LDLPVD  141 (225)
Q Consensus        73 adr~~~~~~~I~p~L-~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~-Ldv~~e  141 (225)
                              +-+...- ++-.+||+|-   |      .++.......+.+.+. .....||.++| +|.+.-
T Consensus       174 --------egv~~fKke~fdvIIvDT---S------GRh~qe~sLfeEM~~v-~~ai~Pd~vi~VmDasiG  226 (483)
T KOG0780         174 --------EGVDRFKKENFDVIIVDT---S------GRHKQEASLFEEMKQV-SKAIKPDEIIFVMDASIG  226 (483)
T ss_pred             --------HHHHHHHHCCCCEEEEEC---C------CCHHHHHHHHHHHHHH-HHHCCCCEEEEEEECCCC
T ss_conf             --------999988863972899827---8------7301248999999999-851598738999856200


No 131
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]
Probab=97.84  E-value=0.0019  Score=40.82  Aligned_cols=182  Identities=19%  Similarity=0.222  Sum_probs=93.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHH----------
Q ss_conf             9888689986788879799999999999977981999877889844100110012444541013456777----------
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIV----------   70 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lL----------   70 (225)
                      |+++.+|-|-|..|.||||.+..|+..|   |+..+..    ...+-|.+|.++-    ..+.|-...--          
T Consensus        86 ~~~p~IILIGGasGVGkStIA~ElA~rL---gI~~vis----TD~IREvlR~ii~----~~l~PtLh~Ssy~Awkalr~~  154 (299)
T COG2074          86 MKRPLIILIGGASGVGKSTIAGELARRL---GIRSVIS----TDSIREVLRKIIS----PELLPTLHTSSYDAWKALRDP  154 (299)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHC---CCCEEEC----CHHHHHHHHHHCC----HHHCCHHHHHHHHHHHHHCCC
T ss_conf             5787599961788777257999999972---9861004----2479999997379----774553567577999983689


Q ss_pred             -----HHHHHHHH-------HHHHHHHHHCCCCEEEECC-CCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             -----88999997-------7635655423452587235-4243100010034442457765444203889841156652
Q gi|254780218|r   71 -----FAAARLDH-------VENVIRPALMEGKILLCDR-FLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILD  137 (225)
Q Consensus        71 -----faadr~~~-------~~~~I~p~L~~g~iVI~DR-y~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ld  137 (225)
                           ..|-..+|       ++.+|..++.+|.-+|..- |+.-        .-++.+.   + .      .-.+.|+|-
T Consensus       155 ~~~~piiaGF~dqa~~V~~GI~~VI~RAi~eG~~lIIEGvHlVP--------g~i~~~~---~-~------~n~~~~~l~  216 (299)
T COG2074         155 TDENPIIAGFEDQASAVMVGIEAVIERAIEEGEDLIIEGVHLVP--------GLIKEEA---L-G------NNVFMFMLY  216 (299)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECC--------CCCCHHH---H-C------CCEEEEEEE
T ss_conf             99961313178776799988999999998537535887421150--------0216766---1-3------551789998


Q ss_pred             EC-HHHHHHHHHHHHHHHH-CCHHHHHHHCCHHHHHHH---HHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             03-4877644321111100-000000211288999999---999999999789949998189788999999999999999
Q gi|254780218|r  138 LP-VDIGLKRVQNRYSLRE-SACLDYFERKDVMIHEKR---RQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV  212 (225)
Q Consensus       138 v~-~e~a~~Ri~~R~~~~~-~~~~d~~E~~~~~~~~kv---~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l  212 (225)
                      ++ ++.-..|.-+|..... ..-..||    ..++..+   .+.-.+.|+++.  +-+|++ -++++-.++|++.|.+..
T Consensus       217 i~dee~Hr~RF~~R~~~t~~~rp~~Ry----l~yf~EiR~I~Dyl~~~Are~g--VPvI~n-~di~etv~~il~~i~~~~  289 (299)
T COG2074         217 IADEELHRERFYDRIRYTHASRPGGRY----LEYFKEIRTIHDYLVERAREHG--VPVIEN-DDIDETVDRILEDIRKRT  289 (299)
T ss_pred             ECCHHHHHHHHHHHHHHHHCCCCHHHH----HHHHHHHHHHHHHHHHHHHHCC--CCEECC-CCHHHHHHHHHHHHHHHH
T ss_conf             388789999999988887605965679----9999999999999999888659--981125-319999999999999998


Q ss_pred             HHHCCC
Q ss_conf             864264
Q gi|254780218|r  213 QKRVSP  218 (225)
Q Consensus       213 ~k~~~~  218 (225)
                      .+....
T Consensus       290 ~r~~~~  295 (299)
T COG2074         290 VRGLSL  295 (299)
T ss_pred             HHHHHC
T ss_conf             887650


No 132
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]
Probab=97.82  E-value=0.00022  Score=46.44  Aligned_cols=138  Identities=16%  Similarity=0.179  Sum_probs=66.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCC--EEEEECCCCC---CCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999977981--9998778898---441001100124445410134567778899999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYD--VHVTREPGGT---PAAEAARHVLLSCGVDEFGAEAEAIVFAAARLD   77 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~--v~~~~eP~~t---~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~   77 (225)
                      ..++|.+-|.-|+||||+++.|...|...+-.  |..+  |.+.   +...+..+-+++.+.-+-+.-..+|+      .
T Consensus        81 ~pfIIgiaGsvavGKST~ar~L~~ll~~~~~~~~v~lv--pmDGFhy~n~~L~~~glm~rKGfPeSyD~~~ll------~  152 (283)
T COG1072          81 RPFIIGIAGSVAVGKSTTARILQALLSRWPESPKVDLV--TMDGFHYPNAVLDERGLMARKGFPESYDVAALL------R  152 (283)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEE--ECCCCCCCHHHHHHCCCCCCCCCCCCCCHHHHH------H
T ss_conf             88799960576655778999999999638898733787--145454676775221220018998535689999------9


Q ss_pred             HHHHHHHHHHCCCC----EEEECCCCCCCEE--HHCCCCCCCHHHHHHHHH------HHCCCCCCCEEEEEEECHHHHHH
Q ss_conf             77635655423452----5872354243100--010034442457765444------20388984115665203487764
Q gi|254780218|r   78 HVENVIRPALMEGK----ILLCDRFLDSSYA--YQGERDSSQHLFLDSLQE------ISVQEVMPDCTIILDLPVDIGLK  145 (225)
Q Consensus        78 ~~~~~I~p~L~~g~----iVI~DRy~~S~lA--YQ~~~~~~~~~~i~~l~~------~~~~~~~PDl~i~Ldv~~e~a~~  145 (225)
                      .+.. ++    +|+    +=+-||-.|...+  |+-. ...+--.++-++=      +..-..-=|++||+|++.+...+
T Consensus       153 fl~~-vK----~~~~~v~aPvysh~~yD~vp~~~~v~-~~pdIlI~EG~nvLq~~~p~~~~sdffDfSIyvDa~~~~le~  226 (283)
T COG1072         153 FLSD-VK----AGKPDVFAPVYSHLIYDPVPDAFQVV-PQPDILIVEGNNVLQDGEPWLFLSDFFDFSIYVDADEELLEE  226 (283)
T ss_pred             HHHH-HH----CCCCCCCCCCCCCCCCCCCCCCEEEC-CCCCEEEEECHHHHCCCCCCCCCCCCCEEEEEECCCHHHHHH
T ss_conf             9999-96----59985124323311025678850205-899889991526625898511125622179993699999999


Q ss_pred             HHHHHHHHH
Q ss_conf             432111110
Q gi|254780218|r  146 RVQNRYSLR  154 (225)
Q Consensus       146 Ri~~R~~~~  154 (225)
                      |..+|....
T Consensus       227 wyi~Rfl~~  235 (283)
T COG1072         227 RYIERFLKF  235 (283)
T ss_pred             HHHHHHHHH
T ss_conf             999999850


No 133
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=97.81  E-value=0.00012  Score=48.04  Aligned_cols=37  Identities=35%  Similarity=0.503  Sum_probs=33.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8868998678887979999999999997798199987
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      ++-.|.+-|+-||||||-+.+|+.+|+++|.+|.+..
T Consensus        96 kP~Vim~vGlqGsGKTTT~aKLA~~~kk~g~kv~lva  132 (433)
T PRK00771         96 KPQTILLVGLQGSGKTTTAAKLARYFQKKGLKVGVIC  132 (433)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9858999737889789999999999997799467850


No 134
>COG4639 Predicted kinase [General function prediction only]
Probab=97.79  E-value=0.00013  Score=47.80  Aligned_cols=116  Identities=19%  Similarity=0.219  Sum_probs=62.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      .++|.-|..||||||-++....     ...++         ....+|..+-.......+....-+.     |+.+....+
T Consensus         3 ~LvvL~G~~~sGKsT~ak~n~~-----~~~~l---------sld~~r~~lg~~~~~e~sqk~~~~~-----~~~l~~~l~   63 (168)
T COG4639           3 ILVVLRGASGSGKSTFAKENFL-----QNYVL---------SLDDLRLLLGVSASKENSQKNDELV-----WDILYKQLE   63 (168)
T ss_pred             EEEEEECCCCCCHHHHHHHHCC-----CCCEE---------CHHHHHHHHHHCHHHHHCCCCHHHH-----HHHHHHHHH
T ss_conf             4899866887764289997179-----95341---------4999998862020466501337999-----999999999


Q ss_pred             HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             5423452587235424310001003444245776544420388984115665203487764432111
Q gi|254780218|r   85 PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRY  151 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~  151 (225)
                      ..|.+|++-|.|=+            .++.+....+..++...-.-+.+++||+|++.+.+|.+.|.
T Consensus        64 qrl~~Gk~tiidAt------------n~rr~~r~~l~~La~~y~~~~~~ivfdtp~~~c~aRNk~~~  118 (168)
T COG4639          64 QRLRRGKFTIIDAT------------NLRREDRRKLIDLAKAYGYKIYAIVFDTPLELCLARNKLRE  118 (168)
T ss_pred             HHHHCCCEEEEECC------------CCCHHHHHHHHHHHHHHCCEEEEEEEECCHHHHHHHHHCCC
T ss_conf             99973976899754------------58999999999999983976899998188999987740440


No 135
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=97.76  E-value=0.00012  Score=48.09  Aligned_cols=24  Identities=38%  Similarity=0.667  Sum_probs=22.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             899867888797999999999999
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +|.|-|.-||||||.++.|.+.|.
T Consensus         1 iIgIaG~S~SGKTTla~~L~~~l~   24 (187)
T cd02024           1 IVGISGVTNSGKTTLAKLLQRILP   24 (187)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             989968888759999999999879


No 136
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129   Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK  resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=97.75  E-value=4.6e-05  Score=50.47  Aligned_cols=47  Identities=28%  Similarity=0.433  Sum_probs=37.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCCCC-----CCCCHHH
Q ss_conf             6899867888797999999999999779819998-778898-----4410011
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPGGT-----PAAEAAR   51 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~~t-----~~ge~ir   51 (225)
                      ..|=|.|++|+||||.++.|-..|..+|+.|-++ =-|+++     -.|..+|
T Consensus        39 ~~vG~TG~PGaGKSTl~~~l~~~lrRrG~~VaViAvDP~SPfTGGsiLGDr~R   91 (333)
T TIGR00750        39 HVVGITGVPGAGKSTLVEKLIMELRRRGLKVAVIAVDPSSPFTGGSILGDRLR   91 (333)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             78766468888577799999899976597689998879759755145456887


No 137
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.
Probab=97.73  E-value=2.3e-05  Score=52.27  Aligned_cols=122  Identities=28%  Similarity=0.388  Sum_probs=61.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC-------CCCCCCCCHHHHCCCCC---CCCCCHHHHHH-HHHHH-
Q ss_conf             89986788879799999999999977981999877-------88984410011001244---45410134567-77889-
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE-------PGGTPAAEAARHVLLSC---GVDEFGAEAEA-IVFAA-   73 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e-------P~~t~~ge~ir~~l~~~---~~~~~~~~~~~-lLfaa-   73 (225)
                      +|.+.|.-||||||.++.|    ++.|++|+-...       |+ +...+.+.+.+-..   ..+.++....+ ++|.- 
T Consensus         1 iigiTG~igSGKStv~~~l----~~~g~~v~~aD~i~~~l~~~~-~~~~~~i~~~fg~~~~~~~g~i~r~~L~~~vf~~~   75 (179)
T cd02022           1 IIGLTGGIGSGKSTVAKLL----KELGIPVIDADKIAHEVYEPG-GPALQAIVEAFGPDILLEDGELDRKKLGEIVFADP   75 (179)
T ss_pred             CEEEECCCCCCHHHHHHHH----HHCCCEEEECHHHHHHHHHCC-HHHHHHHHHHCCCHHCCCCCCCCHHHHHHHHHCCH
T ss_conf             9886378757899999999----987990996359999988607-69999999873713028888675999999986698


Q ss_pred             HHHHHHHHHHHHHHCCC-----------CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHH
Q ss_conf             99997763565542345-----------2587235424310001003444245776544420388984115665203487
Q gi|254780218|r   74 ARLDHVENVIRPALMEG-----------KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDI  142 (225)
Q Consensus        74 dr~~~~~~~I~p~L~~g-----------~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~  142 (225)
                      .....++.++-|.....           .+|+.+               .+.     +.. .......|.++++++|.++
T Consensus        76 ~~~~~Le~iihP~v~~~~~~~~~~~~~~~~vi~e---------------vpL-----L~E-~~~~~~~d~ii~V~a~~~~  134 (179)
T cd02022          76 EKRKKLEAITHPLIRKEIEEQLAEARKEKVVVLD---------------IPL-----LFE-TGLEKLVDRVIVVDAPPEI  134 (179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEE---------------EEE-----EEE-CCCCCCCCEEEEEECCHHH
T ss_conf             9999998572799999999999863035633676---------------555-----420-5876557758999868688


Q ss_pred             HHHHHHHHHHH
Q ss_conf             76443211111
Q gi|254780218|r  143 GLKRVQNRYSL  153 (225)
Q Consensus       143 a~~Ri~~R~~~  153 (225)
                      ..+|+.+|.+.
T Consensus       135 r~~R~~~R~~~  145 (179)
T cd02022         135 QIERLMKRDGL  145 (179)
T ss_pred             HHHHHHHHCCC
T ss_conf             99999980299


No 138
>KOG3308 consensus
Probab=97.73  E-value=0.0004  Score=44.87  Aligned_cols=184  Identities=19%  Similarity=0.175  Sum_probs=88.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC---CCC-CCCC-------------------CHHHHCCCCC
Q ss_conf             9888689986788879799999999999977981999877---889-8441-------------------0011001244
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE---PGG-TPAA-------------------EAARHVLLSC   57 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e---P~~-t~~g-------------------e~ir~~l~~~   57 (225)
                      |+|-.+|.|-|.-.|||||++++|...|...  .++.-..   |.+ -+..                   +.|--.|.+.
T Consensus         1 s~K~~ivgiSG~TnsGKTTLak~l~~~f~~~--~lIhqDDFyKp~~Ei~v~~~n~~~wd~~esLdm~~fl~~ia~~l~~~   78 (225)
T KOG3308           1 SMKTLIVGISGCTNSGKTTLAKSLHRFFPGC--SLIHQDDFYKPENEIEVDYNNIDNWDLLESLDMEKFLEKIATWLDSR   78 (225)
T ss_pred             CCEEEEEEEECCCCCCHHHHHHHHHHHCCCC--EEECCCCCCCCHHHHHCCCCCCCHHCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9618999864246787768999999873687--46402234675534211237721110131420999987888885075


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             45410134567778899999776356554234525872354243100010034442457765444203889841156652
Q gi|254780218|r   58 GVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILD  137 (225)
Q Consensus        58 ~~~~~~~~~~~lLfaadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ld  137 (225)
                        .+.+.-.++++-.|+ ++|....-.+.-.+..+||.|-+..    |+-       +.+..         .=|..+++.
T Consensus        79 --~~~~~ar~~~v~~~~-~~~~~~~~q~~~~~~~iviidGfmi----y~y-------~p~~~---------~~d~~im~~  135 (225)
T KOG3308          79 --HNAPEAREHLVSYAN-FEHYAQQFQIKAYKNHIVIIDGFMI----YNY-------KPQVD---------LFDRIIMLT  135 (225)
T ss_pred             --CCCCHHHHHHHHHHH-HHHHHHHCCCCCCCCCEEEEECCEE----EEC-------CHHHH---------HHHHHEEEE
T ss_conf             --556337565411667-7777642275200276799836147----726-------32664---------555210220


Q ss_pred             ECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0348776443211111000000002112889999999999999997899499981897889999999999999998
Q gi|254780218|r  138 LPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ  213 (225)
Q Consensus       138 v~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~  213 (225)
                      .|-+++.+|..+|........ -.|+.---.++.+-++.+.....   .-...++++.+-+.+-..|...+.....
T Consensus       136 ~~y~~~krRr~~Rt~y~p~~t-gyfd~~~~P~Y~~~~~~~~d~~~---h~~~flngdvs~e~~~~~v~~~i~~~~~  207 (225)
T KOG3308         136 LDYETCKRRREARTYYPPDDT-GYFDPVVWPHYEKNFEEARDRSR---HDSLFLNGDVSEEKLDDKVNESINQRQQ  207 (225)
T ss_pred             CCHHHHHHHHCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHCC---CCEEEECCCCHHHHCHHHHHHHHCCCCC
T ss_conf             439999876236544777877-52357646089887888875034---4315552520132232565430100212


No 139
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=97.73  E-value=0.00021  Score=46.49  Aligned_cols=42  Identities=31%  Similarity=0.291  Sum_probs=36.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             88868998678887979999999999997798199987788984
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTP   45 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~   45 (225)
                      .+|..|.+=|+.||||||-+.+|+.+|..+|.+|.+..  ++|.
T Consensus       204 ~~g~VIaLVGvnGvGKTTTiAKLA~~l~~~gkkV~LVA--aDTF  245 (407)
T PRK12726        204 SNHRIISLIGQTGVGKTTTLVKLGWQLLKQNRTVGFIT--TDTF  245 (407)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCC
T ss_conf             36908999899989789999999999997799179997--0667


No 140
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=97.71  E-value=0.00022  Score=46.48  Aligned_cols=112  Identities=24%  Similarity=0.322  Sum_probs=62.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC----------CCCHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             8868998678887979999999999997798199987788984----------410011001244454101345677788
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTP----------AAEAARHVLLSCGVDEFGAEAEAIVFA   72 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~----------~ge~ir~~l~~~~~~~~~~~~~~lLfa   72 (225)
                      ++-.|-+-|+-||||||-+.+|+.||+++|++|.++.  .++.          .++.+.-.+... ...-+|-.      
T Consensus        99 ~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVa--aD~~RpAA~eQL~~La~q~~v~~f~~-~~~~~Pv~------  169 (451)
T COG0541          99 PPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVA--ADTYRPAAIEQLKQLAEQVGVPFFGS-GTEKDPVE------  169 (451)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCHHH------
T ss_conf             9858999815679748689999999997499458985--05678689999999998609853167-78899799------


Q ss_pred             HHHHHHHHHHHHHHHCC-CCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEE-EEE
Q ss_conf             99999776356554234-5258723542431000100344424577654442038898411566-520
Q gi|254780218|r   73 AARLDHVENVIRPALME-GKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTII-LDL  138 (225)
Q Consensus        73 adr~~~~~~~I~p~L~~-g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~-Ldv  138 (225)
                           -..+-+..+-.+ .++||+|-         ..+...+.+..+.+..+ .....||=++| +|.
T Consensus       170 -----Iak~al~~ak~~~~DvvIvDT---------AGRl~ide~Lm~El~~I-k~~~~P~E~llVvDa  222 (451)
T COG0541         170 -----IAKAALEKAKEEGYDVVIVDT---------AGRLHIDEELMDELKEI-KEVINPDETLLVVDA  222 (451)
T ss_pred             -----HHHHHHHHHHHCCCCEEEEEC---------CCCCCCHHHHHHHHHHH-HHHCCCCEEEEEEEC
T ss_conf             -----999999999974998899968---------87330309999999999-855398748998764


No 141
>pfam03668 ATP_bind_2 P-loop ATPase protein family. This family contains an ATP-binding site and could be an ATPase (personal obs:C Yeats).
Probab=97.68  E-value=0.0047  Score=38.50  Aligned_cols=151  Identities=14%  Similarity=0.153  Sum_probs=71.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844100110012444541013456777889999977635655
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP   85 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p   85 (225)
                      +|+|.|+-||||||..+.    |+..||-++                       +++.+...-     ...+.+... .+
T Consensus         3 lviVTGlSGAGKStAl~~----LED~Gy~cv-----------------------DNlP~~Ll~-----~~~~~~~~~-~~   49 (284)
T pfam03668         3 LVIITGRSGAGKSVALRA----LEDLGYYCV-----------------------DNLPPQLLP-----RLVDFLLAA-GS   49 (284)
T ss_pred             EEEEECCCCCCHHHHHHH----HHCCCCEEE-----------------------CCCCHHHHH-----HHHHHHHHC-CC
T ss_conf             999957997779999999----981892477-----------------------588999999-----999998624-78


Q ss_pred             HHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHH-HHHHHHCCHHHHHHH
Q ss_conf             4234525872354243100010034442457765444203889841156652034877644321-111100000000211
Q gi|254780218|r   86 ALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQN-RYSLRESACLDYFER  164 (225)
Q Consensus        86 ~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~-R~~~~~~~~~d~~E~  164 (225)
                      ...+=.++|-=|.-           ....+..+.+......... --++|||++.++.++|-+. |....- ...+.   
T Consensus        50 ~~~~lAi~iD~R~~-----------~~~~~~~~~~~~l~~~~~~-~~ilFLdA~~~~LirRy~eTRR~HPL-~~~~~---  113 (284)
T pfam03668        50 RISSVAVVMDVRNR-----------PFSGDLDEQRNELATRAIT-PRILFLEADDDTLVRRYSDTRRSHPL-SGKQL---  113 (284)
T ss_pred             CCCEEEEEEECCCC-----------CCHHHHHHHHHHHHHCCCC-CEEEEEECCCHHHHHHHHHCCCCCCC-CCCCC---
T ss_conf             76526899963665-----------3337699999999866998-26999978808999988873688998-88898---


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHH
Q ss_conf             28899999999999999978994999818-9788999999999999
Q gi|254780218|r  165 KDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVW  209 (225)
Q Consensus       165 ~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~  209 (225)
                       ..+-.++-++....+.. ..  =.+||+ +.++.++.+.|.+.+.
T Consensus       114 -~leaI~~Er~~L~~lr~-~A--d~vIDTS~l~~~~Lr~~i~~~~~  155 (284)
T pfam03668       114 -SLEGIAAERRLLEPLRA-RA--DLIIDTSTLSVHGLRESIRRAFG  155 (284)
T ss_pred             -CHHHHHHHHHHHHHHHH-HC--CEEEECCCCCHHHHHHHHHHHHC
T ss_conf             -69999999999999996-26--59985689999999999999864


No 142
>PRK10867 signal recognition particle protein; Provisional
Probab=97.67  E-value=0.00021  Score=46.58  Aligned_cols=36  Identities=33%  Similarity=0.553  Sum_probs=29.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHH-CCCCEEEE
Q ss_conf             8868998678887979999999999997-79819998
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVT   38 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~-~g~~v~~~   38 (225)
                      ++-.|.+-|+-||||||-+.+|+.+|++ .+.+|.+.
T Consensus        99 ~p~VIm~vGLqGsGKTTT~aKLA~~lk~k~~k~vllv  135 (453)
T PRK10867         99 PPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVV  135 (453)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9969999746888518589999999997389837985


No 143
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=97.66  E-value=0.00018  Score=46.92  Aligned_cols=119  Identities=24%  Similarity=0.307  Sum_probs=62.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE--EEECC--CCCCCCCHHHHCC------C-CCCC--CCCHHHHHHHH
Q ss_conf             868998678887979999999999997798199--98778--8984410011001------2-4445--41013456777
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH--VTREP--GGTPAAEAARHVL------L-SCGV--DEFGAEAEAIV   70 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~--~~~eP--~~t~~ge~ir~~l------~-~~~~--~~~~~~~~~lL   70 (225)
                      -|=|.|.|..|+||||.+.++++.|++.|++|-  .|.|=  |+..+|-.|.++-      + ..+.  ..+..+.-   
T Consensus         5 ~mki~ITG~PGvGKtTl~~ki~e~L~~~g~kvgGf~t~EVR~gGkR~GF~Ivdl~tg~~~~la~~~~~~~rvGkY~V---   81 (179)
T COG1618           5 AMKIFITGRPGVGKTTLVLKIAEKLREKGYKVGGFITPEVREGGKRIGFKIVDLATGEEGILARVGFSRPRVGKYGV---   81 (179)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCCCCCCCCEEEE---
T ss_conf             45999867998458999999999998559665139831142088275159998147955798884788762104786---


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCC-CHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             889999977635655423452587235424310001003444-245776544420388984115665
Q gi|254780218|r   71 FAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSS-QHLFLDSLQEISVQEVMPDCTIIL  136 (225)
Q Consensus        71 faadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~-~~~~i~~l~~~~~~~~~PDl~i~L  136 (225)
                      +.-+..+.....++.|+..-++||.|--        |. +.+ ...+.+.+.... ...+| ++.-+
T Consensus        82 ~v~~le~i~~~al~rA~~~aDvIIIDEI--------Gp-MElks~~f~~~ve~vl-~~~kp-liatl  137 (179)
T COG1618          82 NVEGLEEIAIPALRRALEEADVIIIDEI--------GP-MELKSKKFREAVEEVL-KSGKP-LIATL  137 (179)
T ss_pred             EHHHHHHHHHHHHHHHHHCCCEEEEECC--------CC-HHHCCHHHHHHHHHHH-CCCCC-EEEEE
T ss_conf             2788899868999988634998999433--------63-3020088999999996-58993-79999


No 144
>PRK12337 2-phosphoglycerate kinase; Provisional
Probab=97.63  E-value=0.0055  Score=38.07  Aligned_cols=178  Identities=17%  Similarity=0.255  Sum_probs=84.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHH--------------
Q ss_conf             988868998678887979999999999997798199987788984410011001244454101345--------------
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEA--------------   66 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~--------------   66 (225)
                      ++++..|-|-|.-|+||||.+..|+..|   |+..+..    ...+-|.+|.++-    ..+.|-.              
T Consensus       259 ~~~PiiILIGGaSGvGKSTlAseLA~RL---GI~~VIs----TDsIREVMR~~is----~el~P~Lh~SSy~Awk~L~~~  327 (492)
T PRK12337        259 PPRPLHVLLGGVSGTGKSVLAAELAYRL---GITRVVP----TDAIREVMRAMVS----KDLLPTLHASTFNAWEALVPP  327 (492)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH---CCCCCCC----CHHHHHHHHHHCC----HHHCCHHHHHHHHHHHHCCCC
T ss_conf             6887699960788866888999999960---9881025----4479999998459----764845777556888860873


Q ss_pred             ---------HHHHHH--HHHHHH----HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             ---------677788--999997----76356554234525872354243100010034442457765444203889841
Q gi|254780218|r   67 ---------EAIVFA--AARLDH----VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD  131 (225)
Q Consensus        67 ---------~~lLfa--adr~~~----~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PD  131 (225)
                               +..+..  -+.+++    ++-+|.-++..|.-||..          |. +-++ .++.   ....  ..|.
T Consensus       328 ~~~~~~~~~~~~vi~GF~~Qv~~V~vGl~aVieRa~~EG~SvVIE----------GV-HLvP-g~i~---~~~~--e~~~  390 (492)
T PRK12337        328 GLGLPGEPTRVELLAGFRDQVQQVSVGLKAVVRRSILEGTSLVLE----------GV-HLVP-GYLQ---HAYQ--DGAL  390 (492)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE----------EE-EECH-HHHH---HHHC--CCCE
T ss_conf             457777860768998999999999999999999999728867998----------33-3070-6666---6641--5873


Q ss_pred             EE-EEEEECHHHHHH-HHHHHHHHHHC-CHHHHHHHCCHHHHHHHH---HHHHHHHHHCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             15-665203487764-43211111000-000002112889999999---9999999978994999818978899999999
Q gi|254780218|r  132 CT-IILDLPVDIGLK-RVQNRYSLRES-ACLDYFERKDVMIHEKRR---QIFLDIARNQPDRCHIVDSAHSFQSVATNIL  205 (225)
Q Consensus       132 l~-i~Ldv~~e~a~~-Ri~~R~~~~~~-~~~d~~E~~~~~~~~kv~---~~y~~la~~~~~~~~~IDa~~~~eei~~~I~  205 (225)
                      .+ |.+.++-|...+ |--.|...... ...++|    +.++..+|   +...+.|+++.  +-+||+. ++|+-.++++
T Consensus       391 vIp~mV~i~dEe~Hr~RF~~R~r~t~~~Rp~ekY----Lk~F~eIR~IQdyLv~rAre~g--VPVI~n~-~ldesvd~~~  463 (492)
T PRK12337        391 TVPMLVALPDEEEHRRHFELRDRETAASRPLHRY----MRHFEEIRLMQDHLLRLAREED--VPVLDGE-TLDESADKAV  463 (492)
T ss_pred             EEEEEEEECCHHHHHHHHHHHHHHHCCCCCHHHH----HHHHHHHHHHHHHHHHHHHHCC--CCCCCCC-CHHHHHHHHH
T ss_conf             8999998476799999999875141036860179----9979999999999999998749--9820787-6677999999


Q ss_pred             HHHHHHHH
Q ss_conf             99999998
Q gi|254780218|r  206 NIVWELVQ  213 (225)
Q Consensus       206 ~~i~~~l~  213 (225)
                      ++|...+-
T Consensus       464 evi~~r~~  471 (492)
T PRK12337        464 EVVLRYVM  471 (492)
T ss_pred             HHHHHHHH
T ss_conf             99999999


No 145
>PRK13695 putative NTPase; Provisional
Probab=97.54  E-value=0.00038  Score=44.99  Aligned_cols=32  Identities=38%  Similarity=0.629  Sum_probs=28.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             86899867888797999999999999779819
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      -|=|.|.|..|+||||.++++.+.|.+.|+.+
T Consensus         3 ~~kI~iTG~PGvGKTTli~Kv~~~L~~~g~~v   34 (174)
T PRK13695          3 ALRIGITGMPGVGKTTLVLKIAELLAREGYKV   34 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEE
T ss_conf             42999878999889999999999986369617


No 146
>KOG0781 consensus
Probab=97.53  E-value=0.00043  Score=44.69  Aligned_cols=122  Identities=19%  Similarity=0.332  Sum_probs=67.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCC-CCCCCHHHHHHHHHHH----HHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244-4541013456777889----999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSC-GVDEFGAEAEAIVFAA----ARL   76 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~-~~~~~~~~~~~lLfaa----dr~   76 (225)
                      +++-.|+|.|..|.||||-..+++=||.+.++.|....  .+|.-+..+-++-.+. ....+.+ +..-||.+    |-+
T Consensus       376 krPYvi~fvGVNGVGKSTNLAKIayWLlqNkfrVlIAA--CDTFRsGAvEQLrtHv~rl~~l~~-~~v~lfekGYgkd~a  452 (587)
T KOG0781         376 KRPYVISFVGVNGVGKSTNLAKIAYWLLQNKFRVLIAA--CDTFRSGAVEQLRTHVERLSALHG-TMVELFEKGYGKDAA  452 (587)
T ss_pred             CCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEE--CCCHHHHHHHHHHHHHHHHHHHCC-CHHHHHHHHCCCCHH
T ss_conf             89759999821476651329999999985783699986--243124478999999999987455-204888610477828


Q ss_pred             HHHHHHHHHHHCCC-CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             97763565542345-2587235424310001003444245776544420388984115665
Q gi|254780218|r   77 DHVENVIRPALMEG-KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIIL  136 (225)
Q Consensus        77 ~~~~~~I~p~L~~g-~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~L  136 (225)
                      --..+-|+-+-.+| ++|+.|-         ..++..+......|..+ ...-+||++||.
T Consensus       453 ~vak~AI~~a~~~gfDvvLiDT---------AGRmhn~~~LM~~L~kl-~~~n~pD~i~~V  503 (587)
T KOG0781         453 GVAKEAIQEARNQGFDVVLIDT---------AGRMHNNAPLMTSLAKL-IKVNKPDLILFV  503 (587)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEC---------CCCCCCCHHHHHHHHHH-HHCCCCCEEEEE
T ss_conf             9999999999866987899835---------44334780678999999-744798659985


No 147
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=97.51  E-value=0.00023  Score=46.26  Aligned_cols=48  Identities=35%  Similarity=0.540  Sum_probs=38.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECC-----CCCCCCCHHH
Q ss_conf             86899867888797999999999999779819998-778-----8984410011
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REP-----GGTPAAEAAR   51 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP-----~~t~~ge~ir   51 (225)
                      ...|-|.|+.|+||||.+..|...|..+|+.|-+. -.|     ||+..|..||
T Consensus        51 a~viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp~TGGsiLGDRiR  104 (323)
T COG1703          51 AHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIR  104 (323)
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHH
T ss_conf             837873179988668899999999997796789999889999878530120766


No 148
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=97.50  E-value=0.0011  Score=42.34  Aligned_cols=37  Identities=24%  Similarity=0.254  Sum_probs=32.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8868998678887979999999999997798199987
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      ++..|.+-|+-||||||-+.+|+.++..+|.+|.+..
T Consensus        74 ~~~vI~lvG~~G~GKTTT~AKLA~~~~~~~~kV~lia  110 (270)
T PRK06731         74 EVQTIALIGPTGVGKTTTLAKMAWQFHGKKKTVGFIT  110 (270)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9818999888989889999999999986799089998


No 149
>PRK13768 GTPase; Provisional
Probab=97.49  E-value=0.0013  Score=41.73  Aligned_cols=89  Identities=24%  Similarity=0.446  Sum_probs=49.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCC--CCC--CCHHHHCCCCC---CCCCCHHHHHHHHHHHH---
Q ss_conf             8998678887979999999999997798199987-7889--844--10011001244---45410134567778899---
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPGG--TPA--AEAARHVLLSC---GVDEFGAEAEAIVFAAA---   74 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~~--t~~--ge~ir~~l~~~---~~~~~~~~~~~lLfaad---   74 (225)
                      .+++-|+-||||||.++.+.++|+..|.++.++. -|+.  .+.  .=-||+.+--.   ..-.+.|.. +++|+.+   
T Consensus         4 ~~~ViGpaGSGKsT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIRd~i~~~dVM~~~~LGPNG-ali~~~e~l~   82 (253)
T PRK13768          4 IVFFLGTAGSGKTTLVGALSDWLEEQGYDVAIVNLDPAVEYLPYKPDIDVREYVSAREIMRKYGLGPNG-ALIASVDLLL   82 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHCCCCCH-HHHHHHHHHH
T ss_conf             899989999988999999999999769975999789866589999886378617899999881989646-8999999999


