HHsearch alignment for GI: 254780218 and conserved domain: pfam00406

>pfam00406 ADK Adenylate kinase.
Probab=98.97  E-value=5.2e-09  Score=74.03  Aligned_cols=117  Identities=19%  Similarity=0.217  Sum_probs=63.0

Q ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC------CCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6788879799999999999977981999877------8898441001100124445410134567778899999776356
Q gi|254780218|r   10 EGIEGAGKTTHISLLKRFLQRKNYDVHVTRE------PGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus        10 EGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e------P~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
T Consensus         2 ~G~PGsGKgTqa~~La~~~---~~~~is~GdllR~~~~~~s~~g~~i~~~i~~G~---lvpd~i~-------~~l~~~~l   68 (186)
T pfam00406         2 LGPPGAGKGTQAERIVQKY---GIVHLSTGDLLRAEVKSGTELGKEAKEYMDKGE---LVPDEVV-------VGLVKERL   68 (186)
T ss_pred             CCCCCCCHHHHHHHHHHHH---CCEEECHHHHHHHHHHCCCHHHHHHHHHHHCCC---CCCHHHH-------HHHHHHHH
T ss_conf             1889898599999999985---990676999999998628879999999998699---5430999-------99999997


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
T Consensus        69 ~~~~~~~g~i-LD----------GfPRt~~Q--a~~l~~~l~~~~~~~~Vi~l~~~~~~~~~Rl~~R~~  124 (186)
T pfam00406        69 EQNDCKNGFL-LD----------GFPRTVPQ--AEALEEMLEYGIKLDYVIEFDVPDEVLVERLTGRRI  124 (186)
T ss_pred             CCCCCCCCEE-EE----------CCCCCHHH--HHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             0745548668-73----------79898999--999999997499877799997378999999976641