BLAST/PSIBLAST alignment of GI: 254780218 and GI: 86357778 at iteration 1
>gi|86357778|ref|YP_469670.1| thymidylate kinase protein [Rhizobium etli CFN 42] Length = 236
>gi|86281880|gb|ABC90943.1| thymidylate kinase protein [Rhizobium etli CFN 42] Length = 236
 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 148/210 (70%), Gaps = 3/210 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ + ++V VTREPGG+P AEA RHVLLS   + 
Sbjct: 14  GTGLFVTFEGGEGAGKSTQIRRLAEALKGEGHEVLVTREPGGSPGAEAVRHVLLSGAAEA 73

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GKI+LCDRF+DSS  YQG   +    F+++LQ
Sbjct: 74  FGTRMEAILFAAARNDHVEEVIRPALAAGKIVLCDRFMDSSRVYQGITGNLDPDFIETLQ 133

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  V+PDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 134 RIAINGVVPDCTLILDIPAKVGLERAQKRSA---AEAPDRFEKERLETHEKRREAFLDIA 190

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
             +P+RC +V++  + +++A  IL IV +L
Sbjct: 191 AREPERCRVVNAMQTEEAIAAEILAIVKQL 220