Q ss_pred             -HHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             -99977635655423452587235
Q gi|254780218|r   75 -RLDHVENVIRPALMEGKILLCDR   97 (225)
Q Consensus        75 -r~~~~~~~I~p~L~~g~iVI~DR   97 (225)
                       +.+.+.+.+.. + +...||.|=
T Consensus        83 ~~~d~l~~~i~~-~-~~dY~i~D~  104 (253)
T PRK13768         83 TKAEEIKEEIER-L-DADYVLVDT  104 (253)
T ss_pred             HHHHHHHHHHHH-C-CCCEEEEEC
T ss_conf             989999999851-5-887599826


No 150
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA; InterPro: IPR011917   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes .; GO: 0005524 ATP binding, 0006869 lipid transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=97.46  E-value=0.00018  Score=46.94  Aligned_cols=89  Identities=27%  Similarity=0.436  Sum_probs=60.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997798199987788984410011001244454101345677788999997763
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~   81 (225)
                      +.|..|++=|--||||||.+++|-++.           ||++   |    ++++|+.  ++..++...|    |. |+  
T Consensus       386 ~~G~~vALVGRSGSGKsTlv~LlPRFy-----------~p~~---G----~IllDG~--~l~d~~L~~L----R~-q~--  438 (603)
T TIGR02203       386 EPGETVALVGRSGSGKSTLVNLLPRFY-----------EPDS---G----QILLDGV--DLQDYTLADL----RR-QV--  438 (603)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHCCCCC-----------CCCC---C----CEEECCC--HHHHCCHHHH----HH-HH--
T ss_conf             587359987068853899985523660-----------4588---8----5652784--0443026635----62-30--


Q ss_pred             HHHHHHCCCCEEEECCCCCCCEEHHCCC--CCCCHHHHHHHHH
Q ss_conf             5655423452587235424310001003--4442457765444
Q gi|254780218|r   82 VIRPALMEGKILLCDRFLDSSYAYQGER--DSSQHLFLDSLQE  122 (225)
Q Consensus        82 ~I~p~L~~g~iVI~DRy~~S~lAYQ~~~--~~~~~~~i~~l~~  122 (225)
                          +|-...+++.|=-+..|+|| |..  ...+.+.++.--.
T Consensus       439 ----alVsQ~V~LFdDTiA~NvaY-g~~da~~~~~a~v~~A~~  476 (603)
T TIGR02203       439 ----ALVSQDVVLFDDTIANNVAY-GRLDAEQVDRAEVERALA  476 (603)
T ss_pred             ----HHHCCCEEECCCCHHHHHHH-CCCCCCCCCHHHHHHHHH
T ss_conf             ----00215237205326776440-423400178789999999


No 151
>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=97.40  E-value=0.00083  Score=43.00  Aligned_cols=29  Identities=31%  Similarity=0.439  Sum_probs=26.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             99867888797999999999999779819
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      |-|.|..|+||||.++++.+.|++.|+++
T Consensus         2 i~ITG~pGvGKTTli~kv~~~l~~~~~~v   30 (168)
T pfam03266         2 IFITGPPGVGKTTLVKKVIELLKSEGVKV   30 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEE
T ss_conf             89978999889999999999998679707


No 152
>PRK05416 hypothetical protein; Provisional
Probab=97.38  E-value=0.012  Score=36.08  Aligned_cols=150  Identities=15%  Similarity=0.199  Sum_probs=70.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68998678887979999999999997798199987788984410011001244454101345677788999997763565
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
                      .+|++.|+-||||||..+.    |+..||-++                       +++.+....     +..++..+   
T Consensus         7 ~lviVTGlSGAGKStAl~~----LEDlGy~ci-----------------------DNlP~~Ll~-----~l~~~~~~---   51 (292)
T PRK05416          7 RLVIVTGLSGAGKSVALRA----LEDLGYYCV-----------------------DNLPPSLLP-----KLVELLAQ---   51 (292)
T ss_pred             EEEEEECCCCCCHHHHHHH----HHHCCCEEE-----------------------CCCCHHHHH-----HHHHHHHC---
T ss_conf             8999968997879999999----981794478-----------------------688889999-----99999724---


Q ss_pred             HHHCCC-CEEEEC-CCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHH-HHHHHHCCHHHH
Q ss_conf             542345-258723-54243100010034442457765444203889841156652034877644321-111100000000
Q gi|254780218|r   85 PALMEG-KILLCD-RFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQN-RYSLRESACLDY  161 (225)
Q Consensus        85 p~L~~g-~iVI~D-Ry~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~-R~~~~~~~~~d~  161 (225)
                      ....++ .++ +| |.           .....+..+.+..+.... .+--++|||++.++.++|-.. |....-......
T Consensus        52 ~~~~~~lAv~-iD~R~-----------~~~~~~l~~~~~~l~~~~-~~~~ilFLdA~~~~LlrRy~eTRR~HPL~~~~~~  118 (292)
T PRK05416         52 SGGIDKVAVV-IDVRS-----------RPFFLDLPEALDELRERG-IDVRVLFLDASDEVLIRRYSETRRRHPLSGDGGS  118 (292)
T ss_pred             CCCCCCEEEE-EECCC-----------CCCHHHHHHHHHHHHHCC-CCEEEEEEECCHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             7887706999-82466-----------544778999999998579-9559999978869999988750689998889999


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHHH
Q ss_conf             21128899999999999999978994999818-9788999999999999
Q gi|254780218|r  162 FERKDVMIHEKRRQIFLDIARNQPDRCHIVDS-AHSFQSVATNILNIVW  209 (225)
Q Consensus       162 ~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa-~~~~eei~~~I~~~i~  209 (225)
                      ..    +-.++-++....+.. ..+  .+||+ +.++.++.+.|.+.+.
T Consensus       119 L~----eaI~~Er~~L~~ir~-~Ad--~vIDTS~l~~~~Lr~~i~~~~~  160 (292)
T PRK05416        119 LL----EAIELERELLAPLRE-RAD--LVIDTSELSVHQLRERIRERFG  160 (292)
T ss_pred             HH----HHHHHHHHHHHHHHH-HCC--EEEECCCCCHHHHHHHHHHHHC
T ss_conf             89----999999999999997-402--8974799999999999999865


No 153
>TIGR00235 udk uridine kinase; InterPro: IPR000764   Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP  A cDNA for uridine kinase from mouse brain was found which encodes a protein of 277 amino acids. A truncated form of the cDNA was expressed in Escherichia coli, and shown to display uridine kinase activity and to readily form a tetramer, the most active form of the wild-type enzyme. Sequence analysis has identified three ATP-binding site consensus motifs. The predicted secondary structure, and sequence comparison with kinases of known structure, is consistent with uridine kinase having the alpha/beta core nucleotide-binding fold common to many kinases .; GO: 0005524 ATP binding, 0016773 phosphotransferase activity alcohol group as acceptor.
Probab=97.37  E-value=0.0042  Score=38.80  Aligned_cols=134  Identities=19%  Similarity=0.210  Sum_probs=72.5

Q ss_pred             CCEEEEECCCCCCH----HHHHHHHHHHHHHCCCCEEEEECCC-CCCC--CCHHHHCCCCCCCCCCHHHHH--HHHHHHH
Q ss_conf             86899867888797----9999999999997798199987788-9844--100110012444541013456--7778899
Q gi|254780218|r    4 GLFISFEGIEGAGK----TTHISLLKRFLQRKNYDVHVTREPG-GTPA--AEAARHVLLSCGVDEFGAEAE--AIVFAAA   74 (225)
Q Consensus         4 g~~I~iEGiDGsGK----sTq~~~L~~~L~~~g~~v~~~~eP~-~t~~--ge~ir~~l~~~~~~~~~~~~~--~lLfaad   74 (225)
                      ..+|+|-|.-||||    ||.++.+.+.|.++-..+..+.+=+ ..+.  +..-...-  .+.+-=+|.++  -||    
T Consensus        10 c~iigI~GgSgSGKs~iATtV~~~i~~~~~~kv~~~~~I~~D~YYK~~GP~~~~~~~r--~~~NfDHP~AfD~~Ll----   83 (220)
T TIGR00235        10 CIIIGISGGSGSGKSLIATTVARKIYEQLGKKVLEIVLISQDNYYKDQGPSDLEMAER--KKTNFDHPDAFDNDLL----   83 (220)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCHHHHHH--HCCCCCCCHHCCHHHH----
T ss_conf             1799701766101567899999999998314001457750324458898873124643--1258898003037999----


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHC-CCCC-------------CCHHHHHHHHHHHCCCCCCCEEEEEEECH
Q ss_conf             999776356554234525872354243100010-0344-------------42457765444203889841156652034
Q gi|254780218|r   75 RLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDS-------------SQHLFLDSLQEISVQEVMPDCTIILDLPV  140 (225)
Q Consensus        75 r~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~-~~~~-------------~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~  140 (225)
                       ++|+.     +|.+|..|  |==+||-.-|.- ...+             +-...=+.+.+      .-|+-||.|+|-
T Consensus        84 -~~Hl~-----nLk~g~~~--~~P~Ydyv~HtRv~~eT~~~~P~~VvIlEGi~~l~D~Rl~~------L~dlkifvDt~~  149 (220)
T TIGR00235        84 -YEHLK-----NLKNGSAI--DVPVYDYVNHTRVKKETVHVEPKDVVILEGILLLTDERLRD------LMDLKIFVDTPL  149 (220)
T ss_pred             -HHHHH-----HHHCCCEE--CCCCCCCCCEECCCCCCEEECCEEEEEEECCHHHHHHHHHH------HHCCEEEEECCC
T ss_conf             -99999-----98468802--24542541002025562687350689970618888799988------718236774683


Q ss_pred             HHHHHHHHHHHHHHHCC
Q ss_conf             87764432111110000
Q gi|254780218|r  141 DIGLKRVQNRYSLRESA  157 (225)
Q Consensus       141 e~a~~Ri~~R~~~~~~~  157 (225)
                      ++++-|...|.-.+.+.
T Consensus       150 D~rliRRl~RD~~~RGR  166 (220)
T TIGR00235       150 DIRLIRRLERDIEERGR  166 (220)
T ss_pred             HHHHHHHHHHHHHHCCC
T ss_conf             03256565655754289


No 154
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=97.37  E-value=0.00051  Score=44.23  Aligned_cols=50  Identities=30%  Similarity=0.435  Sum_probs=39.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCC-----CCCCCCHHHH
Q ss_conf             886899867888797999999999999779819998-7788-----9844100110
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPG-----GTPAAEAARH   52 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~-----~t~~ge~ir~   52 (225)
                      +...|-|.|+.|+||||.+..|...|.++|.+|-+. -.|+     |.-.|..+|=
T Consensus        28 ~a~~iGiTG~PGaGKStli~~l~~~~~~~g~~vaVlAvDPSS~~sgGaiLGDr~RM   83 (267)
T pfam03308        28 RAHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRTRM   83 (267)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHH
T ss_conf             95599876899887999999999999968986899997899988886300107777


No 155
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]
Probab=97.32  E-value=0.0044  Score=38.64  Aligned_cols=119  Identities=20%  Similarity=0.224  Sum_probs=60.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCC----------------CCCCCCHHHHCCCC--CCCCCCHHHH
Q ss_conf             8998678887979999999999997798199987-788----------------98441001100124--4454101345
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPG----------------GTPAAEAARHVLLS--CGVDEFGAEA   66 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~----------------~t~~ge~ir~~l~~--~~~~~~~~~~   66 (225)
                      -+.+-|+-.|||||.+..|++.+-++|+++..+. -||                +..++  ++++...  --.+.++|..
T Consensus        75 ~vmvvG~vDSGKSTLt~~LaN~~l~rG~~v~iiDaDvGQ~ei~pPg~ISL~~~~s~~~~--L~~l~~~~~~FvG~isP~~  152 (398)
T COG1341          75 VVMVVGPVDSGKSTLTTYLANKLLARGRKVAIIDADVGQSEIGPPGFISLAFPESPVIS--LSELEPFTLYFVGSISPQG  152 (398)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEECCCCCCCC--HHHCCCCCEEEEECCCCCC
T ss_conf             89998986767889999999887644741899968999766679746774125677777--7775865227985147777


Q ss_pred             HHHHHHH--HHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHH
Q ss_conf             6777889--9999776356554234525872354243100010034442457765444203889841156652034877
Q gi|254780218|r   67 EAIVFAA--ARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIG  143 (225)
Q Consensus        67 ~~lLfaa--dr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a  143 (225)
                      ....+.+  +|.  ++.    +.+.-.+||.|=   +.+.+     +.....+   ........+||++++|+..-+.+
T Consensus       153 ~~~~~i~~v~rL--~~~----a~~~~~~ilIdT---~GWi~-----G~~g~el---k~~li~~ikP~~Ii~l~~~~~~~  214 (398)
T COG1341         153 FPGRYIAGVARL--VDL----AKKEADFILIDT---DGWIK-----GWGGLEL---KRALIDAIKPDLIIALERANELS  214 (398)
T ss_pred             CHHHHHHHHHHH--HHH----HHCCCCEEEECC---CCCEE-----CCHHHHH---HHHHHHHCCCCEEEEECCCCCCC
T ss_conf             768999999999--998----651687799969---98430-----7427899---99988650977899931445323


No 156
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=97.30  E-value=0.00059  Score=43.85  Aligned_cols=49  Identities=31%  Similarity=0.475  Sum_probs=38.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCC-----CCCCCCHHH
Q ss_conf             886899867888797999999999999779819998-7788-----984410011
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPG-----GTPAAEAAR   51 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~-----~t~~ge~ir   51 (225)
                      +...|-|.|+.|+||||.+..|...|.++|..|-+. -.|+     |.-.|..+|
T Consensus        48 ~a~~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDPsS~~sgGaiLGDr~R  102 (325)
T PRK09435         48 NALRIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDPSSTRTGGSILGDKTR  102 (325)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHH
T ss_conf             8259974279998688999999999996798589999789999888610103888


No 157
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006417   The NadR protein of Escherichia coli and closely related bacteria is both enzyme and regulatory protein. The first 60 or so amino acids, N-terminal region is a DNA-binding helix-turn-helix domain (IPR001387 from INTERPRO) responsible for repressing the nadAB genes of NAD de novo biosynthesis. The NadR homologs in Mycobacterium tuberculosis, Haemophilus influenzae, and others appear to lack the repressor domain. NadR has recently been shown to act as an enzyme of the salvage pathway of NAD biosynthesis, nicotinamide-nucleotide adenylyltransferase; members of this family are presumed to share this activity. E. coli NadR has also been found to regulate the import of its substrate, nicotinamide ribonucleotide, but it is not known if the other members of this family share that activity.  ; GO: 0003677 DNA binding, 0030528 transcription regulator activity, 0006810 transport, 0019363 pyridine nucleotide biosynthetic process, 0045449 regulation of transcription.
Probab=97.27  E-value=0.00053  Score=44.14  Aligned_cols=119  Identities=16%  Similarity=0.177  Sum_probs=61.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             689986788879799999999999977981999877889844100110012444--541013456777889999977635
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCG--VDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~--~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      +.++|=|..-|||||++++|++.|+..          ...+.|...+...+++.  .-.++.+....+   -..+..+..
T Consensus       176 k~V~ilG~eStGKstLv~~lA~~~nt~----------~~~Eyar~y~e~~~ggDe~~L~~~dY~~~~~---G~~~~~~~~  242 (346)
T TIGR01526       176 KTVAILGGESTGKSTLVNKLAEKLNTT----------SAWEYAREYVEAKLGGDEIALQYSDYARIVL---GQIDYIDAA  242 (346)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCC----------CCHHHHHHHHHHHCCCCHHHHHCCCHHHHHH---HHHHHHHHH
T ss_conf             588885588863689999999984688----------7125655666651687214542034378764---246677786


Q ss_pred             HHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCC--CCC-CEEEEEEEC
Q ss_conf             655423452587235424310001003444245776544420388--984-115665203
Q gi|254780218|r   83 IRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQE--VMP-DCTIILDLP  139 (225)
Q Consensus        83 I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~--~~P-Dl~i~Ldv~  139 (225)
                      ++.+ .+.+|++||==...|-||  +....+.+..+.|+-+....  -.| ||||+|.=+
T Consensus       243 v~~a-~nq~v~f~DTD~i~T~vf--a~~y~G~eDfeql~P~~~~~i~~~r~DL~ll~~p~  299 (346)
T TIGR01526       243 VRDA-DNQKVAFIDTDFITTQVF--AKLYEGREDFEQLHPFLKKTIAEYRFDLTLLLKPN  299 (346)
T ss_pred             HCCC-CCCEEEEEECCHHHHHHH--HHHCCCCCCHHHCCHHHHHHHHHCCCCEEEEECCC
T ss_conf             3073-237478984776789999--98707865544506278877632788479972799


No 158
>COG3911 Predicted ATPase [General function prediction only]
Probab=97.21  E-value=0.0068  Score=37.54  Aligned_cols=168  Identities=18%  Similarity=0.137  Sum_probs=78.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHH----HHHH
Q ss_conf             988868998678887979999999999997798199987788984410011001244454101345677788----9999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFA----AARL   76 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfa----adr~   76 (225)
                      |++-++.++.|..|+||||+.+.|+    ..|+.++.  ||+..    .|+..-.  ..+..-|+++..+|+    +.+.
T Consensus         6 ~nR~~~fIltGgpGaGKTtLL~aLa----~~Gfatve--e~~r~----ii~~es~--~gg~~lPW~D~~afael~~~~~l   73 (183)
T COG3911           6 FNRHKRFILTGGPGAGKTTLLAALA----RAGFATVE--EAGRD----IIALESA--QGGTALPWTDPGAFAELVGLQRL   73 (183)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHH----HCCCEEEC--CCHHH----HHHHHHH--CCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             5653389983799976899999999----75863501--34166----8999875--48976776476899999999999


Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCC-HHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
Q ss_conf             9776356554234525872354243100010034442-457765444203889841156652034877644321111100
Q gi|254780218|r   77 DHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQ-HLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE  155 (225)
Q Consensus        77 ~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~-~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~  155 (225)
                      ...    + .-+.+..|..||-....+||-....+.. ...+..+....-..|   . +||--|......--..|.    
T Consensus        74 ~q~----r-~~~~~~~vFfDR~~~da~a~l~~lsga~la~~v~~~~~~~~Yn~---r-Vfl~qp~~~iyqqde~Rk----  140 (183)
T COG3911          74 RQT----R-SAAVGGRVFFDRGPPDALAYLRFLSGALLADEVATIVREGRYNP---R-VFLVQPWPFIYQQDEERK----  140 (183)
T ss_pred             HHH----H-CCCCCCCEEECCCCHHHHHHHHHHCCCHHHHHHHHHHHHCCCCC---C-EEECCCCCCCCCCHHHCC----
T ss_conf             986----4-01336713541572779999998425277789999998357787---2-786389631140123146----


Q ss_pred             CCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEC-CCCCHHHHHHHH
Q ss_conf             0000002112889999999999999997899499981-897889999999
Q gi|254780218|r  156 SACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVD-SAHSFQSVATNI  204 (225)
Q Consensus       156 ~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~ID-a~~~~eei~~~I  204 (225)
                       ...|    +-..+++.....|.+|     + +..|+ .-.++++=..-|
T Consensus       141 -~tld----eAv~~~e~lv~aYt~L-----G-yelv~lp~a~Ve~Rv~fV  179 (183)
T COG3911         141 -ITLD----EAVAFYEVLVAAYTEL-----G-YELVPLPPAPVEDRVRFV  179 (183)
T ss_pred             -CCHH----HHHHHHHHHHHHHHHC-----C-CEEEECCCCCHHHHHHHH
T ss_conf             -6888----9999999999998723-----8-436426875489999999


No 159
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=97.20  E-value=0.0047  Score=38.50  Aligned_cols=37  Identities=27%  Similarity=0.285  Sum_probs=32.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8868998678887979999999999997798199987
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      +|-++.+||-.|+|||+.+..+.-..-+.|.++.++.
T Consensus        23 ~gs~~li~G~~GtGKsi~~~~~~~~~l~~g~~~~yis   59 (230)
T PRK08533         23 FGSIILIEGDESTGKSILSQRLAYGFLQNGYSVSYVS   59 (230)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9848999868998789999999999987898699999


No 160
>KOG4238 consensus
Probab=97.20  E-value=0.0015  Score=41.45  Aligned_cols=117  Identities=21%  Similarity=0.313  Sum_probs=74.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999977981999877889844100110012444541013456777889999977635
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENV   82 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~   82 (225)
                      +|.-|-+.|+.|+||||.+-.|.++|.+.|+++..       --|.-||.-|  .+.-.++|.        ||-+++.++
T Consensus        49 rgctvw~tglsgagkttis~ale~~l~~~gipcy~-------ldgdnirhgl--~knlgfs~e--------dreenirri  111 (627)
T KOG4238          49 RGCTVWLTGLSGAGKTTISFALEEYLVSHGIPCYS-------LDGDNIRHGL--NKNLGFSPE--------DREENIRRI  111 (627)
T ss_pred             CCEEEEEEECCCCCCCEEEHHHHHHHHHCCCCCCC-------CCCCHHHHHH--HHCCCCCHH--------HHHHHHHHH
T ss_conf             55158743047788524207899999865985103-------4760266655--412698835--------578889999


Q ss_pred             HH--HHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHH
Q ss_conf             65--542345258723542431000100344424577654442038898411566520348776443
Q gi|254780218|r   83 IR--PALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRV  147 (225)
Q Consensus        83 I~--p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri  147 (225)
                      -+  +..++.. .||=-.+.|.++       -+...-..++.-.   -.|-+-+|.|.|.+++.+|-
T Consensus       112 aevaklfadag-lvcitsfispf~-------~dr~~arkihe~~---~l~f~ev~v~a~l~vceqrd  167 (627)
T KOG4238         112 AEVAKLFADAG-LVCITSFISPFA-------KDRENARKIHESA---GLPFFEVFVDAPLNVCEQRD  167 (627)
T ss_pred             HHHHHHHHCCC-CEEHHHHCCHHH-------HHHHHHHHHHCCC---CCCEEEEEECCCHHHHHCCC
T ss_conf             99999873577-142103348344-------3035566541026---98629998247056653037


No 161
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=97.17  E-value=0.0019  Score=40.88  Aligned_cols=115  Identities=17%  Similarity=0.191  Sum_probs=59.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHH----CCCCEEEEECCCCC-CCCC--HHHHC--CCCCCCCCCHHHHHHHHHHH
Q ss_conf             8868998678887979999999999997----79819998778898-4410--01100--12444541013456777889
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQR----KNYDVHVTREPGGT-PAAE--AARHV--LLSCGVDEFGAEAEAIVFAA   73 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~----~g~~v~~~~eP~~t-~~ge--~ir~~--l~~~~~~~~~~~~~~lLfaa   73 (225)
                      ++++|+|=|+-|+||||-+.+|+.++.-    ++.+|.++.  .+| ++|.  -++.+  +++-.           ++.+
T Consensus       173 k~~vi~lVGPTGvGKTTTiAKLAa~~~l~~~~k~~~V~lit--~DtyRigAveQLktya~il~vp-----------~~v~  239 (388)
T PRK12723        173 KKRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIIT--IDNYRIGAKKQIQTYGDIMGIP-----------VKAI  239 (388)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEE--ECCCCHHHHHHHHHHHHHHCCC-----------EEEE
T ss_conf             76289998998875787999999999986267677379998--0787588999999999997880-----------6985


Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCC-CCHHHHHHHHHHHCCCCCCCEEEEEEECHHH
Q ss_conf             99997763565542345258723542431000100344-4245776544420388984115665203487
Q gi|254780218|r   74 ARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDS-SQHLFLDSLQEISVQEVMPDCTIILDLPVDI  142 (225)
Q Consensus        74 dr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~-~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~  142 (225)
                      ...+-+...+. .+.+.++|+.|-          +++. .+...+..+..+.. ...||..++|-++...
T Consensus       240 ~~~~dl~~~l~-~~~~~D~IlIDT----------AGrs~~d~~~~~el~~~~~-~~~~~~~~~Lvlsat~  297 (388)
T PRK12723        240 ESFKDLKEEIT-QSKDFDLVLIDT----------IGKSPKDFMKLAEMKELLN-ACGRDAEFHLAVSSTT  297 (388)
T ss_pred             CCHHHHHHHHH-HHCCCCEEEEEC----------CCCCCCCHHHHHHHHHHHH-HCCCCCEEEEEECCCC
T ss_conf             78899999999-724999999958----------9988568999999999997-4189845999987989


No 162
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.; GO: 0005525 GTP binding, 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=97.15  E-value=0.0019  Score=40.80  Aligned_cols=114  Identities=18%  Similarity=0.308  Sum_probs=65.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CC--HH-------HHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             8689986788879799999999999977981999877889844-10--01-------10012444541013456777889
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-AE--AA-------RHVLLSCGVDEFGAEAEAIVFAA   73 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~-ge--~i-------r~~l~~~~~~~~~~~~~~lLfaa   73 (225)
                      ...|=|=|+=||||||-|.+|+=+.+.+|+++-+++  -+|.- |.  -+       +=.+++ .+.+.+|---|.    
T Consensus       121 ~~ViMfVGLQGaGKTTtctKLA~YYk~rGfK~~lvC--ADTFRAGAFdQLkqNA~kA~iPFYG-sy~E~DPVkiA~----  193 (453)
T TIGR01425       121 SSVIMFVGLQGAGKTTTCTKLAYYYKRRGFKPALVC--ADTFRAGAFDQLKQNATKAKIPFYG-SYLESDPVKIAS----  193 (453)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEC--CCCCCCCHHHHHHHHHHHCCCCCCC-CCCCCCCEEEEC----
T ss_conf             215888621488715668787777632664325651--7754232489998747644897120-104898707800----


Q ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEE-EEECH
Q ss_conf             99997763565542345258723542431000100344424577654442038898411566-52034
Q gi|254780218|r   74 ARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTII-LDLPV  140 (225)
Q Consensus        74 dr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~-Ldv~~  140 (225)
                      -=.+.+.      -++.++||.|=         +.++.-+...-+.+.+. ....+||.+|| .|-+.
T Consensus       194 EGv~~Fk------~E~~diIivDT---------SGRHkQe~~LF~Em~qv-~~Ai~Pd~iifVMDGsI  245 (453)
T TIGR01425       194 EGVEKFK------KEKFDIIIVDT---------SGRHKQEEELFEEMVQV-AEAIKPDSIIFVMDGSI  245 (453)
T ss_pred             CCHHHHH------CCCCCEEEEEC---------CCCCHHHHHHHHHHHHH-HHCCCCCCEEEEECCCH
T ss_conf             2011322------12784799837---------98732258888998768-63349983699806616


No 163
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=97.14  E-value=0.00087  Score=42.88  Aligned_cols=47  Identities=30%  Similarity=0.421  Sum_probs=35.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCCC-----CCCCCHHHH
Q ss_conf             899867888797999999999999779819998-77889-----844100110
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPGG-----TPAAEAARH   52 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~~-----t~~ge~ir~   52 (225)
                      .|-|.|+.||||||++..|...|.++|++|-+. --|.+     .-.|..+|-
T Consensus         1 viGitG~pGaGKStLi~~l~~~~~~~g~~VaVlavDPsS~~sgGalLGDRiRm   53 (148)
T cd03114           1 VIGITGVPGAGKSTLIDALITALRARGKRVAVLAIDPSSPFSGGAILGDRIRM   53 (148)
T ss_pred             CEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHH
T ss_conf             97625899787899999999999978983799996888786686203235453


No 164
>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.
Probab=97.14  E-value=0.013  Score=35.87  Aligned_cols=37  Identities=30%  Similarity=0.496  Sum_probs=29.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             8886899867888797999999999999779819998
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      ..|+-|.+.|.=||||||..+++.+.|++..-.++++
T Consensus        18 ~~~~vIgl~G~WGsGKTs~l~~~~~~L~~~~~~~~~v   54 (301)
T pfam07693        18 APGFVIGLYGAWGSGKTSFLNLLEDELKEFPEEFHIV   54 (301)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             9997999989899999999999999986136882699


No 165
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein B; InterPro: IPR004435   The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism , .    In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which coverts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner . MoCF is the active co-factor in eukaryotic and some prokaryotic molybdoenzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdoenzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF . Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 () of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) .   The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=97.12  E-value=0.00065  Score=43.63  Aligned_cols=36  Identities=28%  Similarity=0.448  Sum_probs=32.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             899867888797999999999999779819998778
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      +|.|-|.-+|||||++..|.+.|.++||.|.+++.-
T Consensus         1 v~~i~G~k~SGKTtL~~~l~~~L~~~Gy~V~~IKH~   36 (165)
T TIGR00176         1 VLQIVGYKNSGKTTLIERLVKALKARGYRVATIKHD   36 (165)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             937896258867899999999997079950898608


No 166
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=97.08  E-value=0.0014  Score=41.65  Aligned_cols=35  Identities=20%  Similarity=0.283  Sum_probs=32.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             89986788879799999999999977981999877
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE   40 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e   40 (225)
                      +|.|-|--||||||++..|...|.++|+.|-+++.
T Consensus         4 ii~ivG~s~SGKTTLi~kli~~l~~~G~rV~~IKH   38 (170)
T PRK10751          4 LLAIAAWSGTGKTTLLKKLIPALCARGIRPGLIKH   38 (170)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             79999469999999999999999987984999945


No 167
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.08  E-value=0.011  Score=36.18  Aligned_cols=121  Identities=22%  Similarity=0.238  Sum_probs=62.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCH-HHHHHHHHHHHHHHHHHH
Q ss_conf             8868998678887979999999999997798199987788984410011001244454101-345677788999997763
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG-AEAEAIVFAAARLDHVEN   81 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~-~~~~~lLfaadr~~~~~~   81 (225)
                      ++-|+++.|--|+||||.++.|.+.|....+.+.....|.-+ ..+.++.+...-+...-. .....  +.     .+.+
T Consensus        42 ~~g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~~~l~-~~~ll~~i~~~lg~~~~~~~~~~~--~~-----~l~~  113 (269)
T TIGR03015        42 REGFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVNTRVD-AEDLLRMVAADFGLETEGRDKAAL--LR-----ELED  113 (269)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCC-HHHHHHHHHHHCCCCCCCCCHHHH--HH-----HHHH
T ss_conf             896599972998988999999998459345489997699999-999999999985989889899999--99-----9999


Q ss_pred             HHHHHHCCC--CEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHC--CCCCCCEEEEEEECHHH
Q ss_conf             565542345--25872354243100010034442457765444203--88984115665203487
Q gi|254780218|r   82 VIRPALMEG--KILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV--QEVMPDCTIILDLPVDI  142 (225)
Q Consensus        82 ~I~p~L~~g--~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~--~~~~PDl~i~Ldv~~e~  142 (225)
                      .+......|  .++|.|=           ...++.+.++.+..+..  ..-.+=+.++|=-.|+.
T Consensus       114 ~L~~~~~~g~~~vliIDE-----------Aq~L~~~~Le~Lr~L~n~e~~~~~ll~iiL~GqpeL  167 (269)
T TIGR03015       114 FLIEQFAAGKRALLVVDE-----------AQNLTPELLEELRMLSNFQTDNAKLLQIFLVGQPEF  167 (269)
T ss_pred             HHHHHHHCCCCEEEEEEC-----------HHHCCHHHHHHHHHHHCCCCCCCCCEEEEEECCHHH
T ss_conf             999999669946999724-----------221999999999999701358887048999578679


No 168
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=96.98  E-value=0.0054  Score=38.13  Aligned_cols=86  Identities=23%  Similarity=0.286  Sum_probs=46.1

Q ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCC--CC--CCHHHHCCCCC---CCCCCHHHHHHHHHHHHH-HHHHH
Q ss_conf             678887979999999999997798199987-78898--44--10011001244---454101345677788999-99776
Q gi|254780218|r   10 EGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPGGT--PA--AEAARHVLLSC---GVDEFGAEAEAIVFAAAR-LDHVE   80 (225)
Q Consensus        10 EGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~~t--~~--ge~ir~~l~~~---~~~~~~~~~~~lLfaadr-~~~~~   80 (225)
                      -|+-||||||.++.+.++++..|.++.++. -|+..  +.  .=-||+.+--.   ....+.|.. +++|+.+. .+++.
T Consensus         2 iGpaGSGKTT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIrd~i~~~dvM~~~~LGPNG-ali~~me~l~~~~d   80 (234)
T pfam03029         2 VGGAGSGKTTFVGALSEILPLRGRSVYVVNLDPAAENLPYEADIDIRELITVADVMEDYGLGPNG-ALTVAMDFGRITLD   80 (234)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHCCCCCCH-HHHHHHHHHHHHHH
T ss_conf             89898988999999999999779975999789866589998777178746799999982989738-99999999999999


Q ss_pred             HHHHHHHC-CCCEEEECC
Q ss_conf             35655423-452587235
Q gi|254780218|r   81 NVIRPALM-EGKILLCDR   97 (225)
Q Consensus        81 ~~I~p~L~-~g~iVI~DR   97 (225)
                      . +...++ ....+|.|=
T Consensus        81 ~-l~~~l~~~~~y~l~Dt   97 (234)
T pfam03029        81 W-LLEELEYEDDYYLFDT   97 (234)
T ss_pred             H-HHHHHCCCCCEEEEEC
T ss_conf             9-9998525577699836


No 169
>CHL00181 cbbX CbbX; Provisional
Probab=96.95  E-value=0.0073  Score=37.36  Aligned_cols=30  Identities=43%  Similarity=0.640  Sum_probs=27.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             868998678887979999999999997798
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNY   33 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~   33 (225)
                      +.=.+|.|..|.||||.++++++.|.+.|+
T Consensus        59 s~h~vF~GnPGTGKTTVARl~a~il~~lG~   88 (287)
T CHL00181         59 GLHMSFTGSPGTGKTTVALKMADILYRLGY   88 (287)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             653888789986799999999999998699


No 170
>COG1855 ATPase (PilT family) [General function prediction only]
Probab=96.90  E-value=0.0015  Score=41.41  Aligned_cols=48  Identities=23%  Similarity=0.387  Sum_probs=36.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHH
Q ss_conf             88689986788879799999999999977981999877889844100110
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARH   52 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~   52 (225)
                      +|.|  |-|..|+||||.+..|++++.++|.-|.++--|-+-..+..|-+
T Consensus       264 eGIL--IAG~PGaGKsTFaqAlAefy~~~GkiVKTmEsPRDl~v~~eITQ  311 (604)
T COG1855         264 EGIL--IAGAPGAGKSTFAQALAEFYASQGKIVKTMESPRDLQVSPEITQ  311 (604)
T ss_pred             CCEE--EECCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCHHHHH
T ss_conf             6469--95699997468999999999866968863247513568866632


No 171
>PRK13764 ATPase; Provisional
Probab=96.90  E-value=0.0016  Score=41.33  Aligned_cols=45  Identities=24%  Similarity=0.383  Sum_probs=34.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCH
Q ss_conf             88689986788879799999999999977981999877889844100
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEA   49 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~   49 (225)
                      +|.|  |-|..||||||.++.|++++.++|.-|.++--|.+-.....
T Consensus       260 ~Gil--IaG~PGaGKsTfaqalA~~~~~~g~iVKTmEsPRDl~v~~~  304 (605)
T PRK13764        260 EGIL--IAGAPGAGKSTFAQALAEFYADMGKIVKTMESPRDLQVPPE  304 (605)
T ss_pred             CEEE--EECCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCC
T ss_conf             6499--97799997789999999999847978983248623668954


