BLAST/PSIBLAST alignment of GI: 254780218 and GI: 241204716 at iteration 1
>gi|241204716|ref|YP_002975812.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 236
>gi|240858606|gb|ACS56273.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 236
 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 151/211 (71%), Gaps = 3/211 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ + +DV +TREPGG+P AEA RHVLLS   + 
Sbjct: 14  GTGLFVTFEGGEGAGKSTQIRRLAEALKGEGHDVLMTREPGGSPGAEAVRHVLLSGAAEA 73

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GK++LCDRF+DSS  YQG   + +  F+++LQ
Sbjct: 74  FGTRMEAILFAAARNDHVEEVIRPALASGKVVLCDRFMDSSRVYQGITGNLEPDFIETLQ 133

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  VMPDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 134 RIAINGVMPDCTVILDIPAKVGLERAQKRAA---ADAPDRFEKERLETHEKRREAFLDIA 190

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +P+RCH+V++  S +++A  IL IV +L+
Sbjct: 191 AREPERCHVVNAMQSEEAIAAEILAIVQQLL 221