HHsearch alignment for GI: 254780218 and conserved domain: pfam00931

>pfam00931 NB-ARC NB-ARC domain.
Probab=95.15  E-value=0.11  Score=30.42  Aligned_cols=35  Identities=23%  Similarity=0.226  Sum_probs=24.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHH-HCCCC-EEEEE
Q ss_conf             6899867888797999999999999-77981-99987
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQ-RKNYD-VHVTR   39 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~-~~g~~-v~~~~   39 (225)
T Consensus        20 ~vI~I~G~gGiGKTtLA~~v~~~~~i~~~F~~~~wv~   56 (285)
T pfam00931        20 GVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVV   56 (285)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCHHHHHCCCEEEEEE
T ss_conf             3999889995639999999971655650598389999