No 172
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=96.89  E-value=0.0022  Score=40.46  Aligned_cols=36  Identities=33%  Similarity=0.452  Sum_probs=32.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             689986788879799999999999977981999877
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE   40 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e   40 (225)
                      +.|.|-|--||||||++..|.+.|.++|++|-++..
T Consensus         2 kii~ivG~snSGKTTLi~kli~~l~~~G~~V~~iKH   37 (159)
T cd03116           2 KVIGFVGYSGSGKTTLLEKLIPALSARGLRVAVIKH   37 (159)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             299999679999999999999999977985989973


No 173
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=96.81  E-value=0.025  Score=34.21  Aligned_cols=81  Identities=12%  Similarity=0.103  Sum_probs=49.7

Q ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHHHCCH-----HH-HHHH-HHHHHHHHHHCCCCEEEECCCCCHHHHHHH
Q ss_conf             1156652034877644321111100000000211288-----99-9999-999999999789949998189788999999
Q gi|254780218|r  131 DCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDV-----MI-HEKR-RQIFLDIARNQPDRCHIVDSAHSFQSVATN  203 (225)
Q Consensus       131 Dl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~-----~~-~~kv-~~~y~~la~~~~~~~~~IDa~~~~eei~~~  203 (225)
                      -+.|+|+.|-+...+||..|-..+-..++=. |-+.+     .- .... .=+|.++..       .+++..+.++..+.
T Consensus       191 ~~~i~L~~~r~~L~~rI~~R~~~Mi~~Glie-Ev~~L~~~~~~~~~~~~~aIGykE~~~-------yL~g~~s~~e~~~~  262 (304)
T PRK00091        191 VLIIGLDPDREVLYERINQRFDQMLEEGLLE-EVRALLAGGLHPDLPAMRAIGYREVWE-------YLDGEISLEEAVEK  262 (304)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHHCCHHH-HHHHHHHCCCCCCHHHHHCCCHHHHHH-------HHCCCCCHHHHHHH
T ss_conf             2899968999999999999999999868999-999999769973046773438999999-------98699999999999


Q ss_pred             HHHHHHHHHHHHCCCC
Q ss_conf             9999999998642645
Q gi|254780218|r  204 ILNIVWELVQKRVSPL  219 (225)
Q Consensus       204 I~~~i~~~l~k~~~~~  219 (225)
                      +....+++.++|..=.
T Consensus       263 i~~~Tr~yAKRQ~TWf  278 (304)
T PRK00091        263 IKQATRQYAKRQLTWF  278 (304)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999972


No 174
>KOG1532 consensus
Probab=96.78  E-value=0.01  Score=36.54  Aligned_cols=92  Identities=24%  Similarity=0.319  Sum_probs=54.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC-CEEEEECCC--CCCCCC--HHHHC----------CCCCCCCCCHHHH
Q ss_conf             88868998678887979999999999997798-199987788--984410--01100----------1244454101345
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPG--GTPAAE--AARHV----------LLSCGVDEFGAEA   66 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~-~v~~~~eP~--~t~~ge--~ir~~----------l~~~~~~~~~~~~   66 (225)
                      +++..|.+-|+-||||||.+..|..++.+++- +.++--.|.  .-|.+.  -||+.          -++++..   -.|
T Consensus        17 ~~p~~ilVvGMAGSGKTTF~QrL~~hl~~~~~ppYviNLDPAv~~vpy~aniDIRDtVkYkEvMkqY~LGPNGg---I~T   93 (366)
T KOG1532          17 QRPVIILVVGMAGSGKTTFMQRLNSHLHAKKTPPYVINLDPAVRNVPYPANIDIRDTVKYKEVMKQYQLGPNGG---IVT   93 (366)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC---HHH
T ss_conf             68707999944778841399999999862369980886788885488866775665430999999838899864---033


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             6777889999977635655423452587235
Q gi|254780218|r   67 EAIVFAAARLDHVENVIRPALMEGKILLCDR   97 (225)
Q Consensus        67 ~~lLfaadr~~~~~~~I~p~L~~g~iVI~DR   97 (225)
                      -+=||+. +.+++-+.|+..-..-++||.|-
T Consensus        94 sLNLF~t-k~dqv~~~iek~~~~~~~~liDT  123 (366)
T KOG1532          94 SLNLFAT-KFDQVIELIEKRAEEFDYVLIDT  123 (366)
T ss_pred             HHHHHHH-HHHHHHHHHHHHHCCCCEEEECC
T ss_conf             5899998-78999999997422047799748


No 175
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]
Probab=96.75  E-value=0.0031  Score=39.60  Aligned_cols=37  Identities=30%  Similarity=0.451  Sum_probs=33.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             6899867888797999999999999779819998778
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      +++.|-|.-+|||||++..|.+.|+++|+.|-.+...
T Consensus         3 ~Il~ivG~k~SGKTTLie~lv~~L~~~G~rVa~iKH~   39 (161)
T COG1763           3 KILGIVGYKNSGKTTLIEKLVRKLKARGYRVATVKHA   39 (161)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             2899996279973428999999997579379999865


No 176
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.65  E-value=0.014  Score=35.67  Aligned_cols=82  Identities=20%  Similarity=0.256  Sum_probs=44.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH-HCC-CCEEEEECCCCC-CCCCHHHHCCCCCCCCCCHHHHHHH---HHHHHH
Q ss_conf             8886899867888797999999999999-779-819998778898-4410011001244454101345677---788999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ-RKN-YDVHVTREPGGT-PAAEAARHVLLSCGVDEFGAEAEAI---VFAAAR   75 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~-~~g-~~v~~~~eP~~t-~~ge~ir~~l~~~~~~~~~~~~~~l---Lfaadr   75 (225)
                      .+|..|+|=|+-|+||||-+.+|+..+. ..| .+|.++.  .+| ++|..          ..+.-+++.+   ++.++-
T Consensus       208 ~~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT--~DtyRigA~----------eQLk~Ya~ilgvp~~v~~~  275 (412)
T PRK05703        208 EQGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVALIT--LDTYRIGAV----------EQLKTYAKIMGIPVKVAYD  275 (412)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE--ECCCCHHHH----------HHHHHHHHHCCCEEEEECC
T ss_conf             5673699988888756769999999999972998179998--376777799----------9999999971973798479


Q ss_pred             HHHHHHHHHHHHCCCCEEEEC
Q ss_conf             997763565542345258723
Q gi|254780218|r   76 LDHVENVIRPALMEGKILLCD   96 (225)
Q Consensus        76 ~~~~~~~I~p~L~~g~iVI~D   96 (225)
                      .+.+...+ ..+...++|+.|
T Consensus       276 ~~~l~~al-~~~~~~dlILID  295 (412)
T PRK05703        276 PKELAKAL-EQLANCDLILID  295 (412)
T ss_pred             HHHHHHHH-HHHCCCCEEEEE
T ss_conf             99999999-871589979996


No 177
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=96.59  E-value=0.0049  Score=38.37  Aligned_cols=34  Identities=32%  Similarity=0.511  Sum_probs=30.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8998678887979999999999997798199987
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      .|+|-|+-|+||||-+.+|+.++..+|.+|.++.
T Consensus         2 Vi~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit   35 (173)
T cd03115           2 VILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVA   35 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9999899999889999999999997699289997


No 178
>PRK06851 hypothetical protein; Provisional
Probab=96.56  E-value=0.007  Score=37.45  Aligned_cols=38  Identities=24%  Similarity=0.339  Sum_probs=34.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             68998678887979999999999997798199987788
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG   42 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~   42 (225)
                      +++++-|..|+||||..+.+.+.+.++|++|.+.+-|.
T Consensus        32 ri~ilKGGpGtGKStlmK~ig~~~~~~GydVE~~hcss   69 (368)
T PRK06851         32 RIFILKGGPGTGKSTLMKKIGEEFLEKGYDVEFLHCSS   69 (368)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             79999689997789999999999996898379997589


No 179
>PRK06851 hypothetical protein; Provisional
Probab=96.56  E-value=0.0054  Score=38.13  Aligned_cols=37  Identities=24%  Similarity=0.350  Sum_probs=33.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             6899867888797999999999999779819998778
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      ..+.|.|-+||||||..+.|++...++|+.|.+.+-|
T Consensus       216 ~~y~ikG~pGtGKstlL~~i~~~A~~~G~dvevyhc~  252 (368)
T PRK06851        216 NRYFLKGRPGTGKSTMLKKVAKAAEERGLDVEVYHCP  252 (368)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             6999818999877999999999999859828998079


No 180
>PRK05439 pantothenate kinase; Provisional
Probab=96.56  E-value=0.063  Score=31.76  Aligned_cols=187  Identities=20%  Similarity=0.224  Sum_probs=88.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCCC--CCCCCHHHHCCCCCCCCCCHHHHHHH-HHHHHHH
Q ss_conf             888689986788879799999999999977--981999877889--84410011001244454101345677-7889999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREPGG--TPAAEAARHVLLSCGVDEFGAEAEAI-VFAAARL   76 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~--g~~v~~~~eP~~--t~~ge~ir~~l~~~~~~~~~~~~~~l-Lfaadr~   76 (225)
                      +.+.+|.|-|-=.+||||-++.|...|..-  ..+|..+.- +|  -|..++.++-+.+.+.=+-+--..+| -|.++  
T Consensus        84 ~~PfIIGIaGSVAVGKSTtARlLq~LL~r~~~~~~V~LvTT-DGFLypNa~L~~rglm~RKGFPESYD~~~Ll~Fl~~--  160 (312)
T PRK05439         84 KVPFIIGIAGSVAVGKSTTARLLQALLSRWPEHPKVDLVTT-DGFLYPNAELKERGLMKRKGFPESYDMRALLRFLSD--  160 (312)
T ss_pred             CCCEEEEEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEEC-CCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHH--
T ss_conf             99989997620102628899999999950789994589934-665578689987677124789854479999999999--


Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCC---CCC---CHHHHHHHHHHHCC---C------CCCCEEEEEEECHH
Q ss_conf             977635655423452587235424310001003---444---24577654442038---8------98411566520348
Q gi|254780218|r   77 DHVENVIRPALMEGKILLCDRFLDSSYAYQGER---DSS---QHLFLDSLQEISVQ---E------VMPDCTIILDLPVD  141 (225)
Q Consensus        77 ~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~---~~~---~~~~i~~l~~~~~~---~------~~PDl~i~Ldv~~e  141 (225)
                                ..+|.-- +.=-+||...|.-..   ..+   +--.++-+|-+..+   .      --=|+.||+|++++
T Consensus       161 ----------vKsG~~~-v~aPvYSH~~YDIvp~~~~~v~~PDILIvEGlNvLQ~~~~~~~~~~vSDffDfSIYvDA~~~  229 (312)
T PRK05439        161 ----------VKSGKPN-VKAPVYSHLIYDIVPGEYQTVDQPDILIVEGLNVLQTGDDDNHRLFVSDFFDFSIYVDADED  229 (312)
T ss_pred             ----------HHCCCCC-CCCEEECHHHHHCCCCCEEEECCCCEEEEECHHHCCCCCCCCCCCCCCCCEEEEEEEECCHH
T ss_conf             ----------9769987-66403336776427997069737998999151214479767886552243138999608888


Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHH---HHHHHHHHHHH-HHHHHHCC
Q ss_conf             776443211111000000002112889999999999999997899499981897889---99999999999-99986426
Q gi|254780218|r  142 IGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQ---SVATNILNIVW-ELVQKRVS  217 (225)
Q Consensus       142 ~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~e---ei~~~I~~~i~-~~l~k~~~  217 (225)
                      ...+==           .+||-            .+++.|..+|+.+.-==|..+.+   +++.+||..|. .-|++.+.
T Consensus       230 ~Ie~WY-----------i~RFl------------~L~~tAf~dp~syF~~ya~l~~~ea~~~A~~iW~~INl~NL~enIl  286 (312)
T PRK05439        230 LIEKWY-----------IERFL------------KLRETAFSDPDSYFHRYAKLSEEEAIAIARQIWKTINLPNLEENIL  286 (312)
T ss_pred             HHHHHH-----------HHHHH------------HHHHHHHCCCHHHHHHHCCCCHHHHHHHHHHHHHHHCHHHHHHHCC
T ss_conf             999999-----------99999------------9999886094668898717999999999999999717451787668


Q ss_pred             CCCCCCCC
Q ss_conf             45454679
Q gi|254780218|r  218 PLSSKKDI  225 (225)
Q Consensus       218 ~~~~~~~~  225 (225)
                      |.-.+-|+
T Consensus       287 PTr~RA~l  294 (312)
T PRK05439        287 PTRERADL  294 (312)
T ss_pred             CCCCCCCE
T ss_conf             75100228


No 181
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=96.53  E-value=0.015  Score=35.57  Aligned_cols=38  Identities=24%  Similarity=0.201  Sum_probs=32.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             88868998678887979999999999997798199987
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      -+|.++-|-|..|+||||.+--++......|.+|++..
T Consensus        21 ~~G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYid   58 (224)
T PRK09361         21 ERGTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYID   58 (224)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             88879999899998599999999999997499099967


No 182
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=96.53  E-value=0.0059  Score=37.91  Aligned_cols=36  Identities=31%  Similarity=0.492  Sum_probs=32.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             868998678887979999999999997798199987
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      +..|++-|+-|+||||-+.+|+.++..+|.+|.++.
T Consensus         1 P~vi~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit   36 (196)
T pfam00448         1 PNVILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVA   36 (196)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             969999899999889999999999997799289997


No 183
>pfam01591 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a bifunctional enzyme with fructose-2,6-bisphosphatase. The bifunctional enzyme catalyses both the synthesis and degradation of fructose-2,6-bisphosphate, a potent regulator of glycolysis. This enzyme contains a P-loop motif.
Probab=96.52  E-value=0.068  Score=31.55  Aligned_cols=167  Identities=13%  Similarity=0.118  Sum_probs=80.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCC-CCCCCCHHHHHHHHHHHHH----HHHH
Q ss_conf             6899867888797999999999999779819998778898441001100124-4454101345677788999----9977
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS-CGVDEFGAEAEAIVFAAAR----LDHV   79 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~-~~~~~~~~~~~~lLfaadr----~~~~   79 (225)
                      ..|+.=|+.+.|||+.++.|.++|.-.|+++.+..      .|+.-|+..-. ....-++|....-  ..-|    .+.+
T Consensus        14 lvIvmVGLPARGKS~ia~kl~RYL~W~g~~~kvFn------~G~yRR~~~~~~~~~~ffdp~n~~~--~~~R~~~a~~~l   85 (223)
T pfam01591        14 TMIVMVGLPARGKTYISKKLTRYLNWLGVPTKVFN------VGEYRRSAVKAYSNYEFFRPDNTEA--MKIREQCALAAL   85 (223)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE------CHHHHHHHCCCCCCCCCCCCCCHHH--HHHHHHHHHHHH
T ss_conf             89999899999889999999999865699805842------6378876318999941138999899--999999999999


Q ss_pred             HHHHHHHHC--CCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEE---CHHHHHHHHHHHHHHH
Q ss_conf             635655423--45258723542431000100344424577654442038898411566520---3487764432111110
Q gi|254780218|r   80 ENVIRPALM--EGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDL---PVDIGLKRVQNRYSLR  154 (225)
Q Consensus        80 ~~~I~p~L~--~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv---~~e~a~~Ri~~R~~~~  154 (225)
                      ++++. +|.  .|.+-|.|=-- ||           .+--.++.+....  .+=.++|+.+   ++++....|.......
T Consensus        86 ~dl~~-~l~~~~G~VaI~DATN-~T-----------~~RR~~i~~~~~~--~~~~vlFiEsic~D~~ii~~NI~~~~~~s  150 (223)
T pfam01591        86 KDVLA-YLNEESGQVAIFDATN-TT-----------RERRKNILDFAEE--NGLKVFFLESICDDPEIIARNIKLVKFSS  150 (223)
T ss_pred             HHHHH-HHHHCCCEEEEEECCC-CC-----------HHHHHHHHHHHHH--CCCEEEEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             99999-9985898299996887-68-----------9999999999986--69749999997388899999999998459


Q ss_pred             -HCCHHHHHHHCCHHHHHHHHH---HHHHHHHHCC--CC-EEEECCCC
Q ss_conf             -000000021128899999999---9999999789--94-99981897
Q gi|254780218|r  155 -ESACLDYFERKDVMIHEKRRQ---IFLDIARNQP--DR-CHIVDSAH  195 (225)
Q Consensus       155 -~~~~~d~~E~~~~~~~~kv~~---~y~~la~~~~--~~-~~~IDa~~  195 (225)
                       +-.+.|. |.--.+|.+|+..   .|.-|...+.  -. +.+||...
T Consensus       151 pDY~~~~~-e~A~~DF~~Ri~~ye~~Yepl~~~~d~~lsyIK~in~g~  197 (223)
T pfam01591       151 PDYKGKPP-EEAIDDFMKRLECYEKQYEPLDDEHDEDLSYIKVINVGQ  197 (223)
T ss_pred             CCCCCCCH-HHHHHHHHHHHHHHHCCEECCCCCCCCCCCEEEEEECCC
T ss_conf             97468899-999999999999753424238834336875699997898


No 184
>PRK13342 recombination factor protein RarA; Reviewed
Probab=96.52  E-value=0.0031  Score=39.57  Aligned_cols=82  Identities=21%  Similarity=0.328  Sum_probs=43.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHH--HHHH-HHHHHHH
Q ss_conf             998678887979999999999997798199987788984410011001244454101345677788--9999-9776356
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFA--AARL-DHVENVI   83 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfa--adr~-~~~~~~I   83 (225)
                      +.|-|+.|+||||.++.|++.+.   .+++... . .+.....||+++-..........+  +||.  ..|+ -...+..
T Consensus        40 ~Il~GPPG~GKTTlA~iiA~~~~---~~f~~ln-A-~~~gv~dir~ii~~a~~~~~~~~t--ilfiDEIHRfnK~QQD~L  112 (417)
T PRK13342         40 MILWGPPGTGKTTLARIIAGATD---AEFEALS-A-VTSGVKDLREVIEEAKQSRLGRRT--ILFIDEIHRFNKAQQDAL  112 (417)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC---CCEEEEE-C-CCCCHHHHHHHHHHHHHHHCCCCE--EEEEECHHHCCHHHHHHH
T ss_conf             99889699989999999999868---9889961-4-103889999999998863148965--999978200588999999


Q ss_pred             HHHHCCCCEEEE
Q ss_conf             554234525872
Q gi|254780218|r   84 RPALMEGKILLC   95 (225)
Q Consensus        84 ~p~L~~g~iVI~   95 (225)
                      .|.+++|.+++.
T Consensus       113 Lp~vE~g~iiLI  124 (417)
T PRK13342        113 LPHVEDGTITLI  124 (417)
T ss_pred             HHHHHCCCEEEE
T ss_conf             875112656999


No 185
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=96.48  E-value=0.0027  Score=39.91  Aligned_cols=30  Identities=30%  Similarity=0.449  Sum_probs=26.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|.+++|=|+.||||||+.+.|+..|.-.
T Consensus        26 ~~G~i~~iiGpNG~GKSTLLk~l~~~l~p~   55 (258)
T COG1120          26 PKGEITGILGPNGSGKSTLLKCLAGLLKPK   55 (258)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             599799998998889999999986567888


No 186
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents various SRP subunits.; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=96.45  E-value=0.0059  Score=37.92  Aligned_cols=113  Identities=19%  Similarity=0.260  Sum_probs=61.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH--HHHCCCCEEEEE----CCCC----CCCCCHHHHCCCC-CCCCCCH---HHHH
Q ss_conf             88868998678887979999999999--997798199987----7889----8441001100124-4454101---3456
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF--LQRKNYDVHVTR----EPGG----TPAAEAARHVLLS-CGVDEFG---AEAE   67 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~--L~~~g~~v~~~~----eP~~----t~~ge~ir~~l~~-~~~~~~~---~~~~   67 (225)
                      +++..|=+-|+=||||||-|.+|+.+  +++.|.+|....    =|.-    -..|+.+--.++. ...+ -+   |.-.
T Consensus       100 ~~P~vilmvGLQGsGKTTt~gKLA~~ll~kk~~~kvLLva~D~yRPAA~~QL~~Lg~Q~gVpvf~h~~~~-~~p~~Pv~i  178 (439)
T TIGR00959       100 KRPTVILMVGLQGSGKTTTAGKLALYLLKKKEGKKVLLVACDLYRPAAIEQLKVLGEQVGVPVFAHLGKG-QSPDDPVEI  178 (439)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHCCCHHHHHHHHHHHHHCCCCCCCCCCCC-CCCCCHHHH
T ss_conf             8683899731378857889999999999986389703403210347899999997675288711004788-898877899


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             77788999997763565542-3452587235424310001003444245776544420388984115665
Q gi|254780218|r   68 AIVFAAARLDHVENVIRPAL-MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIIL  136 (225)
Q Consensus        68 ~lLfaadr~~~~~~~I~p~L-~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~L  136 (225)
                           |.++      +..|- ...++||+|=         ..+-..|....+.|..+ .....||=|+|-
T Consensus       179 -----a~~A------l~~Ak~~~~D~vI~DT---------AGRL~ID~~LM~EL~~i-K~~~nP~EiLlV  227 (439)
T TIGR00959       179 -----ARQA------LEEAKENGFDVVIVDT---------AGRLQIDEELMEELAEI-KEILNPDEILLV  227 (439)
T ss_pred             -----HHHH------HHHHHHCCCCEEEEEC---------CCCHHHHHHHHHHHHHH-HHHHCCCEEEEC
T ss_conf             -----9999------9999974897899726---------75125559999999999-888688705412


No 187
>TIGR01846 type_I_sec_HlyB type I secretion system ATPase; InterPro: IPR010132   Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This entry contains one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane.
Probab=96.44  E-value=0.0032  Score=39.50  Aligned_cols=27  Identities=37%  Similarity=0.625  Sum_probs=23.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             988868998678887979999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      ++.|-+|=|-|+-||||||.++++-+.
T Consensus       488 I~~Ge~IGIvGpSGSGKSTLTKL~QRL  514 (703)
T TIGR01846       488 IKPGEVIGIVGPSGSGKSTLTKLLQRL  514 (703)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             578657998727898678999998861


No 188
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=96.43  E-value=0.0019  Score=40.80  Aligned_cols=29  Identities=34%  Similarity=0.644  Sum_probs=25.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|.+++|-|..||||||.+++|...+.
T Consensus        37 i~~Ge~vaIvG~sGsGKSTL~~ll~gl~~   65 (226)
T cd03248          37 LHPGEVTALVGPSGSGKSTVVALLENFYQ   65 (226)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             82999999999999849999999964546


No 189
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.40  E-value=0.0029  Score=39.72  Aligned_cols=35  Identities=26%  Similarity=0.529  Sum_probs=28.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             88868998678887979999999999997798199
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      ++|-+++|-|..||||||.++.|...++-..-.+.
T Consensus        34 ~~Ge~vaivG~nGsGKSTLlk~l~Gll~p~~G~I~   68 (273)
T PRK13632         34 NEGEYVAILGHNGSGKSTISKILTGLLKPQSGEIK   68 (273)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE
T ss_conf             49989999999998699999999738778887599


No 190
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=96.39  E-value=0.0025  Score=40.15  Aligned_cols=29  Identities=38%  Similarity=0.685  Sum_probs=25.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|.+|+|-|.-||||||.+++|...+.
T Consensus        26 i~~G~~iaIvG~sGsGKSTLl~ll~gl~~   54 (238)
T cd03249          26 IPPGKTVALVGSSGCGKSTVVSLLERFYD   54 (238)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             76999999999999989999999823861


No 191
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.   Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits this transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L. lactis functionally complements an Escherichia coli proU mutant. The complementing locus is similar to a opuA locus in Bacillus subtlis. This clarifies the differences in nomenclature.; GO: 0005524 ATP binding, 0015171 amino acid transmembrane transporter activity, 0006865 amino acid transport, 0016020 membrane.
Probab=96.39  E-value=0.0028  Score=39.87  Aligned_cols=28  Identities=29%  Similarity=0.649  Sum_probs=24.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|=||||=|+-||||||.+++|-+..+
T Consensus        17 ~~GEi~vi~GlSGsGKsT~vrmlNRLIE   44 (372)
T TIGR01186        17 AKGEIFVIMGLSGSGKSTLVRMLNRLIE   44 (372)
T ss_pred             ECCEEEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             2543899977899857899999872257


No 192
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=96.39  E-value=0.0029  Score=39.77  Aligned_cols=32  Identities=28%  Similarity=0.451  Sum_probs=27.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             88868998678887979999999999997798
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNY   33 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~   33 (225)
                      .+|-+++|-|..||||||.++.|...+...|-
T Consensus        28 ~~Ge~vaIvG~sGsGKSTLl~lL~gl~~~~G~   59 (275)
T cd03289          28 SPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGD   59 (275)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCE
T ss_conf             79999999999999799999999603578953


No 193
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.35  E-value=0.004  Score=38.92  Aligned_cols=29  Identities=28%  Similarity=0.390  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|-+++|-|..||||||..+.|...+..
T Consensus        33 ~~Ge~vaiiG~sGsGKSTLl~ll~Gl~~p   61 (269)
T PRK13648         33 PKGQWTSIVGHNGSGKSTIAKLMIGIEKV   61 (269)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             59989999999999799999999649799


No 194
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=96.33  E-value=0.033  Score=33.45  Aligned_cols=117  Identities=18%  Similarity=0.229  Sum_probs=61.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHH---HHHHHHH
Q ss_conf             8886899867888797999999999999--7798199987788984410011001244454101345677---7889999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ--RKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAI---VFAAARL   76 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~--~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~l---Lfaadr~   76 (225)
                      .+|.+|++=|+-|+||||-..+|+.++.  ....+|-++. -+.-++|..          ..+.-+++.+   +-++.-.
T Consensus       201 ~~~~vi~LVGPTGVGKTTTlAKLAar~~~~~~~~kVaiIT-tDtYRIGA~----------EQLk~Ya~im~vp~~vv~~~  269 (407)
T COG1419         201 EQKRVIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAIIT-TDTYRIGAV----------EQLKTYADIMGVPLEVVYSP  269 (407)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEE-ECCCHHHHH----------HHHHHHHHHHCCCEEEECCH
T ss_conf             4685799989988758879999999997532576068997-144115289----------99999999869955996399


Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHH
Q ss_conf             97763565542345258723542431000100344424577654442038898411566520348
Q gi|254780218|r   77 DHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVD  141 (225)
Q Consensus        77 ~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e  141 (225)
                      .-+...|. .|.+-++|+.|-=         .....+...+..+..+....  +++-.||-++..
T Consensus       270 ~el~~ai~-~l~~~d~ILVDTa---------Grs~~D~~~i~el~~~~~~~--~~i~~~Lvlsat  322 (407)
T COG1419         270 KELAEAIE-ALRDCDVILVDTA---------GRSQYDKEKIEELKELIDVS--HSIEVYLVLSAT  322 (407)
T ss_pred             HHHHHHHH-HHHCCCEEEEECC---------CCCCCCHHHHHHHHHHHHCC--CCCEEEEEEECC
T ss_conf             99999999-8531888999689---------98833789999999997035--662179998457


No 195
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=96.33  E-value=0.0064  Score=37.68  Aligned_cols=34  Identities=21%  Similarity=0.216  Sum_probs=28.6

Q ss_pred             CCCC-EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             8886-899867888797999999999999779819998
Q gi|254780218|r    2 NSGL-FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         2 ~~g~-~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      .+|. ++||=|+.|+|||..++.+|++|.   .+++.+
T Consensus       447 ~~GpqIlClvGPPGVGKTSlg~SIA~ALn---RkFvR~  481 (941)
T TIGR00763       447 MKGPQILCLVGPPGVGKTSLGKSIAKALN---RKFVRF  481 (941)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHC---CEEEEE
T ss_conf             88876787207269542227899999968---804999


No 196
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.32  E-value=0.0034  Score=39.36  Aligned_cols=30  Identities=33%  Similarity=0.591  Sum_probs=26.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-++++-|..||||||..+.++..++-.
T Consensus        25 ~~G~i~~l~G~NGaGKSTLlkli~Gl~~p~   54 (200)
T PRK13540         25 PAGGLLHLKGSNGAGKTTLLKLIAGLLNPE   54 (200)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             799799998899987999999997785889


No 197
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=96.31  E-value=0.0044  Score=38.66  Aligned_cols=29  Identities=34%  Similarity=0.503  Sum_probs=25.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+++|-|..||||||..+.+...+.
T Consensus        25 i~~Ge~~aivG~sGsGKSTLl~~l~G~~~   53 (178)
T cd03247          25 LKQGEKIALLGRSGSGKSTLLQLLTGDLK   53 (178)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHHCCC
T ss_conf             86999999999998759999999986176


No 198
>KOG1533 consensus
Probab=96.31  E-value=0.016  Score=35.32  Aligned_cols=87  Identities=22%  Similarity=0.345  Sum_probs=47.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCC----CCCCHHHHCCCCC---CCCCCHHHHHHHHHH----HH
Q ss_conf             998678887979999999999997798199987-78898----4410011001244---454101345677788----99
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPGGT----PAAEAARHVLLSC---GVDEFGAEAEAIVFA----AA   74 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~~t----~~ge~ir~~l~~~---~~~~~~~~~~~lLfa----ad   74 (225)
                      -++-|+.||||||-+.-..+.|.+.|.++.++. .|++.    +-+=-|++++-..   ..-.+.|.. ++.|.    ++
T Consensus         5 qvVIGPPgSGKsTYc~g~~~fls~~gr~~~vVNLDPaNd~~~Y~~~v~I~elit~edvm~~~~LGPNg-~l~yc~E~l~~   83 (290)
T KOG1533           5 QVVIGPPGSGKSTYCNGMSQFLSAIGRPVAVVNLDPANDNLPYECAVDIRELITVEDVMEELGLGPNG-ALKYCMEYLEA   83 (290)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHCCCCCH-HHHHHHHHHHH
T ss_conf             68876999985311320999999748962799568765678887765199971399999985879961-27999999985


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             9997763565542345258723
Q gi|254780218|r   75 RLDHVENVIRPALMEGKILLCD   96 (225)
Q Consensus        75 r~~~~~~~I~p~L~~g~iVI~D   96 (225)
                      ..+-+...|+|  ..+..||.|
T Consensus        84 ~idwl~~~l~~--~~~~Y~lFD  103 (290)
T KOG1533          84 NIDWLLEKLKP--LTDHYVLFD  103 (290)
T ss_pred             HHHHHHHHHHH--CCCCEEEEE
T ss_conf             44999997452--347489995


No 199
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=96.29  E-value=0.0039  Score=39.00  Aligned_cols=29  Identities=28%  Similarity=0.472  Sum_probs=25.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.+|.+++|-|..||||||.++.|...+.
T Consensus        25 i~~G~~vaIvG~sGsGKSTLl~ll~gl~~   53 (173)
T cd03246          25 IEPGESLAIIGPSGSGKSTLARLILGLLR   53 (173)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             85999999999999809999999966666


No 200
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=96.27  E-value=0.0096  Score=36.65  Aligned_cols=36  Identities=25%  Similarity=0.319  Sum_probs=22.6

Q ss_pred             CCCEEEEECCCCCCHHHHHH--HHHHHHHHCCCCEEEEECC
Q ss_conf             88689986788879799999--9999999779819998778
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHIS--LLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~--~L~~~L~~~g~~v~~~~eP   41 (225)
                      ++--++++|.-|||||||+=  .|.+.. ..| +++ +-+|
T Consensus        19 ~~~~~vl~a~tGsGKtTqvP~~ll~~~~-~~g-~I~-~~qP   56 (812)
T PRK11664         19 TAPQVLLKAPTGAGKSTWLPLQLLQQGG-ING-KII-MLEP   56 (812)
T ss_pred             HCCEEEEEECCCCCHHHHHHHHHHHCCC-CCC-CEE-EECC
T ss_conf             7997999908999989999999996468-899-389-9388


No 201
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=96.27  E-value=0.0042  Score=38.76  Aligned_cols=28  Identities=25%  Similarity=0.412  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|-|+.||||||.++.+...+.
T Consensus        29 ~~Ge~~~iiG~sGsGKSTLl~~i~Gl~~   56 (228)
T cd03257          29 KKGETLGLVGESGSGKSTLARAILGLLK   56 (228)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             6998999999999869999999972898


No 202
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.27  E-value=0.0042  Score=38.81  Aligned_cols=30  Identities=33%  Similarity=0.462  Sum_probs=25.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-++++=|+.||||||..+.|+..++-.
T Consensus        23 ~~GEiv~liGpNGaGKSTLlk~l~Gll~p~   52 (246)
T cd03237          23 SESEVIGILGPNGIGKTTFIKMLAGVLKPD   52 (246)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             579899999799976999999997787888


No 203
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.27  E-value=0.0041  Score=38.84  Aligned_cols=30  Identities=27%  Similarity=0.504  Sum_probs=26.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|.+++|=|..||||||.++.+...+.-.
T Consensus        31 ~~Ge~~aiiG~nGsGKSTLl~~l~GLl~p~   60 (286)
T PRK13646         31 EQGKYYAIVGQTGSGKSTLIQNINALLKPT   60 (286)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             699899999999981999999997078888


No 204
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=96.27  E-value=0.0059  Score=37.89  Aligned_cols=26  Identities=27%  Similarity=0.529  Sum_probs=22.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+| +++|-|+.||||||.++.|.-.+
T Consensus        21 p~G-itaIvGpsGsGKSTLl~~i~~~l   46 (197)
T cd03278          21 PPG-LTAIVGPNGSGKSNIIDAIRWVL   46 (197)
T ss_pred             CCC-EEEEECCCCCCHHHHHHHHHHHH
T ss_conf             898-28999999998899999999874


No 205
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=96.26  E-value=0.0036  Score=39.22  Aligned_cols=28  Identities=39%  Similarity=0.635  Sum_probs=25.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|..|+|-|..||||||.+++|...+.
T Consensus       359 ~~Ge~vaiVG~SGsGKSTL~~LL~gly~  386 (585)
T PRK13657        359 KPGQTVAIVGPTGAGKSTLINLLHRVFD  386 (585)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             5998899988989869999999860157


No 206
>COG4240 Predicted kinase [General function prediction only]
Probab=96.26  E-value=0.0095  Score=36.66  Aligned_cols=37  Identities=27%  Similarity=0.419  Sum_probs=31.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEE
Q ss_conf             8886899867888797999999999999779-819998
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKN-YDVHVT   38 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g-~~v~~~   38 (225)
                      .++.++-|.|+-||||||.+..+...|..+| +.+...
T Consensus        48 grPli~gisGpQGSGKStls~~i~~~L~~kg~ert~~l   85 (300)
T COG4240          48 GRPLIVGISGPQGSGKSTLSALIVRLLAAKGLERTATL   85 (300)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             79639985268887653599999999997365306886


No 207
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=96.25  E-value=0.0055  Score=38.06  Aligned_cols=31  Identities=29%  Similarity=0.583  Sum_probs=27.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9888689986788879799999999999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .++|..++|-|.-||||||.+++|...+.-.
T Consensus       338 I~~Ge~vaIVG~SGsGKSTLl~LL~g~y~p~  368 (569)
T PRK10789        338 LKPGQMLGICGPTGSGKSTLLSLIQRHFDVS  368 (569)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             8899789987999998799999999776426


