HHsearch alignment for GI: 254780218 and conserved domain: pfam03029

>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=96.98  E-value=0.0054  Score=38.13  Aligned_cols=86  Identities=23%  Similarity=0.286  Sum_probs=46.1

Q ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCC--CC--CCHHHHCCCCC---CCCCCHHHHHHHHHHHHH-HHHHH
Q ss_conf             678887979999999999997798199987-78898--44--10011001244---454101345677788999-99776
Q gi|254780218|r   10 EGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPGGT--PA--AEAARHVLLSC---GVDEFGAEAEAIVFAAAR-LDHVE   80 (225)
Q Consensus        10 EGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~~t--~~--ge~ir~~l~~~---~~~~~~~~~~~lLfaadr-~~~~~   80 (225)
T Consensus         2 iGpaGSGKTT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIrd~i~~~dvM~~~~LGPNG-ali~~me~l~~~~d   80 (234)
T pfam03029         2 VGGAGSGKTTFVGALSEILPLRGRSVYVVNLDPAAENLPYEADIDIRELITVADVMEDYGLGPNG-ALTVAMDFGRITLD   80 (234)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHCCCCCCH-HHHHHHHHHHHHHH
T ss_conf             89898988999999999999779975999789866589998777178746799999982989738-99999999999999


Q ss_pred             HHHHHHHC-CCCEEEECC
Q ss_conf             35655423-452587235
Q gi|254780218|r   81 NVIRPALM-EGKILLCDR   97 (225)
Q Consensus        81 ~~I~p~L~-~g~iVI~DR   97 (225)
T Consensus        81 ~-l~~~l~~~~~y~l~Dt   97 (234)
T pfam03029        81 W-LLEELEYEDDYYLFDT   97 (234)
T ss_pred             H-HHHHHCCCCCEEEEEC
T ss_conf             9-9998525577699836