HHsearch alignment for GI: 254780218 and conserved domain: pfam06414

>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=98.44  E-value=2e-05  Score=52.59  Aligned_cols=166  Identities=17%  Similarity=0.155  Sum_probs=84.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCC---CHHHHHHHHHHHHHHHH
Q ss_conf             888689986788879799999999999977981999877889844100110012444541---01345677788999997
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE---FGAEAEAIVFAAARLDH   78 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~---~~~~~~~lLfaadr~~~   78 (225)
T Consensus        10 ~~Pkai~laG~pGAGKS~~~~~~~~~~~~~~~--v~I-------n~D~~r~~~P--~y~~l~~~~~~~~~~~~~~~a~~~   78 (191)
T pfam06414        10 ERPVAVLLGGQPGAGKTELARALLEELGGGNV--VRI-------DPDELRTYHP--DYDELQKADPKDASELTQPDASRW   78 (191)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCCCC--EEE-------CCHHHHHHHH--HHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             69879999579988889999999875378993--897-------1358788777--478655407677899989999999


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCH
Q ss_conf             76356554234525872354243100010034442457765444203889841156652034877644321111100000
Q gi|254780218|r   79 VENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESAC  158 (225)
Q Consensus        79 ~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~  158 (225)
T Consensus        79 ~~~~~~~a~~~r~n~iieg----T~~------~-~~~~~~~~~~lk~~GY-~v~v~~Va~~~e~S~~r~~~Ry~~~~~~g  146 (191)
T pfam06414        79 VEKLIDYAIERGYNIILEG----TLR------S-PDVARKLARKLKAAGY-EVEVYVVAVPPELSWLGVLDRYEEELAAG  146 (191)
T ss_pred             HHHHHHHHHHCCCCEEEEC----CCC------C-HHHHHHHHHHHHHCCC-EEEEEEEECCHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999997599989857----778------9-7999999999997899-79999998899999999999998510578


Q ss_pred             HHHHHHCCHHHHHH----HHHHHHHHHHHC-CCCEEEECCC
Q ss_conf             00021128899999----999999999978-9949998189
Q gi|254780218|r  159 LDYFERKDVMIHEK----RRQIFLDIARNQ-PDRCHIVDSA  194 (225)
Q Consensus       159 ~d~~E~~~~~~~~k----v~~~y~~la~~~-~~~~~~IDa~  194 (225)
T Consensus       147 --R~v--~~~~hd~~~~~~~~~~~~l~~~~~~d~i~i~~r~  183 (191)
T pfam06414       147 --RRV--PKEVHDAAYNGLPESVEALEREKLFDRILIKDRD  183 (191)
T ss_pred             --CCC--CHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             --748--9999999998599999999966997559998799