No 208
>PRK13826 Dtr system oriT relaxase; Provisional
Probab=96.25  E-value=0.02  Score=34.80  Aligned_cols=80  Identities=23%  Similarity=0.240  Sum_probs=50.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      +.+-++.|.-|+||||......+.+++.||.|+     |..+.|+....+   .....+..+|.+-+-  -+|+.    =
T Consensus       397 ~~Ia~VvG~AGaGKStmL~aAReawEa~GyrV~-----GaALsGkAAegL---e~~sGI~SrTlAs~e--~~w~~----g  462 (1102)
T PRK13826        397 ERIAAVIGRAGAGKTTMMKAAREAWEAAGYRVV-----GGALAGKAAEGL---EKEAGIASRTLSSWE--LRWNQ----G  462 (1102)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEE-----EECCCHHHHHHH---HHCCCCCCHHHHHHH--HHHCC----C
T ss_conf             866899842888788999999999997797798-----015007899977---534695303389999--87435----8


Q ss_pred             HHHHCCCCEEEECC
Q ss_conf             55423452587235
Q gi|254780218|r   84 RPALMEGKILLCDR   97 (225)
Q Consensus        84 ~p~L~~g~iVI~DR   97 (225)
                      +..|..+.++|.|=
T Consensus       463 r~~L~~~dVlVIDE  476 (1102)
T PRK13826        463 RDQLDNKTVFVLDE  476 (1102)
T ss_pred             CCCCCCCCEEEEEC
T ss_conf             65567873899845


No 209
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.24  E-value=0.0026  Score=40.01  Aligned_cols=29  Identities=34%  Similarity=0.582  Sum_probs=25.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+++|-|..||||||.++.|...+.
T Consensus        24 i~~Ge~v~ivG~sGsGKSTLl~ll~gl~~   52 (236)
T cd03253          24 IPAGKKVAIVGPSGSGKSTILRLLFRFYD   52 (236)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHCCCCC
T ss_conf             86999999999999989999999743854


No 210
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=96.24  E-value=0.0063  Score=37.74  Aligned_cols=30  Identities=43%  Similarity=0.560  Sum_probs=26.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-+|+|-|..||||||.++.|...+.-.
T Consensus        32 ~~Ge~v~ivG~sGsGKSTLl~ll~g~~~p~   61 (207)
T cd03369          32 KAGEKIGIVGRTGAGKSTLILALFRFLEAE   61 (207)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             699999999999987999999999872888


No 211
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA; InterPro: IPR005895   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains the cytochrome c biogenesis protein encoded by ccmA in bacteria and one arabidopsis protein, possibly encoded by an organelle. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The post-translational pathway includes the transport of a heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which functions as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.; GO: 0005215 transporter activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space.
Probab=96.24  E-value=0.0039  Score=38.97  Aligned_cols=35  Identities=34%  Similarity=0.535  Sum_probs=27.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             88868998678887979999999999997798199
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      +-|=+++|+|..||||||+-+.|+--++-..=.|.
T Consensus        24 ~aGe~l~v~GpNG~GKTtLLR~LAGL~~P~~G~v~   58 (204)
T TIGR01189        24 NAGEALQVEGPNGIGKTTLLRILAGLLRPESGEVR   58 (204)
T ss_pred             ECCCEEEEEECCCCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             07827898606987357899999850588665575


No 212
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.24  E-value=0.0045  Score=38.60  Aligned_cols=29  Identities=17%  Similarity=0.397  Sum_probs=25.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|.++++-|..||||||..+.+.-.++-
T Consensus        24 ~~G~i~~i~G~NGsGKSTLlk~i~Gl~~p   52 (195)
T PRK13541         24 LPSAITYIKGANGCGKSSLLRMIAGIMQP   52 (195)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             79979999999998199999999679889


No 213
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.23  E-value=0.0043  Score=38.74  Aligned_cols=29  Identities=31%  Similarity=0.518  Sum_probs=25.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|-|..||||||.++.|...+.-
T Consensus        31 ~~GE~vaivG~nGsGKSTL~k~l~Gl~~p   59 (279)
T PRK13635         31 YEGEWVAIVGHNGSGKSTLAKLLNGLLLP   59 (279)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             79989999999996599999999728888


No 214
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=96.22  E-value=0.0033  Score=39.45  Aligned_cols=37  Identities=30%  Similarity=0.522  Sum_probs=26.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHC-CCC-EEEEECCC
Q ss_conf             89986788879799999999999977-981-99987788
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRK-NYD-VHVTREPG   42 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~-g~~-v~~~~eP~   42 (225)
                      +|++-|+-||||+|.++.|.+.+... ... .++||.|.
T Consensus         1 livi~GPSG~GK~tl~~~L~~~~~~~~~~~vs~TTR~~r   39 (137)
T cd00071           1 LIVLSGPSGVGKSTLLKRLLEEFDPNFGFSVSHTTRKPR   39 (137)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEECCCCC
T ss_conf             999999998899999999985198776875660378998


No 215
>KOG0730 consensus
Probab=96.22  E-value=0.026  Score=34.07  Aligned_cols=126  Identities=17%  Similarity=0.171  Sum_probs=62.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCC---HHHHCCCCCCCCCCHHHH----HHHHH
Q ss_conf             988868998678887979999999999997798199987788--984410---011001244454101345----67778
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG--GTPAAE---AARHVLLSCGVDEFGAEA----EAIVF   71 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~--~t~~ge---~ir~~l~~~~~~~~~~~~----~~lLf   71 (225)
                      |..++=|-+.|+.||||||.++.++...   +.+.+.+.-|-  +--+||   .||+++.  ++....|-.    |.=-+
T Consensus       465 i~ppkGVLlyGPPGC~KT~lAkalAne~---~~nFlsvkgpEL~sk~vGeSEr~ir~iF~--kAR~~aP~IiFfDEiDsi  539 (693)
T KOG0730         465 ISPPKGVLLYGPPGCGKTLLAKALANEA---GMNFLSVKGPELFSKYVGESERAIREVFR--KARQVAPCIIFFDEIDAL  539 (693)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEECCCHHHHHHHCCCHHHHHHHHHH--HHHHCCCEEEEHHHHHHH
T ss_conf             7887547777899862478999986463---58726415789987751825899999999--986269837744666666


Q ss_pred             HHHH-------HHHHHHHHHHHH----CCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCC---CCEEEEEE
Q ss_conf             8999-------997763565542----345258723542431000100344424577654442038898---41156652
Q gi|254780218|r   72 AAAR-------LDHVENVIRPAL----MEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVM---PDCTIILD  137 (225)
Q Consensus        72 aadr-------~~~~~~~I~p~L----~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~---PDl~i~Ld  137 (225)
                      +..|       .+.+-+.+..-+    +...++|.           ++  ....+.++.    +  +.+   -|..||..
T Consensus       540 ~~~R~g~~~~v~~RVlsqLLtEmDG~e~~k~V~Vi-----------AA--TNRpd~ID~----A--LlRPGRlD~iiyVp  600 (693)
T KOG0730         540 AGSRGGSSSGVTDRVLSQLLTEMDGLEALKNVLVI-----------AA--TNRPDMIDP----A--LLRPGRLDRIIYVP  600 (693)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEE-----------EC--CCCHHHCCH----H--HCCCCCCCEEEEEC
T ss_conf             63047875514899999999870041014708999-----------50--588101269----7--75986533057515


Q ss_pred             ECHHHHHHHHHHH
Q ss_conf             0348776443211
Q gi|254780218|r  138 LPVDIGLKRVQNR  150 (225)
Q Consensus       138 v~~e~a~~Ri~~R  150 (225)
                      .|-+.+...|-+-
T Consensus       601 lPD~~aR~~Ilk~  613 (693)
T KOG0730         601 LPDLEARLEILKQ  613 (693)
T ss_pred             CCCHHHHHHHHHH
T ss_conf             8347889999999


No 216
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232   Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities. These proteins are strictly limited to bacterial endospore-forming species, but are not found universally among members of this group; they are missing from the Clostridium species..
Probab=96.21  E-value=0.0047  Score=38.51  Aligned_cols=27  Identities=37%  Similarity=0.593  Sum_probs=24.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             998678887979999999999997798
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNY   33 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~   33 (225)
                      -+|-|.+|.||||.++.|++.|.+.|.
T Consensus        45 MiFKGNPGTGKTTVAR~~gklf~emnv   71 (261)
T TIGR02881        45 MIFKGNPGTGKTTVARLLGKLFKEMNV   71 (261)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             774278668438999999999853375


No 217
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=96.21  E-value=0.0048  Score=38.42  Aligned_cols=30  Identities=27%  Similarity=0.450  Sum_probs=26.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      +++|-++++-|+.||||||..+.|...++.
T Consensus        23 i~~Ge~~~l~G~NGsGKSTLlk~i~Gl~~p   52 (201)
T cd03231          23 LAAGEALQVTGPNGSGKTTLLRILAGLSPP   52 (201)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             879959999999999999999999667788


No 218
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=96.21  E-value=0.0048  Score=38.44  Aligned_cols=28  Identities=32%  Similarity=0.592  Sum_probs=25.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++-|+.||||||..+.+...+.
T Consensus        23 ~~Ge~~~liGpNGaGKSTllk~i~Gl~~   50 (213)
T cd03235          23 KPGEFLAIVGPNGAGKSTLLKAILGLLK   50 (213)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             5998999999999869999999976878


No 219
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=96.20  E-value=0.0046  Score=38.52  Aligned_cols=29  Identities=28%  Similarity=0.463  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|-|..||||||.++.+...+.-
T Consensus        35 ~~GE~v~iiG~nGsGKSTL~r~l~gl~~P   63 (281)
T PRK13633         35 KKGEFLVILGHNGSGKSTIAKHMNALLLP   63 (281)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             79989999999998499999999758878


No 220
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=96.18  E-value=0.0048  Score=38.46  Aligned_cols=28  Identities=29%  Similarity=0.469  Sum_probs=25.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|.+|+|-|..||||||.+++|...+.
T Consensus        28 ~~G~~v~ivG~sGsGKSTLl~ll~gl~~   55 (220)
T cd03245          28 RAGEKVAIIGRVGSGKSTLLKLLAGLYK   55 (220)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7999999999999859999999967254


No 221
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=96.18  E-value=0.0045  Score=38.58  Aligned_cols=30  Identities=33%  Similarity=0.562  Sum_probs=26.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-|+++-|+.||||||..+.++..++-.
T Consensus        25 ~~Ge~~~lvGpnGaGKSTLl~~i~Gl~~p~   54 (255)
T PRK11248         25 ESGELLVVLGPSGCGKTTLLNLIAGFVPPQ   54 (255)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             699899999999846999999997599889


No 222
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.18  E-value=0.0047  Score=38.49  Aligned_cols=28  Identities=29%  Similarity=0.342  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|-|..||||||..+.|...+.
T Consensus        29 ~~Ge~~aiiG~NGsGKSTLl~~l~Gl~~   56 (273)
T PRK13647         29 PEGSKTAILGPNGAGKSTLLLHLNGIYT   56 (273)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999759999999966988


No 223
>TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230   Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems.   The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly .   The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets.   In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen .   This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport.
Probab=96.17  E-value=0.0045  Score=38.61  Aligned_cols=24  Identities=25%  Similarity=0.383  Sum_probs=21.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             888689986788879799999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLK   25 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~   25 (225)
                      ++|=+.||=|+.||||||+++-|+
T Consensus        24 ~~GE~HAiMGPNGsGKSTL~~~ia   47 (248)
T TIGR01978        24 KKGEIHAIMGPNGSGKSTLSKTIA   47 (248)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             685179986889984788877761


No 224
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter; InterPro: IPR005897   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains ABC-type bacteriocin transporter. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.    Peptide bacteriocins are exported across the cytoplasmic membrane by a dedicated ATP-binding cassette (ABC) transporter. These ABC-transporters have an N-terminal peptidase domain that belong to MEROPS peptidase family C39 (clan CA); a central multi-pass transmembrane region and a C-terminal ABC transporter domain. These transporters have dual function: (i) they remove the N-terminal leader peptide from its bacteriocin precursor by cleavage at a Gly-Gly bond and (ii) transport the mature bacteriocin across the cytoplasmic membrane. This represents a novel strategy for secretion of bacterial proteins . Many bacteria are known to regulate diverse physiological processes through this system, such as bioluminescence, regulation of sporulation, virulence factor expression, antibiotics production, competence for genetic transformation, and activation of biofilm formation .; GO: 0008234 cysteine-type peptidase activity, 0019534 toxin transporter activity, 0006810 transport, 0016020 membrane.
Probab=96.17  E-value=0.0036  Score=39.18  Aligned_cols=27  Identities=33%  Similarity=0.523  Sum_probs=23.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      +.+-=+++=|+-||||||++++|...+
T Consensus       498 ~~n~k~tiVGmSGSGKsTLaKLLV~Ff  524 (710)
T TIGR01193       498 KKNEKITIVGMSGSGKSTLAKLLVGFF  524 (710)
T ss_pred             ECCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             078548997367974899998752035


No 225
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.16  E-value=0.032  Score=33.54  Aligned_cols=38  Identities=26%  Similarity=0.272  Sum_probs=28.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH-CC-CCEEEE
Q ss_conf             988868998678887979999999999997-79-819998
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR-KN-YDVHVT   38 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~-~g-~~v~~~   38 (225)
                      +.+|..++|=|+-|+||||-+.+|+.++.- +| .+|-++
T Consensus       173 ~~~ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLI  212 (404)
T PRK06995        173 MERGGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALL  212 (404)
T ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             1147558986688876375899999999998389837999


No 226
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=96.16  E-value=0.0053  Score=38.18  Aligned_cols=27  Identities=26%  Similarity=0.528  Sum_probs=23.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ..|-|+|+=|+-||||||..++++-..
T Consensus        27 ~~Gef~vllGPSGcGKSTlLr~IAGLe   53 (338)
T COG3839          27 EDGEFVVLLGPSGCGKSTLLRMIAGLE   53 (338)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             479799998999888899999996887


No 227
>pfam07728 AAA_5 AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=96.15  E-value=0.0085  Score=36.94  Aligned_cols=41  Identities=22%  Similarity=0.235  Sum_probs=26.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCH
Q ss_conf             9986788879799999999999977981999877889844100
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEA   49 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~   49 (225)
                      |-+.|..|+|||+.++.+++.+.  +.++..+....++...+.
T Consensus         2 vll~Gp~G~GKT~la~~la~~l~--~~~~~~i~~~~~~~~~dl   42 (139)
T pfam07728         2 VLLVGPPGTGKSELAERLAAALS--NRPVFYVQLTRDTTEEDL   42 (139)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCC--CCCCHHHCCCCCCCHHHC
T ss_conf             89998997569999999999807--983111214655652220


No 228
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.15  E-value=0.0048  Score=38.46  Aligned_cols=30  Identities=23%  Similarity=0.371  Sum_probs=25.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .++|-+++|-|..||||||.++.+.-.+.-
T Consensus        34 i~~Ge~~aIiG~nGsGKSTL~~~l~Gll~p   63 (289)
T PRK13645         34 FKKNKVTCVIGTTGSGKSTMIQLTNGLIIS   63 (289)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             889989999999995799999999659889


No 229
>TIGR01188 drrA daunorubicin resistance ABC transporter, ATP-binding protein; InterPro: IPR005894   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains the daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. In other words it functions as an ATP dependent antiporter. .
Probab=96.14  E-value=0.0023  Score=40.33  Aligned_cols=175  Identities=24%  Similarity=0.343  Sum_probs=79.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH-HC------CCCEEEEECCCCCCCCCHHHHCC--CCCC---CCCCHHHHHHH
Q ss_conf             8886899867888797999999999999-77------98199987788984410011001--2444---54101345677
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ-RK------NYDVHVTREPGGTPAAEAARHVL--LSCG---VDEFGAEAEAI   69 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~-~~------g~~v~~~~eP~~t~~ge~ir~~l--~~~~---~~~~~~~~~~l   69 (225)
                      ++|-.+.|=||.||||||.+++|+--|+ ..      ||+|  +|||..-    .+|+-+  ....   ...++-+.-+.
T Consensus        19 ~~G~vfGfLGPNGAGKTTti~mLtTll~P~sG~A~V~GYDv--vreP~kl----~VRr~IG~v~Q~~s~D~~LTg~ENl~   92 (343)
T TIGR01188        19 REGEVFGFLGPNGAGKTTTIRMLTTLLKPTSGTARVAGYDV--VREPRKL----KVRRRIGIVPQYASVDEDLTGRENLV   92 (343)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEEEEEEC--CCCHHHC----CCCEEEEEECCCCCCCCCCCHHHHHH
T ss_conf             06248997687998513356341025579987689983210--2363040----32113204468555564577475444


Q ss_pred             HHHHH-----HHHHHHHHHHHHHCC---CCEEEECCCC--CCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEC
Q ss_conf             78899-----999776356554234---5258723542--4310001003444245776544420388984115665203
Q gi|254780218|r   70 VFAAA-----RLDHVENVIRPALME---GKILLCDRFL--DSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLP  139 (225)
Q Consensus        70 Lfaad-----r~~~~~~~I~p~L~~---g~iVI~DRy~--~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~  139 (225)
                      |+ |.     ++.. ++-+...|+-   ++  =.||++  ||.    |+++-+     +--..   -.-+|++. |||=|
T Consensus        93 m~-g~LyGlp~~~~-~~Ra~ELLe~~~L~~--aa~r~V~tySG----GMrRRL-----~iA~s---li~~P~vL-FLDEP  155 (343)
T TIGR01188        93 MM-GRLYGLPKKEA-EERAEELLELFELTE--AADRKVKTYSG----GMRRRL-----EIAAS---LIHQPEVL-FLDEP  155 (343)
T ss_pred             HH-HHHCCCCHHHH-HHHHHHHHHHCCHHH--HHCCCCCCCCC----CCEEHH-----HHHHH---HHCCCCEE-ECCCC
T ss_conf             53-33348968999-988888762300146--62543322677----112144-----54311---10388256-51488


Q ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHH--HHHHHHHHHHHCCCCEEEEC-----CCCCHHHHHHHHHH
Q ss_conf             487764432111110000000021128899999--99999999997899499981-----89788999999999
Q gi|254780218|r  140 VDIGLKRVQNRYSLRESACLDYFERKDVMIHEK--RRQIFLDIARNQPDRCHIVD-----SAHSFQSVATNILN  206 (225)
Q Consensus       140 ~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~k--v~~~y~~la~~~~~~~~~ID-----a~~~~eei~~~I~~  206 (225)
                       ...+.= ++|     ..-||..++...+.-..  +-..|.+=|...-+++-+||     |..+++++...+.+
T Consensus       156 -T~GLDP-~tR-----~~iWd~i~~lk~~~g~TilLTThYmeEAd~L~DriaiId~G~iiA~gt~~eLK~tvik  222 (343)
T TIGR01188       156 -TTGLDP-RTR-----RAIWDYIEALKKEEGVTILLTTHYMEEADKLCDRIAIIDHGRIIAEGTPEELKRTVIK  222 (343)
T ss_pred             -CCCCCH-HHH-----HHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEECCEEEEECCCCHHHHHHHH
T ss_conf             -768888-669-----9999999998740796999743786999823688788616489986692024677630


No 230
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.14  E-value=0.0056  Score=38.03  Aligned_cols=28  Identities=29%  Similarity=0.514  Sum_probs=24.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++=|..||||||..+.|+-.+.
T Consensus        24 k~GEi~gLiGpNGaGKSTLlk~i~Gll~   51 (255)
T cd03236          24 REGQVLGLVGPNGIGKSTALKILAGKLK   51 (255)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             8980999989999709999999967986


No 231
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.13  E-value=0.0046  Score=38.57  Aligned_cols=29  Identities=28%  Similarity=0.459  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|-+++|=|..||||||.++.|...|.-
T Consensus        32 ~~Ge~vaiiG~nGsGKSTL~~~l~Gll~P   60 (283)
T PRK13640         32 PRGSWTALIGHNGSGKSTISKLINGLLLP   60 (283)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             89999999999998799999999640378


No 232
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.13  E-value=0.0062  Score=37.76  Aligned_cols=28  Identities=36%  Similarity=0.508  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|+.||||||..+.|+-.++
T Consensus        23 ~~GEiv~ilGpNGaGKSTllk~i~G~l~   50 (177)
T cd03222          23 KEGEVIGIVGPNGTGKTTAVKILAGQLI   50 (177)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             8998999989999999999999968867


No 233
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]
Probab=96.13  E-value=0.012  Score=35.99  Aligned_cols=35  Identities=40%  Similarity=0.521  Sum_probs=28.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHC-CCCEEEEE
Q ss_conf             689986788879799999999999977-98199987
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTR   39 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~-g~~v~~~~   39 (225)
                      |-|+|.|=-|+||||.+.+|...|-++ |++|..+.
T Consensus         1 mkIaI~GKGG~GKTtiaalll~~l~~~~~~~VLvVD   36 (255)
T COG3640           1 MKIAITGKGGVGKTTIAALLLKRLLSKGGYNVLVVD   36 (255)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             969996599765899999999999864895499994


No 234
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.13  E-value=0.0054  Score=38.14  Aligned_cols=30  Identities=30%  Similarity=0.496  Sum_probs=26.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-+++|-|..||||||.++.|.-.++-.
T Consensus        26 ~~Ge~vaiiG~nGsGKSTL~~~l~Gll~P~   55 (274)
T PRK13644         26 KKGEYIGIIGKNGSGKSTLALHLNGLLRPQ   55 (274)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             489999999999980999999997068588


No 235
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=96.12  E-value=0.0055  Score=38.08  Aligned_cols=29  Identities=34%  Similarity=0.559  Sum_probs=25.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|=|+.||||||..+.+.-.+..
T Consensus        23 ~~GE~v~iiG~nGaGKSTLl~~i~Gll~p   51 (233)
T PRK10771         23 ERGEQVAILGPSGAGKSTLLNLIAGFLTP   51 (233)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             89989999999998199999999659999


No 236
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=96.11  E-value=0.0056  Score=38.02  Aligned_cols=28  Identities=25%  Similarity=0.426  Sum_probs=24.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9888689986788879799999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      +.+|-++++-|..||||||..+.|.-.+
T Consensus        24 i~~Ge~~aliG~sGsGKSTLl~~l~gl~   51 (248)
T PRK11264         24 VKPGEVVAIIGPSGSGKTTLLRCINLLE   51 (248)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             8799899999999980999999997589


No 237
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.10  E-value=0.0052  Score=38.24  Aligned_cols=29  Identities=24%  Similarity=0.558  Sum_probs=25.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+++|-|+.||||||..+.++-.++
T Consensus        27 i~~Ge~~~iiGpsGsGKSTLl~~i~Gl~~   55 (220)
T cd03293          27 VEEGEFVALVGPSGCGKSTLLRIIAGLER   55 (220)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             87998999999999579999999975999


No 238
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.10  E-value=0.0051  Score=38.26  Aligned_cols=29  Identities=31%  Similarity=0.540  Sum_probs=25.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|-|++|=|..||||||.++.+.-.+.-
T Consensus        30 ~~Ge~vaiiG~nGsGKSTLl~~l~Gll~p   58 (288)
T PRK13643         30 KKGSYTALIGHTGSGKSTLLQHLNGLLQP   58 (288)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             59989999999994799999999748888


No 239
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=96.09  E-value=0.0065  Score=37.65  Aligned_cols=28  Identities=32%  Similarity=0.584  Sum_probs=24.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-|++|-|+-||||||+.+.+.-..+
T Consensus        29 ~~Ge~vaI~GpSGSGKSTLLniig~ld~   56 (226)
T COG1136          29 EAGEFVAIVGPSGSGKSTLLNLLGGLDK   56 (226)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             4998999989999989999999964667


No 240
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.09  E-value=0.0058  Score=37.96  Aligned_cols=29  Identities=45%  Similarity=0.673  Sum_probs=25.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.+|.+|+|-|.-||||||.++.|...+.
T Consensus        26 i~~Ge~vaivG~sGsGKSTLl~ll~gl~~   54 (229)
T cd03254          26 IKPGETVAIVGPTGAGKTTLINLLMRFYD   54 (229)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             87999999999999809999999966866


No 241
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=96.09  E-value=0.0057  Score=37.97  Aligned_cols=27  Identities=22%  Similarity=0.486  Sum_probs=23.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-+++|-|+-||||||..+.+.-..
T Consensus        22 ~~Ge~~~i~GpSGsGKSTLL~~i~gl~   48 (206)
T TIGR03608        22 EKGKMVAIVGESGSGKSTLLNIIGLLE   48 (206)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             699899998799970999999997599


No 242
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=96.09  E-value=0.0056  Score=38.02  Aligned_cols=30  Identities=30%  Similarity=0.507  Sum_probs=25.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-++++-|..||||||..+.+...+.-.
T Consensus        36 ~~GEiv~LiG~nGaGKSTLlr~i~Gl~~p~   65 (257)
T PRK11247         36 PAGQFVAVVGRSGCGKSTLLRLLAGLETPT   65 (257)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             799899999899888999999996589888


No 243
>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582    To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage. In Saccharomyces cerevisiae the Ddc1/Rad17/Mec3 complex and Rad24 are DNA damage checkpoint components which may promote checkpoint activation by "sensing" DNA damage directly . Rad24 shares sequence homology with RF-c, a protein that recognises DNA template/RNA primer hybrids during DNA replication. The Ddc1 complex has structural homology to proliferating-cell nuclear antigen (PCNA), which clamps onto DNA and confers processivity to DNA polymerases delta and epsilon. Rad24 is postulated to recognise DNA lesions and then recruit the Ddc1 complex to generate checkpoint signals. ; GO: 0006281 DNA repair, 0007049 cell cycle, 0005634 nucleus.
Probab=96.09  E-value=0.0058  Score=37.94  Aligned_cols=29  Identities=34%  Similarity=0.567  Sum_probs=25.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             86899867888797999999999999779819
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      |-+.-|.|+.||||||.++.|++.|   |+.+
T Consensus       118 Gs~LLi~GPsGCgKsT~~k~LsKel---g~~~  146 (670)
T TIGR00602       118 GSILLITGPSGCGKSTTIKILSKEL---GIKV  146 (670)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHH---HHHH
T ss_conf             5378841755884478999998886---4456


No 244
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364    Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase (IPR013363 from INTERPRO) of a type-IV secretion-like system of the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii..
Probab=96.09  E-value=0.0078  Score=37.19  Aligned_cols=34  Identities=21%  Similarity=0.314  Sum_probs=27.3

Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHC--CCCEEEEECC
Q ss_conf             986788879799999999999977--9819998778
Q gi|254780218|r    8 SFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREP   41 (225)
Q Consensus         8 ~iEGiDGsGKsTq~~~L~~~L~~~--g~~v~~~~eP   41 (225)
                      -|+|.=|||||||+..+++++-+.  ..|++++--|
T Consensus       153 LiCG~TGSGKSTl~AaiY~~~l~t~pdRKivT~EDP  188 (374)
T TIGR02525       153 LICGETGSGKSTLAAAIYRHCLETYPDRKIVTYEDP  188 (374)
T ss_pred             EECCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             221778972899999999985074889707986577


No 245
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=96.08  E-value=0.0063  Score=37.73  Aligned_cols=29  Identities=34%  Similarity=0.529  Sum_probs=25.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|..|+|-|..||||||.+++|.....
T Consensus       364 I~~Ge~vaIVG~SGsGKSTL~~LL~rly~  392 (593)
T PRK10790        364 VPSRNFVALVGHTGSGKSTLASLLMGYYP  392 (593)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             48997899879998868999999998556


No 246
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=96.08  E-value=0.0059  Score=37.92  Aligned_cols=29  Identities=24%  Similarity=0.515  Sum_probs=25.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+++|=|+.||||||..+.|...+.
T Consensus        27 i~~GE~~~iiGpNGaGKSTLlk~i~Gll~   55 (262)
T PRK09984         27 IHHGEMVALLGPSGSGKSTLLRHLSGLIT   55 (262)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             87998999998999609999999975677


No 247
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=96.08  E-value=0.023  Score=34.34  Aligned_cols=38  Identities=21%  Similarity=0.145  Sum_probs=32.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             88868998678887979999999999997798199987
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      -+|.++-|-|..|+||||.+-.++......|.+|+++.
T Consensus        17 ~~G~it~i~G~pG~GKStl~lq~a~~~~~~g~~v~Yid   54 (218)
T cd01394          17 ERGTVTQVYGPPGTGKTNIAIQLAVETAGQGKKVAYID   54 (218)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             78879999899998499999999999863698699996


No 248
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=96.07  E-value=0.0062  Score=37.76  Aligned_cols=28  Identities=25%  Similarity=0.525  Sum_probs=25.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|-|..||||||..+.|...+.
T Consensus        31 ~~Ge~~~i~G~sGsGKSTLlk~i~gl~~   58 (225)
T PRK10247         31 RAGEFKLITGPSGCGKSTLLKIVASLIS   58 (225)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             5996999999999999999999964668


No 249
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=96.06  E-value=0.063  Score=31.76  Aligned_cols=26  Identities=23%  Similarity=0.360  Sum_probs=23.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99867888797999999999999779
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
                      --|.|+.|+||+|.++.+++.|.+.+
T Consensus        42 yLF~Gp~G~Gk~~~A~~~A~~l~C~~   67 (395)
T PRK07940         42 WLFTGPPGSGRSNAARAFAAALQCTD   67 (395)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             76368998788999999999966999


No 250
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.05  E-value=0.005  Score=38.33  Aligned_cols=28  Identities=32%  Similarity=0.592  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|-|..||||||.++.|...+.
T Consensus        18 ~~Ge~vaiiG~sGsGKSTLl~~l~GLl~   45 (276)
T PRK13634         18 PSGSYVAIIGHTGSGKSTLLQHLNGLLK   45 (276)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999699999999974999


No 251
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.04  E-value=0.0059  Score=37.92  Aligned_cols=30  Identities=30%  Similarity=0.592  Sum_probs=25.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .++|.+|+|-|.-||||||..++|...++-
T Consensus        25 i~~Ge~i~IvG~sGsGKSTLl~ll~gl~~p   54 (234)
T cd03251          25 IPAGETVALVGPSGSGKSTLVNLIPRFYDV   54 (234)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             879999999989998299999999667667


No 252
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.04  E-value=0.0063  Score=37.73  Aligned_cols=35  Identities=26%  Similarity=0.270  Sum_probs=27.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             88868998678887979999999999997798199
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      .+|.++++=|..||||||..+.+...++-..=.+.
T Consensus        28 ~~Ge~~aliG~NGaGKSTLl~~i~Gll~p~~G~I~   62 (277)
T PRK13652         28 GRKQRIAVIGPNGAGKSTLFKHFNGILKPTSGSVL   62 (277)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             89989999999994799999999669999846999


No 253
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136   This entry represents the Ti-type conjugative transfer relaxase TraA. TraA contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, IPR005053 from INTERPRO) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, IPR014129 from INTERPRO). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer ..
Probab=96.03  E-value=0.02  Score=34.75  Aligned_cols=79  Identities=20%  Similarity=0.214  Sum_probs=52.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
                      +-+=|+=|--|+||||..+-+.+++++.||.|+     | --.+-+.-+-|  .....+..+|.+-|=.  +|++=    
T Consensus       430 ~~iavVvG~AGtGKSt~L~aAR~AWe~~Gy~V~-----G-AALsGKAAegL--e~~sGI~SRTLASle~--aW~~G----  495 (888)
T TIGR02768       430 GDIAVVVGRAGTGKSTMLKAAREAWEAAGYRVI-----G-AALSGKAAEGL--EAESGIESRTLASLEY--AWANG----  495 (888)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEE-----E-HHHHHHHHHHH--HCCCCCCHHHHHHHHH--HHHCC----
T ss_conf             964899748998766789999999987397787-----1-54555898873--0026875047887999--98738----


Q ss_pred             HHHHCCCCEEEEC
Q ss_conf             5542345258723
Q gi|254780218|r   84 RPALMEGKILLCD   96 (225)
Q Consensus        84 ~p~L~~g~iVI~D   96 (225)
                      +..|.++.|.|.|
T Consensus       496 ~d~L~~~dvLviD  508 (888)
T TIGR02768       496 RDLLEDKDVLVID  508 (888)
T ss_pred             CCCCCCCCEEEEE
T ss_conf             7522477668985


No 254
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=96.03  E-value=0.0067  Score=37.56  Aligned_cols=27  Identities=33%  Similarity=0.518  Sum_probs=23.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-|++|-|+.||||||..+.+....
T Consensus        25 ~~Ge~v~i~GpSGsGKSTLl~~i~gl~   51 (214)
T cd03292          25 SAGEFVFLVGPSGAGKSTLLKLIYKEE   51 (214)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             599899999799953999999996298


No 255
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.03  E-value=0.006  Score=37.84  Aligned_cols=28  Identities=36%  Similarity=0.643  Sum_probs=25.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-|++|=|+.||||||..+.+...++
T Consensus        25 ~~Ge~~~iiGpsGsGKSTLl~~i~gl~~   52 (241)
T cd03256          25 NPGEFVALIGPSGAGKSTLLRCLNGLVE   52 (241)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             9998999999998339999999974999


No 256
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=96.02  E-value=0.042  Score=32.79  Aligned_cols=25  Identities=32%  Similarity=0.416  Sum_probs=21.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9986788879799999999999977
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .-|.|+.|+||||.+..+++.|-..
T Consensus        39 lLf~GPpG~GKTt~A~~lA~~l~~~   63 (337)
T PRK12402         39 LVVYGPSGSGKTAAVRALARELYGD   63 (337)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             9888929848999999999996799


No 257
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.02  E-value=0.0066  Score=37.60  Aligned_cols=31  Identities=32%  Similarity=0.516  Sum_probs=26.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9888689986788879799999999999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      +..|-++++-|+.||||||..+.|+-.++-.
T Consensus        34 v~~Ge~~~l~GpNGaGKTTLlr~l~Gl~~p~   64 (214)
T PRK13543         34 VDAGEALLVQGDNGAGKTTLLRVLAGLLHVE   64 (214)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             8189899999999987999999997697788


No 258
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=96.02  E-value=0.0065  Score=37.64  Aligned_cols=28  Identities=29%  Similarity=0.475  Sum_probs=24.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|-|..||||||..+.++-.+.
T Consensus        33 ~~GE~v~iiG~sGsGKSTLl~~i~Gl~~   60 (233)
T PRK11629         33 GEGEMMAIVGSSGSGKSTLLHLLGGLDT   60 (233)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             8998999999999409999999966999


No 259
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=96.01  E-value=0.0075  Score=37.28  Aligned_cols=30  Identities=33%  Similarity=0.560  Sum_probs=26.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-+++|-|..||||||..+.+...++..
T Consensus        24 ~~Gei~~iiG~nGaGKSTLl~~i~Gl~~p~   53 (205)
T cd03226          24 YAGEIIALTGKNGAGKTTLAKILAGLIKES   53 (205)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             699899998899998999999995685777


No 260
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=96.01  E-value=0.0071  Score=37.42  Aligned_cols=28  Identities=32%  Similarity=0.634  Sum_probs=24.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9888689986788879799999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      +++|-|+++=|+-||||||..++++-.-
T Consensus        28 i~~Gef~tlLGPSGcGKTTlLR~IAGfe   55 (352)
T COG3842          28 IKKGEFVTLLGPSGCGKTTLLRMIAGFE   55 (352)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             4488689998998888899999996777


No 261
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=96.01  E-value=0.0065  Score=37.66  Aligned_cols=29  Identities=28%  Similarity=0.517  Sum_probs=25.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|-+|+|-|.-||||||.+++|...+.
T Consensus        60 I~~Ge~vaIVG~sGSGKSTLl~lL~gl~~   88 (282)
T cd03291          60 IEKGEMLAITGSTGSGKTSLLMLILGELE   88 (282)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             84999999999999819999999957872


No 262
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=96.00  E-value=0.0071  Score=37.43  Aligned_cols=28  Identities=25%  Similarity=0.446  Sum_probs=25.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|-|..||||||.++.|...+.
T Consensus        28 ~~Ge~v~ivG~sGsGKSTLl~ll~gl~~   55 (221)
T cd03244          28 KPGEKVGIVGRTGSGKSSLLLALFRLVE   55 (221)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             6998999999999989999999967971


No 263
>TIGR00630 uvra excinuclease ABC, A subunit; InterPro: IPR004602   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products . The UvrC protein contain 4 conserved regions: a central region which interact with UvrB (Uvr domain), a Helix hairpin Helix (HhH) domain important for 5 prime incision of damage DNA and the homology regions 1 and 2 of unknown function. UvrC homology region 2 is specific for UvrC proteins, whereas UvrC homology region 1 is also shared by few other nucleases.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0009380 excinuclease repair complex.
Probab=96.00  E-value=0.0042  Score=38.77  Aligned_cols=29  Identities=41%  Similarity=0.662  Sum_probs=22.1

Q ss_pred             CCEEEEECCCCCCHHHHHHH-----HHHHHHHCC
Q ss_conf             86899867888797999999-----999999779
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISL-----LKRFLQRKN   32 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~-----L~~~L~~~g   32 (225)
                      |.|.+|.|+-||||||+++-     |++.|...+
T Consensus       665 G~~t~iTGVSGSGKSTLind~L~~~~~~~L~~~~  698 (956)
T TIGR00630       665 GLFTCITGVSGSGKSTLINDTLYPALARRLNGAK  698 (956)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             7179997445874577799999999999985276


No 264
>PHA02519 plasmid partition protein SopA; Reviewed
Probab=95.99  E-value=0.018  Score=35.02  Aligned_cols=39  Identities=18%  Similarity=0.264  Sum_probs=30.3

Q ss_pred             CEEEEECC-CCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCC
Q ss_conf             68998678-887979999999999997798199987--7889
Q gi|254780218|r    5 LFISFEGI-EGAGKTTHISLLKRFLQRKNYDVHVTR--EPGG   43 (225)
Q Consensus         5 ~~I~iEGi-DGsGKsTq~~~L~~~L~~~g~~v~~~~--eP~~   43 (225)
                      ..|+|--- -|+||||-+-.|++.|..+|+.|..+.  -|-+
T Consensus       107 ~VIAVaN~KGGVGKTTTavnLA~~LAl~G~RVL~ID~lDPQa  148 (387)
T PHA02519        107 VVLAVMSHKGGVYKTSSAVHTAQWLALQGHRVLLIEGNDPQG  148 (387)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             289986168877699999999999997699689995988520


No 265
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=95.99  E-value=0.0042  Score=38.79  Aligned_cols=32  Identities=25%  Similarity=0.426  Sum_probs=26.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             88868998678887979999999999997798
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNY   33 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~   33 (225)
                      ++|-+++|=|+.||||||..+.|.......|.
T Consensus        21 ~~Ge~v~iiGpNGaGKSTLlk~i~Gl~p~~G~   52 (245)
T PRK03695         21 RAGEILHLVGPNGAGKSTLLARMAGLLSGSGE   52 (245)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCE
T ss_conf             59989999978994199999998466888965


No 266
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=95.99  E-value=0.0065  Score=37.66  Aligned_cols=29  Identities=28%  Similarity=0.428  Sum_probs=24.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.+|-+++|-|..||||||..+.+...+.
T Consensus        28 i~~Ge~~~IvG~sGsGKSTLl~~i~G~~~   56 (204)
T cd03250          28 VPKGELVAIVGPVGSGKSSLLSALLGELE   56 (204)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHCCCCC
T ss_conf             76998999999999858999999818952


No 267
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.98  E-value=0.0063  Score=37.74  Aligned_cols=28  Identities=32%  Similarity=0.539  Sum_probs=25.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|.+++|-|..||||||..+.|...++
T Consensus        26 ~~Ge~i~ivG~sGsGKSTLl~ll~gl~~   53 (171)
T cd03228          26 KPGEKVAIVGPSGSGKSTLLKLLLRLYD   53 (171)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             5998999999999839999999976775


No 268
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=95.98  E-value=0.0022  Score=40.45  Aligned_cols=82  Identities=17%  Similarity=0.265  Sum_probs=43.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCC--CCHHHHHHHHHH--HHHH-HHHHH
Q ss_conf             998678887979999999999997798199987788984410011001244454--101345677788--9999-97763
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD--EFGAEAEAIVFA--AARL-DHVEN   81 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~--~~~~~~~~lLfa--adr~-~~~~~   81 (225)
                      +.|=|+.|+||||.++.+++....   ..+...  .-+...+.+|+++-..+..  ....++  +||.  -.|+ ....+
T Consensus        55 ~Il~GPPGtGKTTLA~iIA~~t~~---~F~~ls--Av~sgvkdlr~ii~~A~~~~~~~g~~t--ILFIDEIHRfNK~QQD  127 (726)
T PRK13341         55 LILYGPPGVGKTTLARIIANHTRA---HFSSLN--AVLAGVKDLRAEVDAAKERLERHGKRT--ILFIDEVHRFNKAQQD  127 (726)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCC---CEEEEE--CCCCCHHHHHHHHHHHHHHHHHCCCCE--EEEEECHHHCCHHHHH
T ss_conf             788897999999999999887488---679985--620377999999999999987459965--9998625425887899


Q ss_pred             HHHHHHCCCCEEEE
Q ss_conf             56554234525872
Q gi|254780218|r   82 VIRPALMEGKILLC   95 (225)
Q Consensus        82 ~I~p~L~~g~iVI~   95 (225)
                      ...|.+++|.+++.
T Consensus       128 ~LLp~vE~G~i~LI  141 (726)
T PRK13341        128 ALLPWVENGTVTLI  141 (726)
T ss_pred             HHHHHHCCCEEEEE
T ss_conf             87888606838999


No 269
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.97  E-value=0.0058  Score=37.94  Aligned_cols=29  Identities=34%  Similarity=0.602  Sum_probs=25.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|-|..||||||.++.+...+.-
T Consensus        31 ~~GE~v~iiG~nGsGKSTLl~~l~GLl~p   59 (287)
T PRK13637         31 EDGEFVALIGHTGSGKSTLIQHLNGLLKP   59 (287)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             79989999999993999999999739988


No 270
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=95.96  E-value=0.0063  Score=37.75  Aligned_cols=30  Identities=27%  Similarity=0.451  Sum_probs=25.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      +++|-+++|=|+.||||||..+.|+..+..
T Consensus        30 i~~Ge~~~ilGpnGsGKSTLl~~i~G~~~~   59 (226)
T cd03234          30 VESGQVMAILGSSGSGKTTLLDAISGRVEG   59 (226)
T ss_pred             EECCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             918809999989996099999999678978


No 271
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.
Probab=95.96  E-value=0.015  Score=35.43  Aligned_cols=33  Identities=39%  Similarity=0.530  Sum_probs=30.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             998678887979999999999997798199987
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      |++.|=-|+||||.+..|+.+|.++|++|..+.
T Consensus         2 ia~~GKGGvGKtt~~~~la~~l~~~g~~vl~iD   34 (116)
T cd02034           2 IAITGKGGVGKTTIAALLARYLAEKGKPVLAID   34 (116)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             789889977499999999999997899699998


No 272
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.96  E-value=0.0058  Score=37.94  Aligned_cols=34  Identities=26%  Similarity=0.552  Sum_probs=27.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             8886899867888797999999999999779819
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      ++|-+++|=|..||||||.++.|...+.-..-.+
T Consensus        28 ~~GE~vaivG~nGsGKSTL~~~l~Gll~p~~G~I   61 (276)
T PRK13650         28 KQGEWLSIIGHNGSGKSTTVRLIDGLLEAESGSI   61 (276)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             8998999999999879999999973889886089


No 273
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=95.96  E-value=0.007  Score=37.46  Aligned_cols=30  Identities=27%  Similarity=0.491  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-++++=|+.||||||..+.+...+.-.
T Consensus        26 ~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~   55 (255)
T PRK11231         26 PTGKITALIGPNGCGKSTLLKCFARLLTPQ   55 (255)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             899799999999981999999997598888


No 274
>pfam07015 VirC1 VirC1 protein. This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumour formation by increasing the level of T-DNA processing. It is thought that the virC operon which enhances T-DNA processing probably does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA.
Probab=95.95  E-value=0.021  Score=34.61  Aligned_cols=36  Identities=31%  Similarity=0.255  Sum_probs=28.1

Q ss_pred             EEEE-CCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCC
Q ss_conf             9986-78887979999999999997798199987-788
Q gi|254780218|r    7 ISFE-GIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPG   42 (225)
Q Consensus         7 I~iE-GiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~   42 (225)
                      |+|- .=-||||||.+-.|+..|.++|++|.++. .|.
T Consensus         4 i~~~~~KGG~GKtT~a~~la~~~~~~g~~V~liD~Dpq   41 (231)
T pfam07015         4 ITFCSFKGGAGKTTALMGLCSALASDGKRVALFEADEN   41 (231)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             99961799865999999999999968995999968998


No 275
>pfam03205 MobB Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop.
Probab=95.95  E-value=0.016  Score=35.35  Aligned_cols=33  Identities=36%  Similarity=0.559  Sum_probs=29.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             899867888797999999999999779819998
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      .|.|-|.-+|||||.++.|.+++.++|+.+...
T Consensus         2 ~v~i~G~~~sGKttl~~~L~~~~~~~g~~~~~~   34 (122)
T pfam03205         2 IVLVVGPKDSGKTTLIRKLLNYLKRRGYRVAVV   34 (122)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             799994899989999999999999879944899


No 276
>PRK10744 phosphate transporter subunit; Provisional
Probab=95.94  E-value=0.0077  Score=37.21  Aligned_cols=29  Identities=21%  Similarity=0.453  Sum_probs=25.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|-+++|=|..||||||..+.|...+.
T Consensus        33 i~~Ge~~~liG~nGaGKSTLlk~i~gl~~   61 (257)
T PRK10744         33 IAKNQVTAFIGPSGCGKSTLLRTFNKMYE   61 (257)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             88998999999999819999999987651


No 277
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.93  E-value=0.008  Score=37.10  Aligned_cols=28  Identities=32%  Similarity=0.488  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++=|..||||||.++.|...++
T Consensus        26 ~~Ge~vaiiG~nGsGKSTLl~~l~Gll~   53 (275)
T PRK13639         26 EEGEMIAILGPNGAGKSTLFLHFNGILK   53 (275)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999649999999973989


No 278
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.93  E-value=0.0067  Score=37.58  Aligned_cols=28  Identities=29%  Similarity=0.605  Sum_probs=25.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|=|..||||||.++.+...+.
T Consensus        31 ~~Ge~~~iiG~nGsGKSTLl~~l~Gll~   58 (286)
T PRK13641         31 EDGSFVALIGHTGSGKSTLMQHFNALLK   58 (286)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             6999999999998399999999965989


No 279
>pfam08303 tRNA_lig_kinase tRNA ligase kinase domain. This domain is found in fungal tRNA ligases and has kinase activity. tRNA ligases are enzymes required for the splicing of precursor tRNA molecules containing introns.
Probab=95.93  E-value=0.073  Score=31.37  Aligned_cols=143  Identities=15%  Similarity=0.110  Sum_probs=64.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC--
Q ss_conf             788879799999999999977981999877889844100110012444541013456777889999977635655423--
Q gi|254780218|r   11 GIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALM--   88 (225)
Q Consensus        11 GiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p~L~--   88 (225)
                      -.-||||||.+-.|.+.+-+-|+  +.    ++.         +. ++...  +.     |+       .. +...|.  
T Consensus         6 AtIGCGKTTv~~aL~~LFg~WgH--vQ----NDn---------I~-~k~~~--~k-----f~-------~~-~l~~L~~~   54 (169)
T pfam08303         6 ATIGCGKTTVSLTLNNLFPEWGH--VQ----NDN---------IT-GKGDK--SK-----LM-------KA-ALELLAKD   54 (169)
T ss_pred             CCCCCCHHHHHHHHHHHCCCCCC--CC----CCC---------CC-CCCCH--HH-----HH-------HH-HHHHHHHC
T ss_conf             26885599999999997788776--41----787---------76-77751--48-----99-------99-99998615


Q ss_pred             CCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCC-CC-CCCEEE----EEEEC-----HHHHHHHHHHHHHHHHCC
Q ss_conf             45258723542431000100344424577654442038-89-841156----65203-----487764432111110000
Q gi|254780218|r   89 EGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQ-EV-MPDCTI----ILDLP-----VDIGLKRVQNRYSLRESA  157 (225)
Q Consensus        89 ~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~-~~-~PDl~i----~Ldv~-----~e~a~~Ri~~R~~~~~~~  157 (225)
                      ...+||+||.-+..        .-....++|+...... .| .|++-|    |.+-+     .++..+|+.+|+.....-
T Consensus        55 ~~~vViaDRNNh~~--------reRkql~~~v~~~~~~~l~~~~~~r~VaL~fv~~~~~~~i~~it~~RV~~RGDNHQtI  126 (169)
T pfam08303        55 GSSVVIADRNNHQS--------RERKQLFTWIDQLKDNYLPYDTNLKVIALSFVDEDDLEEVREITRDRVLKRGDNHQSI  126 (169)
T ss_pred             CCCEEEEECCCCHH--------HHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             99679983776459--------9999999999987311267888738999980169986999999999998548775354


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             000021128899999999999999978994999818978899999
Q gi|254780218|r  158 CLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVAT  202 (225)
Q Consensus       158 ~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~  202 (225)
                         +.++.+......+-++|.+-       +.-+|.+.+|+.-..
T Consensus       127 ---k~~s~~~~~v~~IM~gFi~r-------fqp~~~~~~PD~~FD  161 (169)
T pfam08303       127 ---KVESMGEKKVMGIMNGFIKR-------FQPVNPAKSPDNMFD  161 (169)
T ss_pred             ---ECCCCCHHHHHHHHHHHHHH-------CCCCCCCCCCCCCCC
T ss_conf             ---35888778999999999983-------378998889641458


No 280
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=95.93  E-value=0.0087  Score=36.90  Aligned_cols=28  Identities=36%  Similarity=0.652  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++-|..||||||..+.|+-.+.
T Consensus        25 ~~Ge~~~l~G~NGaGKSTLl~~l~Gl~~   52 (204)
T PRK13538         25 NAGELVQIEGPNGAGKTSLLRILAGLAR   52 (204)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             7998999999999859999999976888


No 281
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.93  E-value=0.0078  Score=37.19  Aligned_cols=28  Identities=32%  Similarity=0.694  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|=|+.||||||..+.++..++
T Consensus        25 ~~Ge~~~ilGpSG~GKSTllr~i~gl~~   52 (242)
T cd03295          25 AKGEFLVLIGPSGSGKTTTMKMINRLIE   52 (242)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             6998999999999569999999975999


No 282
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=95.93  E-value=0.0077  Score=37.22  Aligned_cols=26  Identities=27%  Similarity=0.376  Sum_probs=23.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             98886899867888797999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      +++|-++++=|+.||||||..+.+.-
T Consensus        24 i~~Gei~~iiG~nGaGKSTLl~~i~G   49 (248)
T PRK09580         24 VRPGEVHAIMGPNGSGKSTLSATLAG   49 (248)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             84997999999999999999999837


No 283
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=95.92  E-value=0.0088  Score=36.88  Aligned_cols=29  Identities=21%  Similarity=0.371  Sum_probs=25.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+|+|-|..||||||.++.|...+.
T Consensus        44 I~~Ge~vaIvG~sGsGKSTL~~ll~gl~~   72 (257)
T cd03288          44 IKPGQKVGICGRTGSGKSSLSLAFFRMVD   72 (257)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             87999999999999819999999960566


No 284
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=95.91  E-value=0.006  Score=37.85  Aligned_cols=30  Identities=33%  Similarity=0.572  Sum_probs=26.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .++|..++|-|.-||||||.+++|...+.-
T Consensus       365 I~~G~~vaiVG~SGsGKSTL~~LL~gly~p  394 (581)
T PRK11176        365 IPAGKTVALVGRSGSGKSTIANLLTRFYDI  394 (581)
T ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHCCC
T ss_conf             799944312289998678999999853667


No 285
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.90  E-value=0.0081  Score=37.09  Aligned_cols=28  Identities=32%  Similarity=0.525  Sum_probs=24.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|=|+.||||||..+.++-..+
T Consensus        26 ~~Ge~~~iiGpSGsGKSTll~~i~Gl~~   53 (239)
T cd03296          26 PSGELVALLGPSGSGKTTLLRLIAGLER   53 (239)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999779999999976999


No 286
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein; InterPro: IPR005666   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     These proteins are involved in the transmembrane transport of sulphate and thiosulphate.; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016020 membrane.
Probab=95.90  E-value=0.0071  Score=37.43  Aligned_cols=26  Identities=23%  Similarity=0.535  Sum_probs=23.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             98886899867888797999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      +..|.++++=|+-||||||+.+.++-
T Consensus        23 v~~G~lvaLLGPSGSGKsTLLR~iAG   48 (241)
T TIGR00968        23 VPTGSLVALLGPSGSGKSTLLRVIAG   48 (241)
T ss_pred             ECCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             43852798546898737899999835


No 287
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=95.90  E-value=0.0089  Score=36.85  Aligned_cols=30  Identities=43%  Similarity=0.619  Sum_probs=25.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-+++|=|..||||||..+.|...+.-.
T Consensus        31 ~~GE~v~IiG~nGsGKSTL~k~l~Gll~P~   60 (304)
T PRK13651         31 NQGEFIAIIGQTGSGKTTFIEHLNALLLPD   60 (304)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             599899998799985999999996699988


No 288
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.90  E-value=0.0077  Score=37.20  Aligned_cols=30  Identities=27%  Similarity=0.517  Sum_probs=26.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-+++|=|..||||||.++.|...+...
T Consensus        31 ~~Ge~~aiiG~sGsGKSTL~~~l~Gl~~~~   60 (277)
T PRK13642         31 TKGEWVSIIGQNGSGKSTTARLIDGLFEEF   60 (277)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             899899999999968999999996389988


No 289
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=95.90  E-value=0.0064  Score=37.71  Aligned_cols=32  Identities=31%  Similarity=0.506  Sum_probs=26.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             98886899867888797999999999999779
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
                      .++|..|+|-|.-||||||.+++|.......|
T Consensus       373 i~~Ge~vaIVG~SGsGKSTl~~LL~g~~p~~G  404 (588)
T PRK11174        373 LPAGQRVALVGPSGAGKTSLLNALLGFLPYQG  404 (588)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC
T ss_conf             74997899989998649999999987289883


No 290
>KOG0055 consensus
Probab=95.89  E-value=0.03  Score=33.71  Aligned_cols=27  Identities=44%  Similarity=0.688  Sum_probs=22.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ..|..+++=|.-||||||.+++|.+..
T Consensus       377 ~~G~~valVG~SGsGKST~i~LL~Rfy  403 (1228)
T KOG0055         377 PSGQTVALVGPSGSGKSTLIQLLARFY  403 (1228)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             799889998899987999999999726


No 291
>TIGR01663 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterPro: IPR006550   These sequences represent the metazoan 5'-polynucleotide-kinase-3'-phosphatase, PNKP, which is believed to be involved in repair of oxidative DNA damage. Removal of 3'-phosphates is essential for the further processing of the break by DNA polymerases , . The central phosphatase domain is a member of the IIIA subfamily (IPR006549 from INTERPRO) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. As is common in this superfamily, the enzyme is magnesium dependent. A difference between this enzyme and other HAD-superfamily phosphatases is in the third conserved catalytic motif which usually contains two conserved aspartate residues believed to be involved in binding the magnesium ion. Here, the second aspartate is replaced by a conserved arginine residue which may indicate an interaction with the phosphate backbone of the substrate. Very close relatives of this domain are also found separate from the N- and C-terminal domains seen here, as in the 3'-phosphatase found in plants. The larger family of these domains is described by IPR006551 from INTERPRO. Outside of the phosphatase domain is a P-loop ATP-binding motif associated with the kinase activity. The entry for the mouse homolog appears to be missing a large piece of sequence corresponding to the first conserved catalytic motif of the phosphatase domain as well as the conserved threonine of the second motif. Either this is a sequencing artifact or this may represent a pseudo- or non-functional gene. .
Probab=95.87  E-value=0.083  Score=31.05  Aligned_cols=99  Identities=22%  Similarity=0.337  Sum_probs=62.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844100110012444541013456777889999977635655
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP   85 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p   85 (225)
                      .++.=|+.||||||-   ++.+|..+||.++--             +.|        -... -++.++.|          
T Consensus       371 ~V~~VGlPG~GKS~F---~~~~l~~~GY~~VN~-------------DTL--------GS~Q-~C~T~C~~----------  415 (526)
T TIGR01663       371 VVVAVGLPGAGKSTF---LKKFLVSAGYKIVNA-------------DTL--------GSTQ-RCLTACKR----------  415 (526)
T ss_pred             EEEEECCCCCCHHHH---HHHHHCCCCCEEECC-------------CCC--------CCHH-HHHHHHHH----------
T ss_conf             899843899857788---885403578558715-------------456--------7224-58999999----------


Q ss_pred             HHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             423452587235424310001003444245776544420388984115665203487764432111
Q gi|254780218|r   86 ALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRY  151 (225)
Q Consensus        86 ~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~  151 (225)
                      +|++|+-|+.|--            +.|-.--...-+.+...-.|-..|++.++.+.+...+.=|+
T Consensus       416 ~L~~G~~~~~DNT------------N~DAASR~~y~Q~A~~~~~PCRCl~~~~~~~Q~~HN~~FRE  469 (526)
T TIGR01663       416 ALDSGKRVVVDNT------------NVDAASRKKYLQLAREKGVPCRCLLFTVTLEQVKHNIAFRE  469 (526)
T ss_pred             HHHCCCEEEEECC------------CCCHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHCC
T ss_conf             9856988998568------------85776778999878646896177655061678542012202


No 292
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.87  E-value=0.008  Score=37.13  Aligned_cols=28  Identities=29%  Similarity=0.494  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|-|+.||||||..+.++-.++
T Consensus        22 ~~Ge~~~ilGpSGsGKSTLl~li~Gl~~   49 (211)
T cd03298          22 AQGEITAIVGPSGSGKSTLLNLIAGFET   49 (211)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999559999999976999


No 293
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.86  E-value=0.0084  Score=36.99  Aligned_cols=30  Identities=30%  Similarity=0.391  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-+++|=|..||||||..+.+...+.-.
T Consensus        30 ~~Ge~~aiiG~NGaGKSTLl~~i~Gll~p~   59 (285)
T PRK13636         30 KKGEVTAILGGNGAGKSTLFQNLNGILKPS   59 (285)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             799899999999980999999996598888


No 294
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=95.86  E-value=0.0083  Score=37.02  Aligned_cols=28  Identities=32%  Similarity=0.490  Sum_probs=25.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|..||||||.++.++..+.
T Consensus        48 ~~GEivgllG~NGaGKSTLlk~I~Gl~~   75 (264)
T PRK13546         48 YEGDVIGLVGINGSGKSTLSNIIGGSLS   75 (264)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             5998999998998619999999967988


No 295
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=95.85  E-value=0.0083  Score=37.01  Aligned_cols=29  Identities=28%  Similarity=0.432  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|-|..||||||..+.+...+..
T Consensus        34 ~~GE~v~ivG~sGsGKSTLl~~i~Gl~~p   62 (228)
T PRK10584         34 KRGETIALIGESGSGKSTLLAILAGLDDG   62 (228)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             99989999999985899999999669999


No 296
>PRK13544 consensus
Probab=95.84  E-value=0.0088  Score=36.88  Aligned_cols=28  Identities=25%  Similarity=0.407  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|+.||||||..+.|+..+.
T Consensus        25 ~~Gei~~l~G~NGsGKSTLl~~i~Gl~~   52 (208)
T PRK13544         25 KQNSLTLVIGNNGSGKTSLLRLLAGLIP   52 (208)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             2994999999999989999999958806


No 297
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=95.84  E-value=0.0081  Score=37.07  Aligned_cols=31  Identities=26%  Similarity=0.381  Sum_probs=26.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9888689986788879799999999999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ..+|.+++|=|..||||||..+.+...+.-.
T Consensus        31 i~~Gei~~iiGpnGsGKSTLlk~i~Gl~~p~   61 (269)
T PRK11831         31 VPRGKITAIMGPSGIGKTTLLRLIGGQIAPD   61 (269)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             8799899999399975999999996798889


No 298
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.84  E-value=0.029  Score=33.80  Aligned_cols=38  Identities=34%  Similarity=0.468  Sum_probs=29.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCC--EEEEECCCCC
Q ss_conf             9986788879799999999999977981--9998778898
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYD--VHVTREPGGT   44 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~--v~~~~eP~~t   44 (225)
                      .-|.|.-|+||||.++.+++.|.+.+.+  .-.+.+|.|.
T Consensus        41 ylf~G~rGvGKTt~ari~Ak~lnc~~~~~~~g~~~~pcg~   80 (721)
T PRK12323         41 YLFTGTRGVGKTTLSRILAKSLNCTGPDGEGGITAQPCGQ   80 (721)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             7502799888989999999997689986678987887877


No 299
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=95.83  E-value=0.0088  Score=36.86  Aligned_cols=30  Identities=20%  Similarity=0.268  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|.+++|-|.-||||||..+.|...++..
T Consensus        25 ~~Ge~~~IvG~sGsGKSTLl~~l~g~~~~~   54 (218)
T cd03290          25 PTGQLTMIVGQVGCGKSSLLLAILGEMQTL   54 (218)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             699999999999980999999985556567


No 300
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=95.83  E-value=0.0099  Score=36.57  Aligned_cols=27  Identities=26%  Similarity=0.399  Sum_probs=23.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-+++|-|+.||||||..+.|.-.+
T Consensus        26 ~~Ge~~~iiG~nGaGKSTLl~~l~gl~   52 (242)
T PRK11124         26 PQGETLVLLGPSGAGKSSLLRVLNLLE   52 (242)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             799899999999971999999996588


No 301
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=95.82  E-value=0.0092  Score=36.76  Aligned_cols=25  Identities=28%  Similarity=0.449  Sum_probs=23.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      ++|-+++|=|+.||||||..+.|.-
T Consensus        30 ~~Gei~aiiG~nGsGKSTL~~~i~G   54 (252)
T CHL00131         30 NAGEIHAIMGPNGSGKSTLSKVIAG   54 (252)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHCC
T ss_conf             7998999999999999999999727


No 302
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=95.81  E-value=0.0096  Score=36.63  Aligned_cols=36  Identities=25%  Similarity=0.447  Sum_probs=27.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             888689986788879799999999999977981999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      .+|-|++|=|+-||||||.-+.++-......-.|.+
T Consensus        27 ~~GEfvsilGpSGcGKSTLLriiAGL~~p~~G~V~~   62 (248)
T COG1116          27 EKGEFVAILGPSGCGKSTLLRLIAGLEKPTSGEVLL   62 (248)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEE
T ss_conf             799799998999788999999996878777755998


No 303
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.81  E-value=0.0093  Score=36.73  Aligned_cols=28  Identities=32%  Similarity=0.532  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|-|..||||||.++.|.-.+.
T Consensus        31 ~~Ge~~aiiG~nGsGKSTLl~~l~Gl~~   58 (280)
T PRK13649         31 LDGSYTAFIGHTGSGKSTIMQLLNGLHV   58 (280)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7998999995999869999999966999


No 304
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=95.81  E-value=0.01  Score=36.53  Aligned_cols=28  Identities=21%  Similarity=0.463  Sum_probs=24.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|+.||||||..+.+...+.
T Consensus        25 ~~Ge~~~liG~nGsGKSTll~~i~Gl~~   52 (240)
T PRK09493         25 DQGEVVVIIGPSGSGKSTLLRCINKLEE   52 (240)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7998999999999809999999963899


No 305
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=95.81  E-value=0.0094  Score=36.70  Aligned_cols=26  Identities=31%  Similarity=0.645  Sum_probs=23.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88868998678887979999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      ++|-||+|.|+.||||||..+.++..
T Consensus        27 ~~Ge~iaitGPSG~GKStllk~va~L   52 (223)
T COG4619          27 RAGEFIAITGPSGCGKSTLLKIVASL   52 (223)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHC
T ss_conf             38854887678876688999999813


No 306
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=95.80  E-value=0.012  Score=36.17  Aligned_cols=28  Identities=36%  Similarity=0.554  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|..||||||..+.|...+.
T Consensus        26 ~~Gei~~l~G~NGaGKTTLlk~i~Gl~~   53 (206)
T PRK13539         26 AAGEALVLTGPNGSGKTTLLRLLAGLLP   53 (206)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             6994999989999989999999958878


No 307
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=95.80  E-value=0.0097  Score=36.61  Aligned_cols=28  Identities=29%  Similarity=0.481  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-|+++=|+.||||||..+.+--.++
T Consensus        28 ~~G~~~~iiGPNGaGKSTLlK~iLGll~   55 (254)
T COG1121          28 EKGEITALIGPNGAGKSTLLKAILGLLK   55 (254)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             4896899999988888999999967876


No 308
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=95.80  E-value=0.0084  Score=36.98  Aligned_cols=29  Identities=31%  Similarity=0.601  Sum_probs=25.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.+|.+|+|-|..||||||.+++|...+.
T Consensus        25 i~~G~~vaivG~sGsGKSTll~ll~gl~~   53 (237)
T cd03252          25 IKPGEVVGIVGRSGSGKSTLTKLIQRFYV   53 (237)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             87999999999999859999999967765


No 309
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=95.79  E-value=0.0097  Score=36.62  Aligned_cols=28  Identities=39%  Similarity=0.659  Sum_probs=24.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-|+++-|+.||||||..++++-.+.
T Consensus        41 ~~GE~~~llGpSGsGKSTLlr~iaGl~~   68 (378)
T PRK09452         41 NNGEFLTLLGPSGCGKTTVLRLIAGFET   68 (378)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             9998999998999769999999976999


No 310
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.79  E-value=0.0082  Score=37.06  Aligned_cols=25  Identities=36%  Similarity=0.570  Sum_probs=22.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      ++|-++++=|+.||||||..+.|+.
T Consensus        31 ~~Ge~~~llGpnGaGKSTLl~~l~g   55 (192)
T cd03232          31 KPGTLTALMGESGAGKTTLLDVLAG   55 (192)
T ss_pred             ECCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             2883999999999988999999837


No 311
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=95.79  E-value=0.0097  Score=36.61  Aligned_cols=29  Identities=34%  Similarity=0.584  Sum_probs=25.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|-++++=|+.||||||..+.+...++.
T Consensus        25 ~~Gei~~iiG~nGaGKSTLlk~i~Gl~~p   53 (211)
T cd03225          25 KKGEFVLIVGPNGSGKSTLLRLLNGLLGP   53 (211)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             49979999889999899999999646779


No 312
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=95.79  E-value=0.0097  Score=36.61  Aligned_cols=30  Identities=27%  Similarity=0.512  Sum_probs=25.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-+++|-|+.||||||..+.++-.+.-.
T Consensus        28 ~~Ge~~~iiG~sGsGKTTll~~i~Gl~~p~   57 (218)
T cd03255          28 EKGEFVAIVGPSGSGKSTLLNILGGLDRPT   57 (218)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             699899999999986999999996699999


No 313
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=95.78  E-value=0.0077  Score=37.20  Aligned_cols=28  Identities=32%  Similarity=0.508  Sum_probs=25.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|..++|-|.-||||||.+++|...+.
T Consensus       365 ~~Ge~vaiVG~SGsGKSTL~~LL~r~yd  392 (575)
T PRK11160        365 KAGEKVALLGRTGCGKSTLLQLLTRAWD  392 (575)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             6998899988999759999999862367


No 314
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=95.78  E-value=0.011  Score=36.25  Aligned_cols=28  Identities=32%  Similarity=0.513  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|.+++|=|+.||||||..+.|...+.
T Consensus        24 ~~Ge~~~iiG~SGsGKSTll~~i~gL~~   51 (227)
T cd03260          24 PKGEITALIGPSGCGKSTLLRLLNRLND   51 (227)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             7998999999999819999999974450


No 315
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=95.77  E-value=0.01  Score=36.51  Aligned_cols=25  Identities=24%  Similarity=0.356  Sum_probs=22.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      ++|-++++=|+.||||||..+.|.-
T Consensus        24 ~~Gei~~iiGpnGaGKSTLl~~i~G   48 (200)
T cd03217          24 KKGEVHALMGPNGSGKSTLAKTIMG   48 (200)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHCC
T ss_conf             7998999996899999999999707


No 316
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=95.76  E-value=0.0078  Score=37.17  Aligned_cols=29  Identities=31%  Similarity=0.458  Sum_probs=25.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-.|+|-|..||||||..++|...+.
T Consensus       488 i~~Ge~vaIvG~sGsGKSTL~kll~Gl~~  516 (694)
T TIGR03375       488 IRPGEKVAIIGRIGSGKSTLLKLLLGLYQ  516 (694)
T ss_pred             ECCCCEEEEEECCCCCHHHHHHHHCCCCC
T ss_conf             87997899980589878899998556758


No 317
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=95.75  E-value=0.0097  Score=36.62  Aligned_cols=29  Identities=21%  Similarity=0.350  Sum_probs=24.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+++|-|..||||||..+.|...+.
T Consensus        24 i~~Ge~v~i~G~sGsGKSTLl~~l~Gl~~   52 (166)
T cd03223          24 IKPGDRLLITGPSGTGKSSLFRALAGLWP   52 (166)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHCCCCC
T ss_conf             88999999995899988999999869876


No 318
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=95.75  E-value=0.0097  Score=36.62  Aligned_cols=30  Identities=33%  Similarity=0.444  Sum_probs=25.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      +++|-+++|-|..||||||..+.++-.+.-
T Consensus        45 i~~GeivgilG~NGaGKSTLl~~i~Gl~~p   74 (224)
T cd03220          45 VPRGERIGLIGRNGAGKSTLLRLLAGIYPP   74 (224)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             838989999979998199999999758777


No 319
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=95.75  E-value=0.01  Score=36.48  Aligned_cols=28  Identities=32%  Similarity=0.444  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++=|+.||||||..+.|...+.
T Consensus        26 ~~Gei~~liGpNGaGKSTLlk~i~Gl~~   53 (257)
T PRK13548         26 RPGEVVAILGPNGAGKSTLLRALSGELP   53 (257)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             6998999999999879999999856757


No 320
>PRK10908 cell division protein FtsE; Provisional
Probab=95.74  E-value=0.0086  Score=36.91  Aligned_cols=28  Identities=29%  Similarity=0.424  Sum_probs=24.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|..||||||..+.+.-.+.
T Consensus        26 ~~Ge~~~liG~nGsGKSTLl~~i~Gl~~   53 (222)
T PRK10908         26 RPGEMAFLTGHSGAGKSTLLKLICGIER   53 (222)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             6998999999998079999999965999


No 321
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.72  E-value=0.01  Score=36.42  Aligned_cols=30  Identities=20%  Similarity=0.362  Sum_probs=26.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-+++|=|..||||||.++.|...+...
T Consensus        50 ~~Ge~vaIIG~nGsGKSTL~~~l~Gll~p~   79 (320)
T PRK13631         50 EKNKIYFIIGNSGSGKSTLVTHFNGLIKSK   79 (320)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             599899999499984999999997588899


No 322
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=95.72  E-value=0.0094  Score=36.70  Aligned_cols=28  Identities=29%  Similarity=0.516  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|+.||||||..+.++..++
T Consensus        26 ~~GE~~~llGpSGsGKSTLlr~iaGL~~   53 (352)
T PRK10851         26 PSGQMVALLGPSGSGKTTLLRIIAGLEH   53 (352)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             9998999999998469999999976999


No 323
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=95.71  E-value=0.01  Score=36.46  Aligned_cols=28  Identities=32%  Similarity=0.452  Sum_probs=25.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|..++|=|.-||||||.+++|....+
T Consensus       347 ~~Ge~vaiVG~SGsGKSTL~~LL~r~y~  374 (547)
T PRK10522        347 KRGELLFLIGGNGSGKSTLAMLLTGLYQ  374 (547)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             5998899989999977999999828966


No 324
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=95.71  E-value=0.0088  Score=36.86  Aligned_cols=30  Identities=33%  Similarity=0.535  Sum_probs=26.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      +++|..++|-|..||||||.+++|...++-
T Consensus       352 i~~Ge~vaiVG~sGsGKSTl~~LL~r~~~~  381 (567)
T COG1132         352 IEPGEKVAIVGPSGSGKSTLIKLLLRLYDP  381 (567)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             548987888558888578999999861588


No 325
>PRK13889 conjugal transfer relaxase TraA; Provisional
Probab=95.71  E-value=0.054  Score=32.15  Aligned_cols=79  Identities=19%  Similarity=0.249  Sum_probs=51.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHH
Q ss_conf             868998678887979999999999997798199987788984410011001244454101345677-7889999977635
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAI-VFAAARLDHVENV   82 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~l-Lfaadr~~~~~~~   82 (225)
                      +-+=++-|.-|+||||......+.++..||.|+     |..+.|+....+   .....+...|.+- ++   +|+.    
T Consensus       362 ~~iavVvG~AGtGKStmL~aAReawEa~GyrV~-----GaALsGkAAegL---e~~sGI~SrTlAs~e~---~w~~----  426 (992)
T PRK13889        362 RDLGVVVGYAGTGKSAMLGVAREAWEAAGYEVR-----GAALSGIAAENL---EGGSGIASRTIASLEH---GWGQ----  426 (992)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEE-----EECCCHHHHHHH---HHCCCCCCHHHHHHHH---HHHC----
T ss_conf             975899833888788999999999997798898-----115006899976---5347943167999999---8746----


Q ss_pred             HHHHHCCCCEEEECC
Q ss_conf             655423452587235
Q gi|254780218|r   83 IRPALMEGKILLCDR   97 (225)
Q Consensus        83 I~p~L~~g~iVI~DR   97 (225)
                      =+..|..+.|+|.|=
T Consensus       427 g~~~L~~~dVlVVDE  441 (992)
T PRK13889        427 GRDLLTARDVLVIDE  441 (992)
T ss_pred             CCCCCCCCCEEEEEC
T ss_conf             733478985899967


No 326
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=95.70  E-value=0.015  Score=35.49  Aligned_cols=28  Identities=29%  Similarity=0.393  Sum_probs=25.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             8868998678887979999999999997
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      +-+++.+.|+-||||||.++.|++.|++
T Consensus        77 ~k~IllL~GPvGsGKStl~~~Lk~~lE~  104 (361)
T smart00763       77 RKQILYLLGPVGGGKSSLVECLKRGLEE  104 (361)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             2569999889988779999999999998


No 327
>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=95.70  E-value=0.013  Score=35.79  Aligned_cols=39  Identities=23%  Similarity=0.255  Sum_probs=27.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             886899867888797999999999999779819998778
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      .+..|+|.|.-||||||..+.|...+......+++.-+|
T Consensus       138 ~~~~ilIsG~TGSGKTT~l~all~~i~~~~~riitiED~  176 (283)
T pfam00437       138 ARGNILVSGGTGSGKTTLLYALLNEINTDDERIVTIEDP  176 (283)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCEEEECCC
T ss_conf             197599988999988999999998408777627873378


No 328
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=95.69  E-value=0.019  Score=34.86  Aligned_cols=36  Identities=33%  Similarity=0.271  Sum_probs=29.1

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             886899867888797999999999999779819998
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      ++..+.|-|..||||||.++.++..+...+..++..
T Consensus         1 ~~~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~   36 (148)
T smart00382        1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVIYI   36 (148)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             997899999997029999999998726689968998


No 329
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.69  E-value=0.011  Score=36.32  Aligned_cols=27  Identities=22%  Similarity=0.442  Sum_probs=23.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-+++|=|+-||||||..+.++-..
T Consensus        24 ~~Ge~~~ivGpSG~GKSTllr~i~Gl~   50 (178)
T cd03229          24 EAGEIVALLGPSGSGKSTLLRCIAGLE   50 (178)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899899999999983999999998599


No 330
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=95.68  E-value=0.011  Score=36.32  Aligned_cols=22  Identities=27%  Similarity=0.551  Sum_probs=19.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHH
Q ss_conf             8886899867888797999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISL   23 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~   23 (225)
                      .+|.+++|-|..||||||..+.
T Consensus        19 ~~G~~~aIiG~sGsGKSTLl~~   40 (261)
T cd03271          19 PLGVLTCVTGVSGSGKSSLIND   40 (261)
T ss_pred             CCCCEEEEECCCCCCHHHHHHH
T ss_conf             8999999987999869999999


No 331
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.67  E-value=0.01  Score=36.42  Aligned_cols=28  Identities=21%  Similarity=0.501  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|=|+.||||||..+.++-.++
T Consensus        23 ~~Ge~~~iiGpSGsGKSTLlr~i~Gl~~   50 (235)
T cd03299          23 ERGDYFVILGPTGSGKSVLLETIAGFIK   50 (235)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999996359999999974999


No 332
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.67  E-value=0.011  Score=36.28  Aligned_cols=29  Identities=34%  Similarity=0.603  Sum_probs=24.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.+|-+++|=|+.||||||..+.++-..+
T Consensus        23 v~~Ge~~~iiGpSGsGKSTllr~i~Gl~~   51 (232)
T cd03300          23 IKEGEFFTLLGPSGCGKTTLLRLIAGFET   51 (232)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             87998999999999839999999977999


No 333
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed
Probab=95.67  E-value=0.01  Score=36.53  Aligned_cols=29  Identities=28%  Similarity=0.502  Sum_probs=25.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|=|+.||||||..+.|...++-
T Consensus        26 ~~GEi~gLIGPNGAGKSTLLk~I~Gll~P   54 (409)
T PRK09536         26 REGHLVGVVGPNGAGKTTLLRAMNGLITP   54 (409)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             89989999999872799999999668888


No 334
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.66  E-value=0.011  Score=36.17  Aligned_cols=28  Identities=21%  Similarity=0.299  Sum_probs=24.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|..||||||..+.|+..+.
T Consensus        31 ~~Gei~~llG~nGsGKSTLl~~l~G~~~   58 (202)
T cd03233          31 KPGEMVLVLGRPGSGCSTLLKALANRTE   58 (202)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             0984999998999988999999837878


No 335
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=95.65  E-value=0.018  Score=34.98  Aligned_cols=37  Identities=22%  Similarity=0.115  Sum_probs=30.4

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             8689986788879799999999999977981999877
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE   40 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e   40 (225)
                      +.-|.+.|+.|+||||.++.+++.+...++.++.+..
T Consensus        19 ~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~   55 (151)
T cd00009          19 PKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNA   55 (151)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEH
T ss_conf             9808998999988659999999971213798278547


No 336
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=95.65  E-value=0.012  Score=36.06  Aligned_cols=28  Identities=25%  Similarity=0.513  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++-|+.||||||..+.+...+.
T Consensus        28 ~~Gei~~LiGpNGaGKSTLlk~I~Gl~~   55 (251)
T PRK09544         28 KPGKILTLLGPNGAGKSTLVRVVLGLVA   55 (251)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             7997999998999889999999966888


No 337
>TIGR00630 uvra excinuclease ABC, A subunit; InterPro: IPR004602   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products . The UvrC protein contain 4 conserved regions: a central region which interact with UvrB (Uvr domain), a Helix hairpin Helix (HhH) domain important for 5 prime incision of damage DNA and the homology regions 1 and 2 of unknown function. UvrC homology region 2 is specific for UvrC proteins, whereas UvrC homology region 1 is also shared by few other nucleases.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0009380 excinuclease repair complex.
Probab=95.64  E-value=0.008  Score=37.11  Aligned_cols=19  Identities=21%  Similarity=0.531  Sum_probs=17.8

Q ss_pred             CCCEEEEECCCCCCHHHHH
Q ss_conf             8868998678887979999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHI   21 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~   21 (225)
                      |..||||.|+-||||||+|
T Consensus        21 r~~lVViTG~SGSGKSSLA   39 (956)
T TIGR00630        21 RDKLVVITGLSGSGKSSLA   39 (956)
T ss_pred             CCCEEEEECCCCCCCHHHH
T ss_conf             9866999745688615456


No 338
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=95.64  E-value=0.0094  Score=36.71  Aligned_cols=28  Identities=32%  Similarity=0.583  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|=|+.||||||..+.+...+.
T Consensus        31 ~~Ge~~~iiGpNGaGKSTLlk~i~Gll~   58 (265)
T PRK10253         31 PDGHFTAIIGPNGCGKSTLLRTLSRLMT   58 (265)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             5997999999988399999999974988


No 339
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=95.63  E-value=0.01  Score=36.54  Aligned_cols=27  Identities=30%  Similarity=0.388  Sum_probs=23.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      +.|-+++|-|+.||||||..+.|.-.+
T Consensus        33 ~~Gei~~ilGpnGaGKSTLl~~l~Gl~   59 (194)
T cd03213          33 KPGELTAIMGPSGAGKSTLLNALAGRR   59 (194)
T ss_pred             ECCEEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             088199999899951999999985777


No 340
>pfam03215 Rad17 Rad17 cell cycle checkpoint protein.
Probab=95.63  E-value=0.026  Score=34.02  Aligned_cols=36  Identities=25%  Similarity=0.452  Sum_probs=29.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             868998678887979999999999997798199987788
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG   42 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~   42 (225)
                      ..+.++.|+-||||||-++.|++.|   |+.+.-..-|.
T Consensus        45 ~~iLlLtGPaG~GKTTTI~lLAkeL---G~ei~EW~NP~   80 (490)
T pfam03215        45 QLILLLTGPSGCGKSTTVKVLSKEL---GIEIIEWSNPE   80 (490)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHH---CCEEEEECCCC
T ss_conf             3189987989988999999999975---96899814865


No 341
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=95.63  E-value=0.011  Score=36.31  Aligned_cols=24  Identities=33%  Similarity=0.308  Sum_probs=18.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             899867888797999999999999
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      -|.+=|+.|.||||.+++.-+.-+
T Consensus       178 HiiLYGPPGVGKTTaARl~LEe~K  201 (616)
T TIGR02903       178 HIILYGPPGVGKTTAARLALEEAK  201 (616)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             078557338847899999876213


No 342
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=95.63  E-value=0.012  Score=35.99  Aligned_cols=29  Identities=28%  Similarity=0.477  Sum_probs=24.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|-++++-|..||||||..+.+.-.+.
T Consensus        23 i~~Gei~~lvG~nGaGKSTl~~~i~Gl~~   51 (163)
T cd03216          23 VRRGEVHALLGENGAGKSTLMKILSGLYK   51 (163)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             87998999998899899999999957768


No 343
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=95.63  E-value=0.013  Score=35.89  Aligned_cols=26  Identities=35%  Similarity=0.539  Sum_probs=23.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88868998678887979999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      ++|-+++|=|..||||||..+.+.-.
T Consensus        29 ~~Gei~~iiG~sGsGKSTLl~~i~gl   54 (257)
T PRK10619         29 NAGDVISIIGSSGSGKSTFLRCINFL   54 (257)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             79979999989998199999999659


No 344
>PRK13542 consensus
Probab=95.62  E-value=0.013  Score=35.92  Aligned_cols=30  Identities=23%  Similarity=0.458  Sum_probs=26.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-++++-|..||||||..+.|...+.-.
T Consensus        42 ~~Gei~~liGpNGaGKTTLlk~l~Gll~p~   71 (224)
T PRK13542         42 APGDLLQVMGPNGSGKTSLLRVLSGLMPPA   71 (224)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             599799999999999999999995797888


No 345
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=95.62  E-value=0.011  Score=36.29  Aligned_cols=28  Identities=29%  Similarity=0.590  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-|+++=|+.||||||..+.|+-.+.
T Consensus        27 ~~Ge~~~llGpsG~GKSTllr~i~Gl~~   54 (369)
T PRK11000         27 HEGEFVVFVGPSGCGKSTLLRMIAGLED   54 (369)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7998999999997369999999977999


No 346
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=95.62  E-value=0.011  Score=36.34  Aligned_cols=28  Identities=32%  Similarity=0.464  Sum_probs=25.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|..||||||..+.+...+.
T Consensus        25 ~~Ge~~aliG~nGaGKSTLl~~i~G~l~   52 (273)
T PRK13547         25 EPGRVTALLGRNGAGKSTLLKVLAGELT   52 (273)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999769999999956788


No 347
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]
Probab=95.61  E-value=0.015  Score=35.50  Aligned_cols=41  Identities=34%  Similarity=0.447  Sum_probs=32.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             88868998678887979999999999997798199987788
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG   42 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~   42 (225)
                      +.|-+.+|+|..||||||+.+.|+--++...=.|..-.+|.
T Consensus        26 ~~Ge~~~i~G~NG~GKTtLLRilaGLl~p~~G~v~~~~~~i   66 (209)
T COG4133          26 NAGEALQITGPNGAGKTTLLRILAGLLRPDAGEVYWQGEPI   66 (209)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCC
T ss_conf             48877999899987588999999712687777578547887


No 348
>PRK13849 putative crown gall tumor protein VirC1; Provisional
Probab=95.60  E-value=0.036  Score=33.25  Aligned_cols=37  Identities=27%  Similarity=0.225  Sum_probs=28.4

Q ss_pred             EEEE-CCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCC
Q ss_conf             9986-78887979999999999997798199987-7889
Q gi|254780218|r    7 ISFE-GIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPGG   43 (225)
Q Consensus         7 I~iE-GiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~~   43 (225)
                      |+|- .=-||||||.+-.|+..|.+.|.+|.++. .|.+
T Consensus         4 i~~~~~KGG~GKtT~a~~la~~~~~~g~~v~~iD~Dpq~   42 (231)
T PRK13849          4 LTFCSFKGGAGKTTALMGLCAALASDGKRVALFEADENR   42 (231)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             999618998769999999999999789959999689986


No 349
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=95.59  E-value=0.013  Score=35.76  Aligned_cols=28  Identities=29%  Similarity=0.480  Sum_probs=24.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|..||||||..+.|...+.
T Consensus        35 ~~Ge~~~liG~NGaGKSTLl~~l~gl~~   62 (265)
T PRK10575         35 PAGKVTGLIGHNGSGKSTLLKMLGRHQP   62 (265)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7998999999999809999999956889


No 350
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=95.59  E-value=0.013  Score=35.93  Aligned_cols=29  Identities=34%  Similarity=0.432  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-++++=|..||||||..+.+...++.
T Consensus        29 ~~Gei~~liG~NGaGKSTLl~~i~G~~~~   57 (237)
T PRK11614         29 NQGEIVTLIGANGAGKTTLLGTLCGDPRA   57 (237)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             69979999879997599999999679988


No 351
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=95.58  E-value=0.01  Score=36.47  Aligned_cols=27  Identities=30%  Similarity=0.519  Sum_probs=24.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-|+++=|+.||||||..++++-..
T Consensus        30 ~~Ge~~~llGpSG~GKTTlLr~iaGl~   56 (351)
T PRK11432         30 KQGTMVTLLGPSGCGKTTVLRLVAGLE   56 (351)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899899999999649999999997699


No 352
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=95.58  E-value=0.012  Score=36.02  Aligned_cols=27  Identities=22%  Similarity=0.380  Sum_probs=23.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++|-+++|=|+-||||||..+.+.-..
T Consensus        24 ~~Ge~~~ivGpSGsGKSTLL~~i~gL~   50 (213)
T cd03262          24 KKGEVVVIIGPSGSGKSTLLRCINLLE   50 (213)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899899999999844999999998199


No 353
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=95.58  E-value=0.013  Score=35.81  Aligned_cols=26  Identities=31%  Similarity=0.503  Sum_probs=23.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88868998678887979999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      ++|-.|.+=|..||||||+.+.|+-.
T Consensus        31 ~~Ge~vgLvG~NGaGKSTLlriLaG~   56 (556)
T PRK11819         31 FPGAKIGVLGLNGAGKSTLLRIMAGV   56 (556)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             68989999999997199999998479


No 354
>TIGR00150 TIGR00150 conserved hypothetical protein TIGR00150; InterPro: IPR003442   This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements . .
Probab=95.57  E-value=0.018  Score=34.94  Aligned_cols=39  Identities=36%  Similarity=0.302  Sum_probs=30.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             8868998678887979999999999997798199987788984
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTP   45 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~   45 (225)
                      .|..|+++|-=||||||.++-+.+.|   |+.-.+++ |+-|-
T Consensus        27 ~~~v~~L~GDlGaGKTtl~~G~~~~L---G~~~~~~S-PTftl   65 (147)
T TIGR00150        27 LGTVVLLKGDLGAGKTTLVKGLLQGL---GITGNVTS-PTFTL   65 (147)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHC---CCEEEEEC-CCCCE
T ss_conf             75389973234666589999999837---92268857-93210


No 355
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=95.57  E-value=0.027  Score=33.93  Aligned_cols=34  Identities=29%  Similarity=0.335  Sum_probs=30.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8998678887979999999999997798199987
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      .|++-|--|+||||.+..|+..|.++|++|....
T Consensus         1 ~i~~~~~kGvGKTT~a~~La~~la~~g~~Vl~vD   34 (99)
T cd01983           1 VIVVTGKGGVGKTTLAANLAAALAKRGKRVLLID   34 (99)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             9898589977689999999999998899699986


No 356
>PRK12374 putative dithiobiotin synthetase; Provisional
Probab=95.57  E-value=0.029  Score=33.81  Aligned_cols=38  Identities=29%  Similarity=0.386  Sum_probs=32.5

Q ss_pred             CCCCCEEEEECCC-CCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9888689986788-8797999999999999779819998778
Q gi|254780218|r    1 MNSGLFISFEGIE-GAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         1 M~~g~~I~iEGiD-GsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      |.|+.||+  |-| ++|||+.+..|.+.|.++|++|...+ |
T Consensus         1 Mmk~~FIT--GTDTdVGKT~vsaaL~~~l~~~G~~v~~~K-P   39 (231)
T PRK12374          1 MLKRFFIT--GTDTSVGKTVVSRALLQALASQGKSVAGYK-P   39 (231)
T ss_pred             CCCCEEEE--ECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-E
T ss_conf             99647998--789995399999999999997899488885-6


No 357
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=95.56  E-value=0.012  Score=36.01  Aligned_cols=30  Identities=40%  Similarity=0.653  Sum_probs=26.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-++++=|+.||||||..+.|...++..
T Consensus        45 ~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~   74 (236)
T cd03267          45 EKGEIVGFIGPNGAGKTTTLKILSGLLQPT   74 (236)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             489599999999830999999996494887


No 358
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=95.56  E-value=0.044  Score=32.69  Aligned_cols=26  Identities=38%  Similarity=0.604  Sum_probs=23.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99867888797999999999999779
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
                      ..|.|+-|+||||.++.|++.|.+.+
T Consensus        48 ~l~~g~rg~gktt~ari~a~~lnc~~   73 (600)
T PRK09111         48 FMLTGVRGVGKTTTARILARALNYKG   73 (600)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             76457898789999999999966988


No 359
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.54  E-value=0.013  Score=35.83  Aligned_cols=29  Identities=31%  Similarity=0.572  Sum_probs=25.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +++|-+++|=|+.||||||..+.+...++
T Consensus        23 i~~Gei~~iiGpnGaGKSTl~~~i~Gl~~   51 (213)
T cd03259          23 VEPGEFLALLGPSGCGKTTLLRLIAGLER   51 (213)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             88998999999999739999999975999


No 360
>PRK08116 hypothetical protein; Validated
Probab=95.53  E-value=0.054  Score=32.15  Aligned_cols=38  Identities=24%  Similarity=0.214  Sum_probs=33.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             86899867888797999999999999779819998778
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      |.=+.|-|.-|+|||-++..++..|-++|++|+++..|
T Consensus       108 ~~GLll~G~~GtGKThLa~aIa~~l~~~g~~V~~~~~~  145 (262)
T PRK08116        108 SVGLLLWGSPGNGKTYLAAAIANELIEKGVPVVFVNVP  145 (262)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             86189989899989999999999999879939998899


No 361
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.52  E-value=0.013  Score=35.78  Aligned_cols=35  Identities=23%  Similarity=0.272  Sum_probs=27.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             88868998678887979999999999997798199
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      .+|-++++=|..||||||..+.|...++-..=.+.
T Consensus        25 ~~Gei~~liGpNGaGKSTLlk~l~Gl~~p~~G~I~   59 (271)
T PRK13638         25 SLSPVTGLVGANGCGKSTLFMNLSGLLRPQKGAVL   59 (271)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEE
T ss_conf             38979999999998099999999668888860799


No 362
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]
Probab=95.51  E-value=0.078  Score=31.22  Aligned_cols=41  Identities=24%  Similarity=0.183  Sum_probs=28.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             988868998678887979999999999997798199987788
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG   42 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~   42 (225)
                      |.+|.. .|-|+-||||||..+.|...+.+.+...++.--++
T Consensus       434 ~d~ghT-~I~G~tGaGKTvLl~~lla~~~k~~~~~iv~fDk~  474 (796)
T COG3451         434 EDVGHT-LIIGPTGAGKTVLLSFLLAQALKYGNPQIVAFDKD  474 (796)
T ss_pred             CCCCCE-EEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             676974-99889888789999999999987459818998489


No 363
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=95.51  E-value=0.014  Score=35.68  Aligned_cols=28  Identities=29%  Similarity=0.546  Sum_probs=24.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|=|+.||||||..+.++-..+
T Consensus        24 ~~Ge~~~i~GpSG~GKSTlLr~iaGl~~   51 (213)
T cd03301          24 ADGEFVVLLGPSGCGKTTTLRMIAGLEE   51 (213)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             6998999999998809999999976999


No 364
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=95.50  E-value=0.016  Score=35.31  Aligned_cols=30  Identities=30%  Similarity=0.491  Sum_probs=26.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-++++=|+.||||||..+.+.-.++..
T Consensus        24 ~~Gei~~liG~nGaGKSTLl~~i~Gl~~p~   53 (222)
T cd03224          24 PEGEIVALLGRNGAGKTTLLKTIMGLLPPR   53 (222)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             899899999999985999999997798899


No 365
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.50  E-value=0.12  Score=30.18  Aligned_cols=32  Identities=22%  Similarity=0.155  Sum_probs=22.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             98886899867888797999999999999779819
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      |++  |-.+-|+.||||||....+...|.. +..+
T Consensus         1 m~~--l~IvaG~NGsGKstv~~~~~~~~~~-~~~~   32 (187)
T COG4185           1 MKR--LDIVAGPNGSGKSTVYASTLAPLLP-GIVF   32 (187)
T ss_pred             CCE--EEEEECCCCCCCEEEEECCCHHHCC-CEEE
T ss_conf             965--8999668888732543102322148-7599


No 366
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=95.50  E-value=0.015  Score=35.41  Aligned_cols=28  Identities=39%  Similarity=0.527  Sum_probs=24.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|..+++-|+.||||||..+.|...++
T Consensus        24 ~~ge~~~l~G~NGsGKTTl~~~l~G~~~   51 (144)
T cd03221          24 NPGDRIGLVGRNGAGKSTLLKLIAGELE   51 (144)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             7999999998999849999999848988


No 367
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=95.49  E-value=0.029  Score=33.80  Aligned_cols=36  Identities=36%  Similarity=0.460  Sum_probs=29.9

Q ss_pred             CCC-CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             888-6899867888797999999999999779819998
Q gi|254780218|r    2 NSG-LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         2 ~~g-~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      +++ ..|-+-|..||||||++..+.+.|+++ |+..++
T Consensus        10 ~~~~~~i~v~Gp~GSGKTaLie~~~~~L~~~-~~~aVI   46 (202)
T COG0378          10 NRPMLRIGVGGPPGSGKTALIEKTLRALKDE-YKIAVI   46 (202)
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHHHHHH-CCEEEE
T ss_conf             5864899961799867899999999999752-776899


No 368
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321   These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=95.48  E-value=0.018  Score=34.98  Aligned_cols=53  Identities=32%  Similarity=0.473  Sum_probs=37.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE------------------ECCC-CC-CCCCHHHHCCC
Q ss_conf             8886899867888797999999999999779819998------------------7788-98-44100110012
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT------------------REPG-GT-PAAEAARHVLL   55 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~------------------~eP~-~t-~~ge~ir~~l~   55 (225)
                      ++|+ |-|.|+=||||||-...+-.++++....++.|                  ||=| +| .+...+|.+|.
T Consensus       126 ~~GL-iLVTGPTGSGKSTTlAsmIDyIN~~~~~HIiTIEDPIEyvh~~~~sli~QREvG~DT~sF~~ALraALR  198 (350)
T TIGR01420       126 PRGL-ILVTGPTGSGKSTTLASMIDYINKNKAGHIITIEDPIEYVHKNKRSLINQREVGLDTLSFANALRAALR  198 (350)
T ss_pred             CCCC-EEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCEEEEECCCEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             6993-898768898678999999978740388882563177314104770245436246754579999768410


No 369
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.; GO: 0005524 ATP binding, 0015416 phosphonate transmembrane-transporting ATPase activity, 0015716 phosphonate transport, 0016020 membrane.
Probab=95.48  E-value=0.012  Score=36.14  Aligned_cols=29  Identities=34%  Similarity=0.680  Sum_probs=25.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .++|=|+++=|+-||||||+.+-|-+--+
T Consensus        25 i~~GE~~~~IG~SGAGKSTLLR~iNrL~~   53 (253)
T TIGR02315        25 INPGEFVAVIGPSGAGKSTLLRCINRLVE   53 (253)
T ss_pred             EECCEEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             41651799973788726799987753026


No 370
>COG1660 Predicted P-loop-containing kinase [General function prediction only]
Probab=95.46  E-value=0.21  Score=28.60  Aligned_cols=27  Identities=26%  Similarity=0.535  Sum_probs=21.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             6899867888797999999999999779819
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      .+|.|.|.-||||||.++.|    +..||-+
T Consensus         2 ~lvIVTGlSGAGKsvAl~~l----EDlGyyc   28 (286)
T COG1660           2 RLVIVTGLSGAGKSVALRVL----EDLGYYC   28 (286)
T ss_pred             CEEEEECCCCCCHHHHHHHH----HHCCEEE
T ss_conf             46999568887688999999----7458045


No 371
>PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional
Probab=95.46  E-value=0.016  Score=35.26  Aligned_cols=30  Identities=37%  Similarity=0.564  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-++++=|+.||||||..+.+.-.+.-.
T Consensus        27 ~~Gei~~liGpNGaGKSTLl~~i~Gl~~~~   56 (241)
T PRK10895         27 NSGEIVGLLGPNGAGKTTTFYMVVGIVPRD   56 (241)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             399799998899986999999996788888


No 372
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE; InterPro: IPR014137   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase..
Probab=95.45  E-value=0.011  Score=36.18  Aligned_cols=26  Identities=31%  Similarity=0.456  Sum_probs=23.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             98886899867888797999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      ++.|+-|++=|--||||||++++|.-
T Consensus        35 l~~Ge~~gLLG~SG~GKSTLArlLlG   60 (267)
T TIGR02769        35 LEEGETVGLLGRSGCGKSTLARLLLG   60 (267)
T ss_pred             ECCCCEEEECCCCCCCHHHHHHHHHH
T ss_conf             13775055236788737789999875


No 373
>PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional
Probab=95.45  E-value=0.015  Score=35.48  Aligned_cols=36  Identities=25%  Similarity=0.386  Sum_probs=27.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             888689986788879799999999999977981999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      ++|-++.|=|+.||||||.++.|.-.+..-.=.+.+
T Consensus        29 ~~Gei~gllGpNGAGKTTli~~l~Gl~~p~sG~v~i   64 (304)
T PRK13537         29 QPGECFGLLGPNGAGKTTTLKMLLGLTHPDAGTISL   64 (304)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEE
T ss_conf             699599999998972999999997795689768999


No 374
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=95.44  E-value=0.016  Score=35.36  Aligned_cols=28  Identities=29%  Similarity=0.460  Sum_probs=24.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.|.+|+|-|--||||||.+++|....+
T Consensus       497 ~~Ge~vaIvG~SGsGKSTL~KLL~gly~  524 (709)
T COG2274         497 PPGEKVAIVGRSGSGKSTLLKLLLGLYK  524 (709)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             7998899987999988999999836788


No 375
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=95.42  E-value=0.016  Score=35.29  Aligned_cols=27  Identities=19%  Similarity=0.421  Sum_probs=24.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++|-+++|=|+-||||||..+.+....
T Consensus        48 ~~GEi~~lvGpSGsGKSTLLr~i~GL~   74 (382)
T TIGR03415        48 EEGEICVLMGLSGSGKSSLLRAVNGLN   74 (382)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             799899999999734999999997599


No 376
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA).  This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life.  ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities.   To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates.  A divalent cation, typically Mg2+, is required for its enzymatic activity.
Probab=95.42  E-value=0.04  Score=32.91  Aligned_cols=37  Identities=30%  Similarity=0.383  Sum_probs=33.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CC
Q ss_conf             68998678887979999999999997798199987-78
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EP   41 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP   41 (225)
                      ++|.|-|=-|+||||.+..++-.|.++|++|.++. .|
T Consensus         1 r~i~~~GKGGVGKTT~AaalA~~lA~~G~kVLlvstDP   38 (254)
T cd00550           1 RYIFFGGKGGVGKTTISAATAVRLAEQGKKVLLVSTDP   38 (254)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             98999689855489999999999996899499995898


No 377
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=95.42  E-value=0.041  Score=32.87  Aligned_cols=36  Identities=19%  Similarity=0.262  Sum_probs=23.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCC---CEEEEECC
Q ss_conf             8868998678887979999999999997798---19998778
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNY---DVHVTREP   41 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~---~v~~~~eP   41 (225)
                      ..-.|+|.|--|||||||+-...   -+.|+   ..+....|
T Consensus        88 ~nqVvii~GeTGsGKTTQiPq~~---le~g~g~~~~I~~TQP  126 (1295)
T PRK11131         88 DHQVVIVAGETGSGKTTQLPKIC---LELGRGIKGLIGHTQP  126 (1295)
T ss_pred             HCCEEEEECCCCCCHHHHHHHHH---HHCCCCCCCEEEECCC
T ss_conf             79969997689998788999999---9627999998997796


No 378
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.41  E-value=0.015  Score=35.40  Aligned_cols=28  Identities=32%  Similarity=0.510  Sum_probs=24.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+| ++++=|+.||||||..+.+.-.+.-
T Consensus        24 ~~G-i~gllGpNGAGKSTll~~i~Gl~~p   51 (211)
T cd03264          24 GPG-MYGLLGPNGAGKTTLMRILATLTPP   51 (211)
T ss_pred             CCC-EEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             897-5999999982399999999759668


No 379
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=95.41  E-value=0.018  Score=35.04  Aligned_cols=28  Identities=32%  Similarity=0.548  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++-|..||||||..+.+...++
T Consensus        23 ~~Ge~~~liG~nGsGKTTLl~~i~G~~~   50 (180)
T cd03214          23 EAGEIVGILGPNGAGKSTLLKTLAGLLK   50 (180)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             6997999998999889999999957989


No 380
>PRK09183 transposase/IS protein; Provisional
Probab=95.41  E-value=0.1  Score=30.46  Aligned_cols=40  Identities=25%  Similarity=0.171  Sum_probs=33.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             8886899867888797999999999999779819998778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      .++.=|+|-|+-|+|||-.+..|....-.+|++|.+++-|
T Consensus        99 ~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~~~  138 (258)
T PRK09183         99 ERNENIVLLGPSGVGKTHLAIALGYEAVRAGIKVRFTTAA  138 (258)
T ss_pred             HCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             5588679989999868999999999999879939997899


No 381
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=95.41  E-value=0.044  Score=32.72  Aligned_cols=39  Identities=21%  Similarity=0.243  Sum_probs=32.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH-HHHCCCCEEEEE
Q ss_conf             988868998678887979999999999-997798199987
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRF-LQRKNYDVHVTR   39 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~-L~~~g~~v~~~~   39 (225)
                      |.+|-|++|-|..|+||||.+..++.. ..+.|.+|.++.
T Consensus        27 l~~GeL~viaarpg~GKT~f~~~~a~~~~~~~g~~vl~~S   66 (271)
T cd01122          27 LRKGELIILTAGTGVGKTTFLREYALDLITQHGVRVGTIS   66 (271)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9998089999689986999999999999997699089997


No 382
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.40  E-value=0.017  Score=35.15  Aligned_cols=30  Identities=37%  Similarity=0.572  Sum_probs=26.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-++++=|+.||||||..+.+.-.++-.
T Consensus        24 ~~Gei~gllGpNGAGKSTll~~i~Gl~~p~   53 (220)
T cd03265          24 RRGEIFGLLGPNGAGKTTTIKMLTTLLKPT   53 (220)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             898399999999871999999997697889


No 383
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=95.40  E-value=0.017  Score=35.12  Aligned_cols=23  Identities=22%  Similarity=0.430  Sum_probs=20.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             88868998678887979999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLL   24 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L   24 (225)
                      ++|.+++|-|..||||||.++.+
T Consensus        19 ~~Ge~~~iiG~nGsGKSTLl~~~   41 (176)
T cd03238          19 PLNVLVVVTGVSGSGKSTLVNEG   41 (176)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHH
T ss_conf             89989999999999899999988


No 384
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.40  E-value=0.018  Score=35.02  Aligned_cols=27  Identities=26%  Similarity=0.548  Sum_probs=24.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++|-+++|-|..||||||..+.|.-.+
T Consensus        23 ~~Ge~~~i~G~nGaGKSTLl~~l~gl~   49 (157)
T cd00267          23 KAGEIVALVGPNGSGKSTLLRAIAGLL   49 (157)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             799799998788999899999995884


No 385
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=95.38  E-value=0.016  Score=35.25  Aligned_cols=31  Identities=26%  Similarity=0.489  Sum_probs=26.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9888689986788879799999999999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      +++|-++++=|+.||||||..+.+.-.++-.
T Consensus        23 v~~Gei~~llGpNGAGKSTll~~i~Gl~~p~   53 (232)
T cd03218          23 VKQGEIVGLLGPNGAGKTTTFYMIVGLVKPD   53 (232)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             8999599999999961999999997799998


No 386
>PRK12377 putative replication protein; Provisional
Probab=95.38  E-value=0.14  Score=29.71  Aligned_cols=39  Identities=23%  Similarity=0.220  Sum_probs=32.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             888689986788879799999999999977981999877
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE   40 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e   40 (225)
                      ..+-=++|-|..|.|||.++-.|...+-.+|++|.++.-
T Consensus        99 ~~~~NlIf~G~pGtGKTHLA~AIg~~a~~~G~sVlF~t~  137 (248)
T PRK12377         99 TGCTNFVFSGKPGTGKNHLAAAIGNRLLAKGRSVIVVTV  137 (248)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH
T ss_conf             188608998999987889999999999987996999889


No 387
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=95.36  E-value=0.014  Score=35.60  Aligned_cols=28  Identities=32%  Similarity=0.533  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-+++|=|..||||||..+.|+-.+.
T Consensus        43 ~~GE~~~llGpsGsGKSTllr~i~Gl~~   70 (377)
T PRK11607         43 YKGEIFALLGASGCGKSTLLRMLAGFEQ   70 (377)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             9998999999998489999999976999


No 388
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=95.35  E-value=0.018  Score=34.95  Aligned_cols=29  Identities=34%  Similarity=0.488  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|-++++=|+.||||||..+.+...+.-
T Consensus        26 ~~Gei~~llG~NGaGKSTLl~~i~Gl~~p   54 (220)
T cd03263          26 YKGEIFGLLGHNGAGKTTTLKMLTGELRP   54 (220)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             49959999989997399999999669878


No 389
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=95.35  E-value=0.016  Score=35.38  Aligned_cols=28  Identities=29%  Similarity=0.522  Sum_probs=24.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|+.||||||..+.++-.++
T Consensus        28 ~~Ge~~~llGpsG~GKTTllr~iaGl~~   55 (358)
T PRK11650         28 ADGEFIVLVGPSGCGKSTLLRMVAGLER   55 (358)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999986369999999976999


No 390
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=95.34  E-value=0.047  Score=32.53  Aligned_cols=38  Identities=16%  Similarity=0.052  Sum_probs=29.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             88868998678887979999999999997798199987
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      -+|..|.|+|..||||||.+.......-++|.++.++.
T Consensus        30 p~g~~~li~G~~G~GKt~~~~~f~~~~~~~g~~~~~~~   67 (241)
T PRK06067         30 PFGSLILIEGENDTGKSVLSQQFVWGALNQGKRGLAIT   67 (241)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             79908999807998879999999999986798299999


No 391
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=95.33  E-value=0.014  Score=35.61  Aligned_cols=28  Identities=36%  Similarity=0.577  Sum_probs=19.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.|-.|++-|..||||||+.+.|+..+.
T Consensus        25 ~~Ge~vgLVG~NGsGKSTLlklL~G~~~   52 (638)
T PRK10636         25 NPGQKVGLVGKNGCGKSTLLALLKNEIS   52 (638)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCC
T ss_conf             8998999988999889999999808998


No 392
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=95.32  E-value=0.018  Score=35.01  Aligned_cols=28  Identities=36%  Similarity=0.478  Sum_probs=24.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++=|+.||||||..+.|.-.++
T Consensus        29 ~~Gei~~liGpnGaGKSTL~~~i~Gl~~   56 (255)
T PRK11300         29 REQEVVSLIGPNGAGKTTVFNCLTGFYK   56 (255)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             9997999998999649999999967988


No 393
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=95.31  E-value=0.019  Score=34.85  Aligned_cols=30  Identities=33%  Similarity=0.388  Sum_probs=25.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ++|-++++=|+.||||||..+.+.-.++..
T Consensus        24 ~~Gei~~liGpNGaGKSTL~~~i~Gl~~p~   53 (230)
T TIGR03410        24 PKGEVTCVLGRNGVGKTTLLKTLMGLLPVK   53 (230)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             999799999999940999999997799999


No 394
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=95.31  E-value=0.2  Score=28.83  Aligned_cols=26  Identities=31%  Similarity=0.565  Sum_probs=23.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99867888797999999999999779
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
                      .-|.|+.|+||||.++.++++|.+..
T Consensus        39 YLFsGPrGvGKTt~ArifAkaLnC~~   64 (523)
T PRK08451         39 YLFSGLRGSGKTSSARIFSRALVCEQ   64 (523)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             87578998688999999999975999


No 395
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=95.31  E-value=0.024  Score=34.30  Aligned_cols=31  Identities=32%  Similarity=0.428  Sum_probs=27.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             8689986788879799999999999977981
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYD   34 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~   34 (225)
                      +.+|++-|+.|+||||+++.|.+.+......
T Consensus        39 P~vVavvGPpgvGKtTLiksLvk~ytk~~l~   69 (225)
T cd01882          39 PLVVAVVGPPGVGKTTLIKSLVKNYTKQNIS   69 (225)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9699998989977889999999998544375


No 396
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.31  E-value=0.02  Score=34.73  Aligned_cols=28  Identities=36%  Similarity=0.544  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++-|+.||||||..+.+.-.+.
T Consensus        24 ~~Gei~gl~G~NGaGKSTLl~~i~Gl~~   51 (173)
T cd03230          24 EKGEIYGLLGPNGAGKTTLIKIILGLLK   51 (173)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             7993999987899799999999976857


No 397
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=95.29  E-value=0.016  Score=35.24  Aligned_cols=27  Identities=26%  Similarity=0.390  Sum_probs=20.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++|-.|++-|..||||||+.+.|+..+
T Consensus        27 ~~Ge~vgLVG~NGsGKSTLl~iL~G~~   53 (632)
T PRK11147         27 EDNERVCLVGRNGAGKSTLMKILSGEV   53 (632)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899899999999987999999983899


No 398
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.29  E-value=0.018  Score=35.03  Aligned_cols=28  Identities=29%  Similarity=0.538  Sum_probs=24.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|=|..||||||..+.+...++
T Consensus        24 ~~Ge~~~iiG~SGsGKSTll~~i~gL~~   51 (235)
T cd03261          24 RRGEILAIIGPSGSGKSTLLRLIVGLLR   51 (235)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7998999999999729999999975999


No 399
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=95.29  E-value=0.019  Score=34.84  Aligned_cols=26  Identities=31%  Similarity=0.473  Sum_probs=22.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88868998678887979999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      ++|-++++-|..||||||..+.|...
T Consensus        28 ~~Ge~~~lvG~nGaGKSTL~~~l~G~   53 (501)
T PRK11288         28 RAGQVHALMGENGAGKSTLLKILSGN   53 (501)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             89819999899998199999998479


No 400
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=95.29  E-value=0.045  Score=32.64  Aligned_cols=40  Identities=30%  Similarity=0.340  Sum_probs=35.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             8886899867888797999999999999779819998778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      .+|.=|+|-|.-|+|||-++..+...+-++|++|.+++.|
T Consensus        45 ~~~~Nlll~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~~   84 (178)
T pfam01695        45 EQAENLLLLGPPGVGKTHLACALGHQACRAGYSVLFTRTP   84 (178)
T ss_pred             HCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECH
T ss_conf             1587689989999878999999999999869859999616


No 401
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=95.28  E-value=0.012  Score=36.11  Aligned_cols=28  Identities=21%  Similarity=0.366  Sum_probs=24.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++=|..||||||..+.|.-.++
T Consensus        24 ~~GEi~~liG~nGaGKSTll~~l~G~~~   51 (182)
T cd03215          24 RAGEIVGIAGLVGNGQTELAEALFGLRP   51 (182)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHCCCCC
T ss_conf             5996999988899992637787669867


No 402
>PRK11701 phnK phosphonates transport ATP-binding protein; Provisional
Probab=95.28  E-value=0.021  Score=34.66  Aligned_cols=30  Identities=30%  Similarity=0.402  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-+++|-|..||||||..+.+...+.-.
T Consensus        30 ~~GEi~~iiG~nGaGKSTLl~~i~G~~~p~   59 (258)
T PRK11701         30 YPGEVLGIVGESGSGKTTLLNALSARLAPD   59 (258)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             799799998889988999999985678888


No 403
>PRK13235 nifH nitrogenase reductase; Reviewed
Probab=95.27  E-value=0.038  Score=33.04  Aligned_cols=38  Identities=26%  Similarity=0.293  Sum_probs=34.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECC
Q ss_conf             98886899867888797999999999999779819998-778
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REP   41 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP   41 (225)
                      |++   |+|=|=-|.||||-+..|+.+|.+.|.+|..+ .-|
T Consensus         1 m~~---iaiyGKGGVGKSTtt~NLaAALA~~GkkVl~IgcDP   39 (274)
T PRK13235          1 MRK---VAIYGKGGIGKSTTTQNTVAGLAEMGKKVMVVGCDP   39 (274)
T ss_pred             CCE---EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             967---999799855476789999999997899799989898


No 404
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=95.24  E-value=0.018  Score=35.03  Aligned_cols=28  Identities=32%  Similarity=0.686  Sum_probs=24.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+++|=|.-||||||..+.+...++
T Consensus        52 ~~GEi~~ivG~SGsGKSTLlr~i~gL~~   79 (400)
T PRK10070         52 EEGEIFVIMGLSGSGKSTMVRLLNRLIE   79 (400)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             7999999999998469999999975999


No 405
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=95.23  E-value=0.021  Score=34.60  Aligned_cols=29  Identities=28%  Similarity=0.370  Sum_probs=25.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      .+|-++.|=|+.||||||.++.|.-.+.-
T Consensus        31 ~~Gei~gllGpNGAGKSTli~~l~Gl~~p   59 (306)
T PRK13536         31 ASGECFGLLGPNGAGKSTIARMILGMTSP   59 (306)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCC
T ss_conf             59969999999898099999999679578


No 406
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=95.23  E-value=0.022  Score=34.52  Aligned_cols=30  Identities=30%  Similarity=0.545  Sum_probs=26.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-++++-|+.||||||..+.+.-.++-.
T Consensus        24 ~~Gei~gllG~NGaGKSTLl~~i~Gl~~p~   53 (208)
T cd03268          24 KKGEIYGFLGPNGAGKTTTMKIILGLIKPD   53 (208)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             698199999999999999999995783789


No 407
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=95.22  E-value=0.018  Score=35.01  Aligned_cols=30  Identities=27%  Similarity=0.532  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      .+|-|++|=|+-||||||..+.++-.++-.
T Consensus        29 ~~GE~~~llGpSG~GKTTlLr~iaGL~~p~   58 (362)
T TIGR03258        29 EAGELLALIGKSGCGKTTLLRAIAGFVKAA   58 (362)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             999899999999745999999997776777


No 408
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.21  E-value=0.017  Score=35.09  Aligned_cols=29  Identities=24%  Similarity=0.587  Sum_probs=24.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             98886899867888797999999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.+|-+++|=|.-||||||..+.++..++
T Consensus        47 i~~GE~~~ivG~SGsGKSTLLr~i~GL~~   75 (269)
T cd03294          47 VREGEIFVIMGLSGSGKSTLLRCINRLIE   75 (269)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             88999999998998489999999975999


No 409
>PRK13230 nitrogenase reductase-like protein; Reviewed
Probab=95.21  E-value=0.043  Score=32.78  Aligned_cols=38  Identities=34%  Similarity=0.512  Sum_probs=34.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CC
Q ss_conf             988868998678887979999999999997798199987-78
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EP   41 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP   41 (225)
                      |++   |+|=|=-|.||||-+-.|+..|.+.|.+|..+. .|
T Consensus         1 m~~---ia~yGKGGVGKTTTavNLAaALA~~GkkVLlID~DP   39 (292)
T PRK13230          1 MKQ---IAFYGKGGIGKSTTVCNLAAALSKSGKKVIVVGCDP   39 (292)
T ss_pred             CCE---EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             967---999179985789899999999998799599977679


No 410
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=95.21  E-value=0.019  Score=34.83  Aligned_cols=25  Identities=28%  Similarity=0.454  Sum_probs=21.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      .+|-.++|-|+-||||||..+-|..
T Consensus        26 ~~Gevv~iiGpSGSGKSTlLRclN~   50 (240)
T COG1126          26 EKGEVVVIIGPSGSGKSTLLRCLNG   50 (240)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             3897899989999988899999977


No 411
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=95.20  E-value=0.041  Score=32.91  Aligned_cols=37  Identities=24%  Similarity=0.294  Sum_probs=28.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             6899867888797999999999999779819998778
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      =+|.|.|+.||||||-...+-+.+...+.+++.+-.|
T Consensus        81 GlilitGptGSGKtTtl~a~l~~~~~~~~~i~tiEdP  117 (264)
T cd01129          81 GIILVTGPTGSGKTTTLYSALSELNTPEKNIITVEDP  117 (264)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             8899978999977999999998643688508998676


No 412
>KOG2004 consensus
Probab=95.20  E-value=0.035  Score=33.26  Aligned_cols=28  Identities=36%  Similarity=0.559  Sum_probs=26.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             8868998678887979999999999997
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      +|++++|-|+.|.|||..++.+++.|..
T Consensus       437 qGkIlCf~GPPGVGKTSI~kSIA~ALnR  464 (906)
T KOG2004         437 QGKILCFVGPPGVGKTSIAKSIARALNR  464 (906)
T ss_pred             CCCEEEEECCCCCCCCCHHHHHHHHHCC
T ss_conf             8837998689987732189999998487


No 413
>PRK07952 DNA replication protein DnaC; Validated
Probab=95.18  E-value=0.036  Score=33.20  Aligned_cols=35  Identities=20%  Similarity=0.241  Sum_probs=31.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             99867888797999999999999779819998778
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      +.|-|..|+|||.++..+++.|-++|++|+++..|
T Consensus        99 LlF~G~~GTGKThLA~aIan~Li~~G~sVlf~t~~  133 (242)
T PRK07952         99 FIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVA  133 (242)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             79978999978999999999999879949997799


No 414
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=95.18  E-value=0.023  Score=34.42  Aligned_cols=35  Identities=29%  Similarity=0.371  Sum_probs=27.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             88868998678887979999999999997798199
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      ++|-++++=|+.||||||..+.+...+....=.+.
T Consensus        29 ~~Gei~gllG~NGaGKSTllk~i~Gl~~p~~G~i~   63 (218)
T cd03266          29 KPGEVTGLLGPNGAGKTTTLRMLAGLLEPDAGFAT   63 (218)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEE
T ss_conf             59829999999998499999999779778974899


No 415
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=95.16  E-value=0.056  Score=32.07  Aligned_cols=38  Identities=18%  Similarity=0.010  Sum_probs=29.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHH-HHHHHHHCCCCEEEEE
Q ss_conf             8886899867888797999999-9999997798199987
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISL-LKRFLQRKNYDVHVTR   39 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~-L~~~L~~~g~~v~~~~   39 (225)
                      -+|-.+.|.|..||||||.+-. +.+.+.+.|.+++.+.
T Consensus        17 ~~gs~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis   55 (231)
T pfam06745        17 PEGRVVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVT   55 (231)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             299699998589725999999999999986589689998


No 416
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. PRK catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=95.16  E-value=0.068  Score=31.58  Aligned_cols=87  Identities=25%  Similarity=0.301  Sum_probs=49.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-------CCHHHHCCCCC-CCCCCHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981999877889844-------10011001244-45410134567778899999
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-------AEAARHVLLSC-GVDEFGAEAEAIVFAAARLD   77 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~-------ge~ir~~l~~~-~~~~~~~~~~~lLfaadr~~   77 (225)
                      +|++.|=-||||||..+.+.+-|...+.+..++.  |+.-+       .+.+++....+ ....+.|.       |+.++
T Consensus         1 IIaVtGsSGAGtsTv~r~f~~IF~re~v~a~vIe--gD~fHryDR~emk~~~~~a~~~g~~~ShfgPe-------AN~fd   71 (277)
T cd02029           1 VIAVTGSSGAGTTTVKRAFEHIFAREGIHPAVVE--GDSFHRYERMEMKMAIAEALDAGRNFSHFGPE-------ANLFD   71 (277)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC-------CCCHH
T ss_conf             9899338888478799999998720588528996--78665467899999999998647876667844-------44799


Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             7763565542345258723542431
Q gi|254780218|r   78 HVENVIRPALMEGKILLCDRFLDSS  102 (225)
Q Consensus        78 ~~~~~I~p~L~~g~iVI~DRy~~S~  102 (225)
                      .+++..+ ++.++..+-.=.|.+++
T Consensus        72 ~Le~~f~-~y~e~g~g~kr~Y~H~~   95 (277)
T cd02029          72 LLEELFR-TYGETGRGRSRYYLHSD   95 (277)
T ss_pred             HHHHHHH-HHHCCCCCCCCEEECCC
T ss_conf             9999999-98668987642430582


No 417
>pfam00931 NB-ARC NB-ARC domain.
Probab=95.15  E-value=0.11  Score=30.42  Aligned_cols=35  Identities=23%  Similarity=0.226  Sum_probs=24.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHH-HCCCC-EEEEE
Q ss_conf             6899867888797999999999999-77981-99987
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQ-RKNYD-VHVTR   39 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~-~~g~~-v~~~~   39 (225)
                      ..|+|-|+-|+||||.++.+.+..+ ...++ ++.+.
T Consensus        20 ~vI~I~G~gGiGKTtLA~~v~~~~~i~~~F~~~~wv~   56 (285)
T pfam00931        20 GVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVV   56 (285)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCHHHHHCCCEEEEEE
T ss_conf             3999889995639999999971655650598389999


No 418
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=95.15  E-value=0.021  Score=34.58  Aligned_cols=28  Identities=32%  Similarity=0.392  Sum_probs=23.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|..||||||..+.|+-.+.
T Consensus        27 ~~Ge~~~LvG~NGaGKSTL~k~l~G~l~   54 (490)
T PRK10938         27 NAGDSWAFVGSNGSGKSALARALAGELP   54 (490)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999997999779999999956998


No 419
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=95.14  E-value=0.066  Score=31.65  Aligned_cols=39  Identities=15%  Similarity=0.181  Sum_probs=32.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH-HHCCCCEEEEE
Q ss_conf             9888689986788879799999999999-97798199987
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFL-QRKNYDVHVTR   39 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L-~~~g~~v~~~~   39 (225)
                      |.+|-+++|-|..|+||||.+..++-.+ ...|.+|.++.
T Consensus        10 ~~~G~L~vi~a~~g~GKS~~~~~la~~~a~~~g~~V~~~S   49 (242)
T cd00984          10 LQPGDLIIIAARPSMGKTAFALNIAENIAKKQGKPVLFFS   49 (242)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9998189999689999999999999999997799599993


No 420
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.14  E-value=0.027  Score=33.98  Aligned_cols=36  Identities=28%  Similarity=0.410  Sum_probs=28.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             888689986788879799999999999977981999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      ++|-++++=|+.||||||..+.+...++.-.=.+.+
T Consensus        24 ~~Gei~gllG~NGaGKTTll~~i~Gl~~p~~G~i~i   59 (210)
T cd03269          24 EKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLF   59 (210)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEE
T ss_conf             799599999899984999999996002668998999


No 421
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701    Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se ..
Probab=95.13  E-value=0.02  Score=34.74  Aligned_cols=31  Identities=32%  Similarity=0.545  Sum_probs=25.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH-HHHHCC
Q ss_conf             8886899867888797999999999-999779
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR-FLQRKN   32 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~-~L~~~g   32 (225)
                      +.|=++++-|.-||||||..+.|+. +|-+.|
T Consensus        32 ~aGEcv~L~G~SGaGKSTlLk~lYaNYlp~~G   63 (224)
T TIGR02324        32 NAGECVALSGPSGAGKSTLLKSLYANYLPDSG   63 (224)
T ss_pred             ECCCEEEEECCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             36735885368887678999976630474686


No 422
>KOG1805 consensus
Probab=95.12  E-value=0.031  Score=33.60  Aligned_cols=36  Identities=36%  Similarity=0.446  Sum_probs=32.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             899867888797999999999999779819998778
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      +--|.|+.|+||||.+..|.+.|-..|.+|..+.+-
T Consensus       687 y~LI~GMPGTGKTTtI~~LIkiL~~~gkkVLLtsyT  722 (1100)
T KOG1805         687 YALILGMPGTGKTTTISLLIKILVALGKKVLLTSYT  722 (1100)
T ss_pred             HHEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             220326998981225999999999738818998505


No 423
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=95.11  E-value=0.021  Score=34.55  Aligned_cols=27  Identities=33%  Similarity=0.541  Sum_probs=23.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-++++-|..||||||.++.|...+
T Consensus        29 ~~Ge~~~lvG~nGsGKSTL~~~l~Gl~   55 (513)
T PRK13549         29 RAGEIVSLCGENGAGKSTLMKVLSGVY   55 (513)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899799998999972999999995678


No 424
>TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division.
Probab=95.10  E-value=0.019  Score=34.85  Aligned_cols=28  Identities=43%  Similarity=0.580  Sum_probs=25.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .||=|+=+.|.-||||||+-++|+..+.
T Consensus        26 ~kG~F~FLtG~SGAGKttLLKLl~~~~~   53 (215)
T TIGR02673        26 RKGEFLFLTGPSGAGKTTLLKLLYGALT   53 (215)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             2774078872778617899999985269


No 425
>pfam05729 NACHT NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.
Probab=95.10  E-value=0.028  Score=33.89  Aligned_cols=25  Identities=28%  Similarity=0.430  Sum_probs=21.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             8998678887979999999999997
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      -|+++|..|+||||.++.++..+.+
T Consensus         2 ~i~i~G~aG~GKTtll~kl~~~wa~   26 (165)
T pfam05729         2 TVILQGEAGSGKTTLLQKLALLWAQ   26 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             8999827989899999999999986


No 426
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=95.10  E-value=0.025  Score=34.14  Aligned_cols=28  Identities=39%  Similarity=0.597  Sum_probs=24.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|+.||||||..+.|.-.+.
T Consensus        24 ~~Gei~gliG~nGaGKSTL~~~i~Gl~~   51 (236)
T cd03219          24 RPGEIHGLIGPNGAGKTTLFNLISGFLR   51 (236)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             8998999998999739999999967987


No 427
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=95.09  E-value=0.042  Score=32.79  Aligned_cols=36  Identities=17%  Similarity=0.497  Sum_probs=26.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEEECC
Q ss_conf             899867888797999999999999779-819998778
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKN-YDVHVTREP   41 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g-~~v~~~~eP   41 (225)
                      +|.|.|.-||||||....+.+++.... ..++.+-.|
T Consensus         3 liLitG~TGSGKTTtl~all~~i~~~~~~~IiTiEDP   39 (198)
T cd01131           3 LVLVTGPTGSGKSTTLAAMIDYINKNKTHHILTIEDP   39 (198)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             8999899999799999999985363788369996473


No 428
>PRK08181 transposase; Validated
Probab=95.09  E-value=0.14  Score=29.75  Aligned_cols=40  Identities=23%  Similarity=0.278  Sum_probs=33.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             8886899867888797999999999999779819998778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      .++.=|+|-|+.|+|||-.+..|....-.+|++|.+++-+
T Consensus       104 ~~~~Nvil~Gp~GtGKThLA~Alg~~A~~~G~~V~f~~~~  143 (269)
T PRK08181        104 AKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTT  143 (269)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             6487089989999878899999999999879939997899


No 429
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=95.08  E-value=0.2  Score=28.80  Aligned_cols=26  Identities=23%  Similarity=0.257  Sum_probs=22.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99867888797999999999999779
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
                      .-|.|++|+||+|.+..+++.|-+.+
T Consensus        29 yLF~Gp~G~GK~~~A~~fa~~Ll~~~   54 (314)
T PRK07399         29 YLFAGPEGVGRKLAALRFIEGLLSQG   54 (314)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             87789998329999999999985789


No 430
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=95.08  E-value=0.024  Score=34.31  Aligned_cols=28  Identities=29%  Similarity=0.409  Sum_probs=24.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++=|+.||||||..+.+.-.++
T Consensus        26 ~~Gei~~liGpNGaGKSTLl~~i~Gl~~   53 (242)
T TIGR03411        26 DPGELRVIIGPNGAGKTTMMDVITGKTR   53 (242)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             8998999998999759999999967957


No 431
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345   These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. .
Probab=95.08  E-value=0.039  Score=32.98  Aligned_cols=46  Identities=22%  Similarity=0.343  Sum_probs=33.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCC-------------CCEEEEECCCCCCCCCHHHHC
Q ss_conf             886899867888797999999999999779-------------819998778898441001100
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKN-------------YDVHVTREPGGTPAAEAARHV   53 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g-------------~~v~~~~eP~~t~~ge~ir~~   53 (225)
                      .-++.++.|.+|.||||.++.+.+...+-+             ++|+.. =|    .|...|++
T Consensus       364 ~~Kv~iLTGGPGTGKtT~t~~i~~~~~~~~gl~l~~~~~vndd~~v~La-AP----TGrAAkRl  422 (769)
T TIGR01448       364 QDKVVILTGGPGTGKTTITKAIIELYEELKGLDLDKDDYVNDDLPVVLA-AP----TGRAAKRL  422 (769)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEE-CC----CHHHHHHC
T ss_conf             0948998577888616899999999987168775531245677648873-77----43788851


No 432
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=95.08  E-value=0.058  Score=31.98  Aligned_cols=34  Identities=18%  Similarity=0.182  Sum_probs=29.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8868998678887979999999999997798199987
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      +|-+++|-|+.|.|||+.++.+++.|   |.+.+.++
T Consensus       348 kg~IlclvGpPGvGKTSl~~sIA~al---~r~f~ris  381 (784)
T PRK10787        348 KGPILCLVGPPGVGKTSLGQSIAKAT---GRKYVRMA  381 (784)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEE
T ss_conf             78779964699877246999999985---89869980


No 433
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=95.08  E-value=0.023  Score=34.34  Aligned_cols=36  Identities=31%  Similarity=0.489  Sum_probs=27.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             888689986788879799999999999977981999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV   37 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~   37 (225)
                      .+|.+.++=|+.||||||..+.|...++.-.=.+.+
T Consensus        29 ~~Gei~gllG~NGAGKTTllk~l~Gl~~p~~G~i~i   64 (293)
T COG1131          29 EPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILV   64 (293)
T ss_pred             ECCEEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEE
T ss_conf             289599998999998999999996797788649999


No 434
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism]
Probab=95.06  E-value=0.054  Score=32.15  Aligned_cols=38  Identities=29%  Similarity=0.428  Sum_probs=32.2

Q ss_pred             CCCCCEEEEECCC-CCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9888689986788-8797999999999999779819998778
Q gi|254780218|r    1 MNSGLFISFEGIE-GAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         1 M~~g~~I~iEGiD-GsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      |.+  -|.|.|.| |.|||+.+..|++.|+++|+++...+ |
T Consensus         1 m~~--~~fVtGTDT~VGKTv~S~aL~~~l~~~g~~~~~~K-P   39 (223)
T COG0132           1 MMK--RFFVTGTDTGVGKTVVSAALAQALKQQGYSVAGYK-P   39 (223)
T ss_pred             CCC--EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-C
T ss_conf             973--69998279996499999999999996897059877-5


No 435
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=95.03  E-value=0.024  Score=34.30  Aligned_cols=34  Identities=29%  Similarity=0.460  Sum_probs=27.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             8886899867888797999999999999779819
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      .+|.+++|-|..||||||+.+.|.-.+....-.+
T Consensus        28 ~~Ge~~~i~G~nGsGKSTL~~~l~GLl~p~~G~v   61 (235)
T COG1122          28 EKGERVLLIGPNGSGKSTLLKLLNGLLKPTSGEV   61 (235)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCEE
T ss_conf             7898999988999889999999537676889848


No 436
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=95.03  E-value=0.025  Score=34.12  Aligned_cols=28  Identities=29%  Similarity=0.399  Sum_probs=24.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-.|+|-|..||||||..+.|...++
T Consensus       348 ~~Ge~iaivG~NGsGKSTLlk~l~G~~~  375 (556)
T PRK11819        348 PPGGIVGIIGPNGAGKSTLFKMITGQEQ  375 (556)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             7882478988987758899999838656


No 437
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=95.03  E-value=0.021  Score=34.62  Aligned_cols=31  Identities=35%  Similarity=0.445  Sum_probs=26.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9888689986788879799999999999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      ..+|-.|+|-|..||||||..+.|...++..
T Consensus       342 i~~Ge~ialvG~NGsGKSTLlk~l~G~l~p~  372 (632)
T PRK11147        342 VQRGDKIALIGPNGCGKTTLLKLMLGQLQAD  372 (632)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             5788779998898842779999860666899


No 438
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=95.02  E-value=0.056  Score=32.08  Aligned_cols=24  Identities=33%  Similarity=0.393  Sum_probs=21.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             998678887979999999999997
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      |.++|+.|+||||.++.+++.+..
T Consensus         2 VLL~GppG~GKT~l~~~lA~~~~~   25 (131)
T pfam07726         2 VLLEGVPGLAKTLLARTLARSLGL   25 (131)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             878989987699999999999599


No 439
>PRK13409 putative ATPase RIL; Provisional
Probab=95.02  E-value=0.023  Score=34.38  Aligned_cols=28  Identities=29%  Similarity=0.413  Sum_probs=23.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.|..+-+=|.+|+||||..+.|+-.|+
T Consensus        97 ~~G~v~GLiG~NGaGKST~lkILsG~l~  124 (590)
T PRK13409         97 KEGKVTGILGPNGIGKSTAVKILSGELI  124 (590)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             9987899889999989999999958714


No 440
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670   This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane.
Probab=95.01  E-value=0.023  Score=34.37  Aligned_cols=26  Identities=27%  Similarity=0.420  Sum_probs=22.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88868998678887979999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      .++..-||=|+-||||||..+.|-+.
T Consensus        25 ~~n~vTAlIGPSGCGKSTlLR~lNRM   50 (248)
T TIGR00972        25 PKNQVTALIGPSGCGKSTLLRSLNRM   50 (248)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             37705898778898678999998877


No 441
>pfam02367 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This uncharacterized family contains a P-loop.
Probab=94.98  E-value=0.031  Score=33.62  Aligned_cols=28  Identities=36%  Similarity=0.407  Sum_probs=25.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.|.+|.+.|-=||||||.++.+.+.|.
T Consensus        13 ~~G~vi~L~G~LGaGKTtfvr~i~~~lg   40 (123)
T pfam02367        13 KAGDVVLLSGDLGAGKTTFVRGLAKGLG   40 (123)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             9997999988877889999999999859


No 442
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.96  E-value=0.025  Score=34.12  Aligned_cols=26  Identities=23%  Similarity=0.295  Sum_probs=23.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .|-|++|=|+-||||||..+.++-..
T Consensus        22 ~ge~~~iiGpSGsGKSTll~~i~GL~   47 (214)
T cd03297          22 NEEVTGIFGASGAGKSTLLRCIAGLE   47 (214)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             99799999999735999999998499


No 443
>PRK13232 nifH nitrogenase reductase; Reviewed
Probab=94.96  E-value=0.055  Score=32.12  Aligned_cols=39  Identities=26%  Similarity=0.353  Sum_probs=34.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCC
Q ss_conf             98886899867888797999999999999779819998-7788
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPG   42 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP~   42 (225)
                      |++   |+|=|=-|.||||-+..|+..|.+.|++|..+ .-|.
T Consensus         1 ~~~---iaiyGKGGVGKSTTt~NLaAALA~~GkkVL~IgcDPk   40 (273)
T PRK13232          1 MRQ---IAIYGKGGIGKSTTTQNLTAALSTMGNKILLVGCDPK   40 (273)
T ss_pred             CCE---EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             957---9997998665887899999999977996999897884


No 444
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=94.96  E-value=0.031  Score=33.60  Aligned_cols=20  Identities=20%  Similarity=0.489  Sum_probs=18.4

Q ss_pred             CCCCEEEEECCCCCCHHHHH
Q ss_conf             88868998678887979999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHI   21 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~   21 (225)
                      -+++|+||.|+-|||||+++
T Consensus        24 P~~klvViTGvSGSGKSSLA   43 (944)
T PRK00349         24 PRDKLVVITGLSGSGKSSLA   43 (944)
T ss_pred             CCCCEEEEECCCCCCHHHHH
T ss_conf             79988999889888689999


No 445
>PRK06526 transposase; Provisional
Probab=94.95  E-value=0.14  Score=29.76  Aligned_cols=40  Identities=20%  Similarity=0.077  Sum_probs=33.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             8886899867888797999999999999779819998778
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP   41 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP   41 (225)
                      ++|-=|+|-|+.|+|||-.+..|....-.+|++|.+++-|
T Consensus        96 ~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~~~  135 (254)
T PRK06526         96 TGKENVVFLGPPGTGKTHLAIGLGIRACQAGHRVLFATAA  135 (254)
T ss_pred             HCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHH
T ss_conf             6588789989999868999999999999869967998779


No 446
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Probab=94.94  E-value=0.023  Score=34.33  Aligned_cols=27  Identities=33%  Similarity=0.668  Sum_probs=23.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             988868998678887979999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      |..|-+.||=|+.||||||+++.+-..
T Consensus        51 v~~GeIfViMGLSGSGKSTLvR~~NrL   77 (386)
T COG4175          51 VEEGEIFVIMGLSGSGKSTLVRLLNRL   77 (386)
T ss_pred             ECCCEEEEEEECCCCCHHHHHHHHHCC
T ss_conf             458708999935878788999997356


No 447
>KOG0065 consensus
Probab=94.94  E-value=0.039  Score=33.02  Aligned_cols=125  Identities=26%  Similarity=0.334  Sum_probs=60.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC---CEEEEECCCC-CCCCCHHHHCCCCCCCCCCHHH---HHHHHHHHH
Q ss_conf             88868998678887979999999999997798---1999877889-8441001100124445410134---567778899
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNY---DVHVTREPGG-TPAAEAARHVLLSCGVDEFGAE---AEAIVFAAA   74 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~---~v~~~~eP~~-t~~ge~ir~~l~~~~~~~~~~~---~~~lLfaad   74 (225)
                      +.|++=++=|.-||||||+.+-|+++.. .|+   ++.+.-.|-+ ..+...+ ...  ...+--.|.   -|.|-|+|.
T Consensus       815 kPG~LTALMG~SGAGKTTLLdvLA~R~t-~G~I~Gdi~i~G~p~~q~tF~R~~-GYv--qQ~DiH~~~~TVrESL~fSA~  890 (1391)
T KOG0065         815 KPGVLTALMGESGAGKTTLLDVLAGRKT-GGYIEGDILISGFPKDQETFARVS-GYV--EQQDIHSPELTVRESLRFSAA  890 (1391)
T ss_pred             CCCCEEEHHCCCCCCHHHHHHHHHCCCC-CCEEEEEEEECCEECCHHHHCCCC-CEE--ECCCCCCCCCCHHHHHHHHHH
T ss_conf             4783640124778765779999856744-656875789888327366512310-114--225656754041989999999


Q ss_pred             H-----------HHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCC-CCCCCEEEEEEECH
Q ss_conf             9-----------997763565542345258723542431000100344424577654442038-89841156652034
Q gi|254780218|r   75 R-----------LDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQ-EVMPDCTIILDLPV  140 (225)
Q Consensus        75 r-----------~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~-~~~PDl~i~Ldv~~  140 (225)
                      -           .+.+++||+ .|+      ++-|-.+-..-  .+.|+..+.-+.+. +... --+|++.+|||=|.
T Consensus       891 LRlp~~v~~~ek~~yVe~Vi~-lle------L~~~~daiVG~--~G~GLs~eQRKrLT-IgVELvA~P~~ilFLDEPT  958 (1391)
T KOG0065         891 LRLPKEVSDEEKYEYVEEVIE-LLE------LKEYADALVGL--PGSGLSTEQRKRLT-IGVELVANPSSILFLDEPT  958 (1391)
T ss_pred             HCCCCCCCHHHHHHHHHHHHH-HHC------CHHHHHHHCCC--CCCCCCHHHHCEEE-EEEEEECCCCEEEEECCCC
T ss_conf             718776997899999999999-837------62566555068--88888977832356-8999832875568856998


No 448
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=94.94  E-value=0.018  Score=34.97  Aligned_cols=21  Identities=19%  Similarity=0.515  Sum_probs=18.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHH
Q ss_conf             988868998678887979999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHI   21 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~   21 (225)
                      +++|-+++|-|..||||||++
T Consensus        18 i~~Ge~~aIvG~nGsGKSTL~   38 (226)
T cd03270          18 IPRNKLVVITGVSGSGKSSLA   38 (226)
T ss_pred             ECCCCEEEEECCCCCHHHHHH
T ss_conf             859989999878996098983


No 449
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=94.93  E-value=0.024  Score=34.26  Aligned_cols=27  Identities=30%  Similarity=0.548  Sum_probs=23.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-|+++=|+-||||||..+.++-..
T Consensus        28 ~~Ge~~~llGpSG~GKtTlLr~iaGl~   54 (353)
T TIGR03265        28 KKGEFVCLLGPSGCGKTTLLRIIAGLE   54 (353)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899999999999535999999997699


No 450
>PRK00635 excinuclease ABC subunit A; Provisional
Probab=94.92  E-value=0.034  Score=33.34  Aligned_cols=19  Identities=16%  Similarity=0.359  Sum_probs=16.4

Q ss_pred             CCCEEEEECCCCCCHHHHH
Q ss_conf             8868998678887979999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHI   21 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~   21 (225)
                      |++|+||.|+-|||||+++
T Consensus       960 rnkLvViTGvSGSGKSSLA  978 (1809)
T PRK00635        960 RNALTAITGPSASGKHSLV  978 (1809)
T ss_pred             CCCEEEEECCCCCCHHHHH
T ss_conf             9866999789888689999


No 451
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=94.91  E-value=0.022  Score=34.50  Aligned_cols=28  Identities=39%  Similarity=0.621  Sum_probs=22.6

Q ss_pred             CCCEEEEECCCCCCHHHHH-HHHHHHHHH
Q ss_conf             8868998678887979999-999999997
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHI-SLLKRFLQR   30 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~-~~L~~~L~~   30 (225)
                      .|.|+|+.|+-||||||++ ..|+..+..
T Consensus       634 lg~lt~VtGvSGSGKStLi~~~l~~~~~~  662 (944)
T PRK00349        634 LGKFTCVTGVSGSGKSTLINETLYKALAR  662 (944)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             89668996147886379999999999999


No 452
>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=94.91  E-value=0.069  Score=31.52  Aligned_cols=39  Identities=18%  Similarity=0.169  Sum_probs=32.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH-HHCCCCEEEEE
Q ss_conf             9888689986788879799999999999-97798199987
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFL-QRKNYDVHVTR   39 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L-~~~g~~v~~~~   39 (225)
                      |.+|-+++|-|..|+||||.+-.++..+ .+.|.+|.++.
T Consensus        16 l~~G~l~vi~g~pg~GKS~~~~~~a~~~a~~~g~~Vl~~s   55 (186)
T pfam03796        16 LQKGDLIIIAARPSMGKTAFALNIARNAALKQDKPVLFFS   55 (186)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             8888179999679998799999999999997099668754


No 453
>PRK04195 replication factor C large subunit; Provisional
Probab=94.90  E-value=0.051  Score=32.29  Aligned_cols=46  Identities=17%  Similarity=0.188  Sum_probs=32.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCC
Q ss_conf             68998678887979999999999997798199987788984410011001
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVL   54 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l   54 (225)
                      +.+.|-|+.|+||||.+..|++.+   |++++-.. ..+....+.|++++
T Consensus        41 k~lLL~GPpGvGKTT~a~~lAk~~---g~~viElN-ASD~R~~~~I~~~i   86 (403)
T PRK04195         41 KALLLYGPPGVGKTSLAHALANDY---GWEVIELN-ASDQRTKDVIERVA   86 (403)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEC-CCCCCCHHHHHHHH
T ss_conf             469988939987999999999984---99859977-10114789999999


No 454
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=94.89  E-value=0.25  Score=28.24  Aligned_cols=26  Identities=38%  Similarity=0.420  Sum_probs=23.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99867888797999999999999779
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKN   32 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g   32 (225)
                      +-|.|++|+||||.+..|++.|...+
T Consensus        27 lL~~Gp~G~Gktt~a~~lA~~l~~~~   52 (325)
T COG0470          27 LLFYGPPGVGKTTAALALAKELLCEN   52 (325)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             00379999978999999999965866


No 455
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional
Probab=94.89  E-value=0.03  Score=33.72  Aligned_cols=27  Identities=26%  Similarity=0.481  Sum_probs=23.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .+|-++++-|..||||||..+.|.-..
T Consensus        32 ~~Ge~v~i~G~nGsGKSTll~~l~gl~   58 (648)
T PRK10535         32 YAGEMVAIVGASGSGKSTLMNILGCLD   58 (648)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899899999999962999999995699


No 456
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=94.88  E-value=0.19  Score=28.90  Aligned_cols=110  Identities=16%  Similarity=0.212  Sum_probs=56.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH--HHHHCCCCEEEEECCCCCCCCCHHHHCCCC-CCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999--999779819998778898441001100124-4454101345677788999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR--FLQRKNYDVHVTREPGGTPAAEAARHVLLS-CGVDEFGAEAEAIVFAAARLDH   78 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~--~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~-~~~~~~~~~~~~lLfaadr~~~   78 (225)
                      ..+.++++.|+..|||||..+.+.-  .|.+.|..|     |.....-.....++.+ ...+.+  ....-.|+++- ..
T Consensus        27 ~~~~~~iiTGpN~sGKSt~lkti~l~~~laq~G~~v-----pa~~~~~~~~~~i~~~~~~~d~~--~~~~S~F~~e~-~~   98 (202)
T cd03243          27 GSGRLLLITGPNMGGKSTYLRSIGLAVLLAQIGCFV-----PAESASIPLVDRIFTRIGAEDSI--SDGRSTFMAEL-LE   98 (202)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEE-----EECCCEEECCCEEEEEECCCHHH--HCCCCHHHHHH-HH
T ss_conf             798289998998875399999999999999838737-----20446894466699984660244--43535499999-99


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHH
Q ss_conf             76356554234525872354243100010034442457765444
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE  122 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~  122 (225)
                      ++.++. ...+...|++|=..-+|-...|.  .+....++++.+
T Consensus        99 ~~~i~~-~~~~~slvliDE~~~gT~~~eg~--~la~a~l~~l~~  139 (202)
T cd03243          99 LKEILS-LATPRSLVLIDELGRGTSTAEGL--AIAYAVLEHLLE  139 (202)
T ss_pred             HHHHHH-HCCCCCEEEECCCCCCCCHHHHH--HHHHHHHHHHHH
T ss_conf             999998-67777724205234799867879--999999999985


No 457
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=94.88  E-value=0.026  Score=34.02  Aligned_cols=36  Identities=25%  Similarity=0.296  Sum_probs=27.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             8886899867888797999999999999779819998
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      +.++=|+|.|.-||||||..+.|.+++... ..++++
T Consensus        23 ~~~~nIlIsG~tGSGKTTll~al~~~i~~~-~rivti   58 (186)
T cd01130          23 EARKNILISGGTGSGKTTLLNALLAFIPPD-ERIITI   58 (186)
T ss_pred             HCCCCEEEECCCCCCHHHHHHHHHHHCCCC-CCEEEE
T ss_conf             859989998999998999999999613345-645984


No 458
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=94.84  E-value=0.026  Score=34.07  Aligned_cols=28  Identities=43%  Similarity=0.474  Sum_probs=24.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-.|+|-|..||||||..+.|...++
T Consensus       336 ~~GeriaIvG~NGsGKSTLlk~L~G~l~  363 (638)
T PRK10636        336 VPGSRIGLLGRNGAGKSTLIKLLAGELA  363 (638)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHCCCCC
T ss_conf             3784799974787138899999728878


No 459
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=94.84  E-value=0.031  Score=33.59  Aligned_cols=28  Identities=29%  Similarity=0.494  Sum_probs=22.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-++++-|..||||||+++.|.-.+.
T Consensus        28 ~~Gei~~liG~nGaGKSTL~~~l~G~~~   55 (501)
T PRK10762         28 YPGRVMALVGENGAGKSTLMKVLTGIYT   55 (501)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8996999989999829999999957998


No 460
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=94.83  E-value=0.029  Score=33.80  Aligned_cols=34  Identities=29%  Similarity=0.568  Sum_probs=27.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             8886899867888797999999999999779819
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV   35 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v   35 (225)
                      ++|-++.+=|+.||||||.++.+...+.--.=.+
T Consensus        26 ~~Gei~gllGpNGAGKTTl~~~l~Gl~~p~~G~i   59 (301)
T TIGR03522        26 QKGRIVGFLGPNGAGKSTTMKIITGYLPPDSGSV   59 (301)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEE
T ss_conf             5981999999999819999999967956897779


No 461
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=94.82  E-value=0.022  Score=34.44  Aligned_cols=64  Identities=16%  Similarity=0.311  Sum_probs=36.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---C-CCCCCCHHHHCCCCCCCCCCHHHH
Q ss_conf             8886899867888797999999999999779819998778---8-984410011001244454101345
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP---G-GTPAAEAARHVLLSCGVDEFGAEA   66 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP---~-~t~~ge~ir~~l~~~~~~~~~~~~   66 (225)
                      .+|--++|-|-.||||||++++|+-...--+-...+-.+|   + ...-++.||-++-++. ..++|+.
T Consensus        37 ~~~QTlaiIG~NGSGKSTLakMlaGmi~PTsG~il~n~~~L~~~Dy~~R~k~IRMiFQDpn-ts~NPRl  104 (267)
T COG4167          37 REGQTLAIIGENGSGKSTLAKMLAGMIEPTSGEILINDHPLHFGDYSFRSKRIRMIFQDPN-TSLNPRL  104 (267)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHHHHHEEEEECCCC-CCCCCHH
T ss_conf             0796799982699747589999835558988548788841312346766444434541886-5568022


No 462
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=94.82  E-value=0.035  Score=33.32  Aligned_cols=25  Identities=40%  Similarity=0.646  Sum_probs=17.8

Q ss_pred             CCEEEEECCCCCCHHHHHHH-HHHHH
Q ss_conf             86899867888797999999-99999
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISL-LKRFL   28 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~-L~~~L   28 (225)
                      |.|+++.|.-||||||+++. |...+
T Consensus       627 g~~t~VTGVSGSGKSTLIn~tL~~a~  652 (935)
T COG0178         627 GVFTCVTGVSGSGKSTLINDTLVPAL  652 (935)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             63799983687877786999999999


No 463
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=94.76  E-value=0.069  Score=31.53  Aligned_cols=34  Identities=26%  Similarity=0.270  Sum_probs=31.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8998678887979999999999997798199987
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      -|+|-|=-|.||||-+-.|+..|.++|.+|.++.
T Consensus         3 ~Iai~GKGGVGKTTtavNLA~aLa~~GkkVlliD   36 (270)
T cd02040           3 QIAIYGKGGIGKSTTTQNLSAALAEMGKKVMIVG   36 (270)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             8999799857789999999999998799499986


No 464
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=94.75  E-value=0.03  Score=33.65  Aligned_cols=28  Identities=29%  Similarity=0.330  Sum_probs=23.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|-++++-|..||||||.++.|.-.+.
T Consensus        22 ~~Gei~~liG~nGsGKSTL~~~l~Gl~~   49 (491)
T PRK10982         22 RPHSIHALMGENGAGKSTLLKCLFGIYQ   49 (491)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             8996999989999819999999956988


No 465
>PRK00635 excinuclease ABC subunit A; Provisional
Probab=94.74  E-value=0.025  Score=34.14  Aligned_cols=19  Identities=21%  Similarity=0.496  Sum_probs=17.5

Q ss_pred             CCCEEEEECCCCCCHHHHH
Q ss_conf             8868998678887979999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHI   21 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~   21 (225)
                      |++|+||.|+-|||||+++
T Consensus        25 ~~~lvViTGvSGSGKSSLA   43 (1809)
T PRK00635         25 PREIVLLTGVSGSGKSSLA   43 (1809)
T ss_pred             CCCEEEEECCCCCCHHHHH
T ss_conf             9988999799889789999


No 466
>KOG0055 consensus
Probab=94.73  E-value=0.11  Score=30.36  Aligned_cols=28  Identities=43%  Similarity=0.736  Sum_probs=24.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9888689986788879799999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++.|.-+++=|+-||||||.+.+|.+..
T Consensus      1013 i~~GqTvALVG~SGsGKSTvI~LLeRfY 1040 (1228)
T KOG0055        1013 IRAGQTVALVGPSGSGKSTVISLLERFY 1040 (1228)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             5599889998899887998999999843


No 467
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=94.71  E-value=0.035  Score=33.31  Aligned_cols=28  Identities=32%  Similarity=0.567  Sum_probs=24.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9888689986788879799999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .++|-||+|=|..||||||+.+.|....
T Consensus        27 I~~GE~VaiIG~SGaGKSTLLR~lngl~   54 (258)
T COG3638          27 INQGEMVAIIGPSGAGKSTLLRSLNGLV   54 (258)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCC
T ss_conf             5798689998788886899999986665


No 468
>PRK00784 cobyric acid synthase; Provisional
Probab=94.70  E-value=0.36  Score=27.26  Aligned_cols=36  Identities=28%  Similarity=0.321  Sum_probs=27.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             988868998678887979999999999997798199
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH   36 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~   36 (225)
                      |....+.+.==--++||||.+..|.+.|...|++|.
T Consensus         1 ~~~k~lMv~GT~S~vGKS~l~aaLCRi~~~~G~~Va   36 (492)
T PRK00784          1 MMAKALMVQGTTSDAGKSTLVAGLCRILARRGLRVA   36 (492)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             986305888678887799999999999995898557


No 469
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.70  E-value=0.027  Score=33.96  Aligned_cols=27  Identities=30%  Similarity=0.464  Sum_probs=22.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             988868998678887979999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      +.+|-+++|=|.-||||||..+.+.-.
T Consensus        28 i~~Ge~~~ivG~SGsGKSTllr~i~gL   54 (233)
T cd03258          28 VPKGEIFGIIGRSGAGKSTLIRCINGL   54 (233)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             999999999889805899999999679


No 470
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=94.69  E-value=0.12  Score=30.19  Aligned_cols=41  Identities=29%  Similarity=0.406  Sum_probs=37.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             88868998678887979999999999997798199987788
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG   42 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~   42 (225)
                      +++++|++-|+.|+..|+-++.|.+++.++|+.+++..+=|
T Consensus        74 ~~P~vVl~HGL~G~s~s~y~r~L~~~~~~rg~~~Vv~~~Rg  114 (345)
T COG0429          74 KKPLVVLFHGLEGSSNSPYARGLMRALSRRGWLVVVFHFRG  114 (345)
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             78549999425788867899999999996688099986534


No 471
>TIGR01184 ntrCD nitrate ABC transporter, ATP-binding proteins C and D; InterPro: IPR005890   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase. ; GO: 0015112 nitrate transmembrane transporter activity, 0015706 nitrate transport, 0016020 membrane.
Probab=94.66  E-value=0.029  Score=33.80  Aligned_cols=27  Identities=37%  Similarity=0.673  Sum_probs=23.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             988868998678887979999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      .++|=||++=|=-||||||+.++++-.
T Consensus         8 i~~GEFisliGHSGCGKSTLLNli~Gl   34 (230)
T TIGR01184         8 IRQGEFISLIGHSGCGKSTLLNLISGL   34 (230)
T ss_pred             EECCCEEEEECCCCCCHHHHHHHHHHC
T ss_conf             526736998512786178999998500


No 472
>PRK08939 primosomal protein DnaI; Reviewed
Probab=94.66  E-value=0.055  Score=32.10  Aligned_cols=47  Identities=21%  Similarity=0.335  Sum_probs=37.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCC
Q ss_conf             8868998678887979999999999997798199987788984410011001
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVL   54 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l   54 (225)
                      ||.+  +.|.-|+|||-.+..++..|..+|++|++++.|+   +...++..+
T Consensus       158 kGly--l~G~~G~GKTyL~~aian~La~~g~~v~~v~~p~---~~~~lK~s~  204 (306)
T PRK08939        158 KGLY--LYGDFGVGKTYLLAAIANELAKKGVSSTLVHFPE---FIRELKNAI  204 (306)
T ss_pred             CEEE--EECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH---HHHHHHHHH
T ss_conf             7788--9899999899999999999998699299987599---999999986


No 473
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=94.66  E-value=0.031  Score=33.58  Aligned_cols=26  Identities=27%  Similarity=0.521  Sum_probs=23.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             88868998678887979999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      ++|-++++-|..||||||.++.|.-.
T Consensus        24 ~~Gei~~LvG~sGsGKSTL~~~l~Gl   49 (520)
T TIGR03269        24 EEGEVLGILGRSGAGKSVLMHVLRGM   49 (520)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             99989999999996999999999651


No 474
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=94.65  E-value=0.039  Score=32.99  Aligned_cols=26  Identities=23%  Similarity=0.424  Sum_probs=22.3

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             98886899867888797999999999
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      |..|.+.+|-|+.||||||..+.+.-
T Consensus        18 l~~g~~~iItGpN~sGKSt~Lr~i~l   43 (162)
T cd03227          18 FGEGSLTIITGPNGSGKSTILDAIGL   43 (162)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             08986899989987757999999999


No 475
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolysed for each amidation .; GO: 0003824 catalytic activity, 0009236 cobalamin biosynthetic process.
Probab=94.63  E-value=0.11  Score=30.38  Aligned_cols=40  Identities=13%  Similarity=0.214  Sum_probs=27.6

Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             002112889999999999999997899499981897889999
Q gi|254780218|r  160 DYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVA  201 (225)
Q Consensus       160 d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~  201 (225)
                      +++..+-.-+.++|+|+|..|++++.  +++|-+..|+.||+
T Consensus        99 ~Y~~~~~d~~~~~i~eSle~L~~~Yd--~vv~EGAGS~AEIN  138 (502)
T TIGR00313        99 EYYKNKVDFLLKAIKESLEILAEEYD--LVVIEGAGSPAEIN  138 (502)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCC--EEEEECCCCCCCCC
T ss_conf             67779999999999999987520288--89982688710005


No 476
>PRK10418 nikD nickel transporter ATP-binding protein; Provisional
Probab=94.63  E-value=0.032  Score=33.48  Aligned_cols=29  Identities=21%  Similarity=0.316  Sum_probs=25.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             88868998678887979999999999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQR   30 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~   30 (225)
                      ++|-+++|=|..||||||.++.+...+..
T Consensus        27 ~~Ge~~aiiG~SGsGKStl~k~llgll~~   55 (254)
T PRK10418         27 QRGRVLALVGGSGSGKSLTCAAALGILPA   55 (254)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             89999999999987899999999579988


No 477
>pfam02374 ArsA_ATPase Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.
Probab=94.63  E-value=0.088  Score=30.89  Aligned_cols=37  Identities=30%  Similarity=0.366  Sum_probs=32.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CC
Q ss_conf             68998678887979999999999997798199987-78
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EP   41 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP   41 (225)
                      ++|-|-|--|+||||.+..++-++.+.|++|.++. .|
T Consensus         2 r~i~~~GKGGVGKTT~AaA~A~~~A~~G~rvLlvStDP   39 (304)
T pfam02374         2 RWIFFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTDP   39 (304)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             19999579857489999999999995899299994697


No 478
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=94.62  E-value=0.034  Score=33.40  Aligned_cols=25  Identities=40%  Similarity=0.562  Sum_probs=22.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      ++|-.++|-|..||||||.++.|.-
T Consensus       284 ~~GE~~~i~G~nGsGKSTLl~~l~G  308 (490)
T PRK10938        284 NPGEHWQIVGPNGAGKSTLLSLITG  308 (490)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             3898899986788879999999808


No 479
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=94.62  E-value=0.024  Score=34.28  Aligned_cols=28  Identities=39%  Similarity=0.665  Sum_probs=25.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ++|..+++=|..||||||..+.|...+.
T Consensus       345 ~~g~~talvG~SGaGKSTLl~lL~G~~~  372 (559)
T COG4988         345 KAGQLTALVGASGAGKSTLLNLLLGFLA  372 (559)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             4896799988999978999999847577


No 480
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=94.58  E-value=0.038  Score=33.11  Aligned_cols=25  Identities=44%  Similarity=0.598  Sum_probs=19.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      +|-.=|.+-|+|||||||....|+.
T Consensus        15 ~ke~~ililGLd~aGKTTil~~lk~   39 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHMLKN   39 (184)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             6614799996588988999999806


No 481
>TIGR00955 3a01204 Pigment precourser permease; InterPro: IPR005284   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family includes different parts of a membrane-spanning permease system necessary for the transport of pigment precursor into pigment cells responsible for eye color. White protein dimerises with brown protein for the transport of guanine and with scarlet protein for the transport of tryptophan.; GO: 0006810 transport.
Probab=94.55  E-value=0.03  Score=33.68  Aligned_cols=47  Identities=30%  Similarity=0.410  Sum_probs=33.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCE----EEEECCCCCCCC-CHHHH
Q ss_conf             8886899867888797999999999999779819----998778898441-00110
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV----HVTREPGGTPAA-EAARH   52 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v----~~~~eP~~t~~g-e~ir~   52 (225)
                      +.|-++|+=|.-||||||+.+.|+.+-. .|..+    +.+   +|.+++ +.+|.
T Consensus        56 ~~GeLlA~mGsSGAGKTTLmn~La~R~~-~g~~~~g~~v~l---NG~~~~~~~~~~  107 (671)
T TIGR00955        56 KPGELLAIMGSSGAGKTTLMNALAFRSP-KGLKVSGSVVLL---NGRPIDAKEMRA  107 (671)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCC-CCCEECCCEEEE---CCEECCHHHHHH
T ss_conf             0670689847876626899999853374-786146836787---583758689985


No 482
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=94.54  E-value=0.038  Score=33.05  Aligned_cols=24  Identities=46%  Similarity=0.627  Sum_probs=19.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             888689986788879799999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLK   25 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~   25 (225)
                      +|-.=|++-|+|||||||....|.
T Consensus        17 ~k~~kIlilGld~aGKTTil~~l~   40 (190)
T cd00879          17 NKEAKILFLGLDNAGKTTLLHMLK   40 (190)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             770489999069998899999980


No 483
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.
Probab=94.53  E-value=0.073  Score=31.39  Aligned_cols=34  Identities=29%  Similarity=0.303  Sum_probs=30.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             8998678887979999999999997798199987
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      +|.|-|=-|+||||.+..|+-.|.++|++|.++.
T Consensus         1 i~~~sGKGGVGKTTvAaalA~~lA~~G~rvLlvs   34 (217)
T cd02035           1 VIFFTGKGGVGKTTIAAATAVRLAEEGKKVLLVS   34 (217)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9899789966199999999999996899499995


No 484
>cd02032 Bchl_like This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.
Probab=94.53  E-value=0.09  Score=30.83  Aligned_cols=35  Identities=26%  Similarity=0.295  Sum_probs=32.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             68998678887979999999999997798199987
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR   39 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~   39 (225)
                      |-|+|=|=-|.||||.+..|+..|.+.|++|..+-
T Consensus         1 ~kiaiyGKGGIGKSTttaNl~aaLA~~G~kVl~Ig   35 (267)
T cd02032           1 MVLAVYGKGGIGKSTTSSNLSVALAKRGKKVLQIG   35 (267)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             97999779965787789999999998799599977


No 485
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=94.51  E-value=0.03  Score=33.72  Aligned_cols=85  Identities=18%  Similarity=0.250  Sum_probs=43.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCC-CCHHHHHHHHHHHHHHH-HHHHHHH
Q ss_conf             998678887979999999999997798199987788984410011001244454-10134567778899999-7763565
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-EFGAEAEAIVFAAARLD-HVENVIR   84 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~-~~~~~~~~lLfaadr~~-~~~~~I~   84 (225)
                      -.|=|+.|+||||.++.+++...   ..+..+.  .-+..-+.+|+++-..... ....++.+++=--.|.. ...+...
T Consensus        51 mIl~GPPG~GKTTlA~liA~~~~---~~f~~~s--Av~~gvkdlr~i~e~a~~~~~~gr~tiLflDEIHRfnK~QQD~lL  125 (436)
T COG2256          51 MILWGPPGTGKTTLARLIAGTTN---AAFEALS--AVTSGVKDLREIIEEARKNRLLGRRTILFLDEIHRFNKAQQDALL  125 (436)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC---CCEEEEC--CCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHCCHHHHHHHH
T ss_conf             57778999888899999987617---7669951--523467999999999999872588349987225333744565510


Q ss_pred             HHHCCCCEEEEC
Q ss_conf             542345258723
Q gi|254780218|r   85 PALMEGKILLCD   96 (225)
Q Consensus        85 p~L~~g~iVI~D   96 (225)
                      |.+++|.+++.-
T Consensus       126 p~vE~G~iilIG  137 (436)
T COG2256         126 PHVENGTIILIG  137 (436)
T ss_pred             HHHCCCEEEEEE
T ss_conf             332488689996


No 486
>PRK13236 nitrogenase reductase; Reviewed
Probab=94.50  E-value=0.073  Score=31.39  Aligned_cols=38  Identities=21%  Similarity=0.325  Sum_probs=33.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECC
Q ss_conf             98886899867888797999999999999779819998-778
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REP   41 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~-~eP   41 (225)
                      |++   |+|=|=-|.||||.+..|+..|.+.|++|..+ ..|
T Consensus         6 mk~---IAiYGKGGIGKSTts~NlsAAlA~~G~rVl~IGCDP   44 (295)
T PRK13236          6 IRQ---IAFYGKGGIGKSTTSQNTLAAMAEMGQRILIVGCDP   44 (295)
T ss_pred             CEE---EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             618---999679843475789999999997799699978898


No 487
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=94.48  E-value=0.33  Score=27.47  Aligned_cols=25  Identities=24%  Similarity=0.399  Sum_probs=22.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9986788879799999999999977
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
                      -.|.|+.|+||||.++.+++.|.+.
T Consensus        41 YLFsGPrGvGKTTlArifAkaLnC~   65 (613)
T PRK05896         41 YIFSGPRGIGKTSIAKIFAKAINCL   65 (613)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             7755899848899999999996699


No 488
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=94.46  E-value=0.042  Score=32.80  Aligned_cols=27  Identities=30%  Similarity=0.423  Sum_probs=22.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++|-++++-|..||||||.++.|.-.+
T Consensus        29 ~~GEi~~liG~nGaGKSTL~~~l~G~~   55 (510)
T PRK09700         29 YPGEIHALLGENGAGKSTLMKVLSGIH   55 (510)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899699998999972999999983799


No 489
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Probab=94.46  E-value=0.032  Score=33.53  Aligned_cols=23  Identities=26%  Similarity=0.372  Sum_probs=20.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             99867888797999999999999
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      +.|-|+.|+||||.++.+++.+.
T Consensus        53 ~lf~GPPG~GKTTlAriiAk~~~   75 (234)
T pfam05496        53 VLLYGPPGLGKTTLANIIANEMG   75 (234)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC
T ss_conf             78878999988899999998408


No 490
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=94.44  E-value=0.041  Score=32.88  Aligned_cols=28  Identities=29%  Similarity=0.379  Sum_probs=24.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      .+|-+.++=|+.||||||..+.++-..+
T Consensus        22 ~~g~i~~l~GpsGaGKTTLl~~iaGl~~   49 (352)
T PRK11144         22 PAQGITAIFGRSGAGKTSLINLISGLTR   49 (352)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             8998999999999629999999976899


No 491
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=94.43  E-value=0.04  Score=32.95  Aligned_cols=26  Identities=42%  Similarity=0.399  Sum_probs=21.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             88689986788879799999999999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      .|-+.+|-|..||||||..+.+...+
T Consensus        21 ~~~itaivG~NGaGKSTLl~~i~~~l   46 (204)
T cd03240          21 FSPLTLIVGQNGAGKTTIIEALKYAL   46 (204)
T ss_pred             ECCEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             08889999899999999999986304


No 492
>TIGR01192 chvA glucan exporter ATP-binding protein; InterPro: IPR005896   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. In general, this protein is in some ways implicated in osmo-regulation and is suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bacterial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmo-adaptaion are related. ; GO: 0005215 transporter activity, 0006810 transport.
Probab=94.38  E-value=0.04  Score=32.91  Aligned_cols=27  Identities=44%  Similarity=0.655  Sum_probs=23.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      |.|-=|+|=||-|+||||++++|.+-.
T Consensus       359 KAG~TvAIVGPTGAGKTTLiNLLQRVy  385 (592)
T TIGR01192       359 KAGQTVAIVGPTGAGKTTLINLLQRVY  385 (592)
T ss_pred             ECCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             247568987789971789988775310


No 493
>PRK10646 putative ATPase; Provisional
Probab=94.38  E-value=0.057  Score=32.02  Aligned_cols=28  Identities=32%  Similarity=0.272  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             8886899867888797999999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ..|.+|.+.|-=||||||.++.+.+.|.
T Consensus        26 ~~g~vi~L~G~LGaGKTtf~r~i~~~lg   53 (153)
T PRK10646         26 DGATVIYLYGDLGAGKTTFSRGFLQALG   53 (153)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             9997999988887899999999999849


No 494
>TIGR02857 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD; InterPro: IPR014216   The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain and a C-terminal ATP-binding domain. In Escherichia coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in the export of redox-active thiol compounds such as cysteine and glutathione , . The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components.    The genes used as the seed members for this entry are all either found in the gammaproteobacterial context, or the CydABCD context. All members of this entry scoring above the trusted cut off at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature, based on this operon in Bacillus subtilis, assigns cydC to the third gene in the operon, where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologues in this family in accordance with the precedence of publication of the E. coli name, CydD..
Probab=94.37  E-value=0.037  Score=33.15  Aligned_cols=32  Identities=31%  Similarity=0.517  Sum_probs=26.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHH-HCCC
Q ss_conf             8886899867888797999999999999-7798
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQ-RKNY   33 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~-~~g~   33 (225)
                      .-|..+++-|.-||||||..+.|.-... ..|-
T Consensus       376 ~pG~~vAl~G~SGaGKSTLL~lLLGf~~P~~G~  408 (570)
T TIGR02857       376 EPGERVALVGPSGAGKSTLLNLLLGFVEPTEGA  408 (570)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHCCCCCCCCE
T ss_conf             387048886279997889999997157644646


No 495
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]
Probab=94.31  E-value=0.14  Score=29.64  Aligned_cols=32  Identities=34%  Similarity=0.442  Sum_probs=16.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             86899867888797999999999999779819998
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
                      |+=|-+||-.|.|||..+..|++   ..|.+.+.+
T Consensus      1543 ~kpilLEGsPGVGKTSlItaLAr---~tG~kliRI 1574 (4600)
T COG5271        1543 GKPILLEGSPGVGKTSLITALAR---KTGKKLIRI 1574 (4600)
T ss_pred             CCCEEECCCCCCCHHHHHHHHHH---HHCCCEEEE
T ss_conf             88546227998667899999999---745724786


No 496
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=94.30  E-value=0.048  Score=32.45  Aligned_cols=25  Identities=24%  Similarity=0.318  Sum_probs=21.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8886899867888797999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKR   26 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~   26 (225)
                      +.|-+-+|=|+.||||||++..|.-
T Consensus        28 ~~GEvhaiMGPNGsGKSTLa~~i~G   52 (251)
T COG0396          28 KEGEVHAIMGPNGSGKSTLAYTIMG   52 (251)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             5982899988998788999999728


No 497
>KOG0057 consensus
Probab=94.30  E-value=0.057  Score=32.04  Aligned_cols=32  Identities=31%  Similarity=0.500  Sum_probs=28.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             88868998678887979999999999997798
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNY   33 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~   33 (225)
                      .+|.=++|-|..||||||..++|-..+...|-
T Consensus       376 ~kGekVaIvG~nGsGKSTilr~LlrF~d~sG~  407 (591)
T KOG0057         376 PKGEKVAIVGSNGSGKSTILRLLLRFFDYSGS  407 (591)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             48978989789998788999999997446885


No 498
>KOG0744 consensus
Probab=94.28  E-value=0.039  Score=33.00  Aligned_cols=27  Identities=30%  Similarity=0.342  Sum_probs=24.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             886899867888797999999999999
Q gi|254780218|r    3 SGLFISFEGIEGAGKTTHISLLKRFLQ   29 (225)
Q Consensus         3 ~g~~I~iEGiDGsGKsTq~~~L~~~L~   29 (225)
                      ..++|-+-|+.|.|||++++.|++.|.
T Consensus       176 ~NRliLlhGPPGTGKTSLCKaLaQkLS  202 (423)
T KOG0744         176 WNRLILLHGPPGTGKTSLCKALAQKLS  202 (423)
T ss_pred             EEEEEEEECCCCCCHHHHHHHHHHHHE
T ss_conf             414899857999882279999987514


No 499
>PRK10419 nikE nickel transporter ATP-binding protein; Provisional
Probab=94.26  E-value=0.048  Score=32.46  Aligned_cols=27  Identities=33%  Similarity=0.432  Sum_probs=23.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFL   28 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L   28 (225)
                      ++|-+++|=|.-||||||.++.|....
T Consensus        36 ~~GE~l~ivGeSGsGKSTL~r~i~gl~   62 (266)
T PRK10419         36 KSGETVALLGRSGCGKSTLARLLVGLE   62 (266)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             899899999999977999999996699


No 500
>pfam01443 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Helicase activity for this family has been demonstrated and NTPase activity. This helicase has multiple roles at different stages of viral RNA replication, as dissected by mutational analysis.
Probab=94.25  E-value=0.033  Score=33.42  Aligned_cols=21  Identities=43%  Similarity=0.600  Sum_probs=0.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHH
Q ss_conf             998678887979999999999
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRF   27 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~   27 (225)
                      |+|-|+.||||||.++.+.+.
T Consensus         1 ~vV~gvpGsGKSt~I~~l~~~   21 (226)
T pfam01443         1 IVVHGVPGCGKSTLIRKLLRT   21 (226)
T ss_pred             CEEEECCCCCHHHHHHHHHHH
T ss_conf             959407999889999999864


Done!