BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus
Liberibacter asiaticus str. psy62]
         (225 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039895|gb|ACT56691.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 225

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD
Sbjct: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL
Sbjct: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI
Sbjct: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225
           ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI
Sbjct: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225


>gi|315122339|ref|YP_004062828.1| thymidylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495741|gb|ADR52340.1| thymidylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 227

 Score =  352 bits (902), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 163/224 (72%), Positives = 195/224 (87%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MNSGLFISFEGIEG GKTTHIS L  FL++ NYDV +TREPGGTP AEAARHVLL+ GVD
Sbjct: 1   MNSGLFISFEGIEGVGKTTHISHLAGFLKKNNYDVQITREPGGTPVAEAARHVLLTGGVD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           EFGA AE+I+F++ RLDHVENVIRPAL+EGKILLCDRFLDSSYAYQGE+D  +  FLDSL
Sbjct: 61  EFGAYAESILFSSIRLDHVENVIRPALIEGKILLCDRFLDSSYAYQGEKDDFKKTFLDSL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           Q++S Q ++PDCTIILDLPVD+GL+R+++RYSL++++ LDYFERKD ++HEKRR+IFLDI
Sbjct: 121 QQVSTQGIVPDCTIILDLPVDVGLQRIRHRYSLKKNSSLDYFERKDWIVHEKRRRIFLDI 180

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKD 224
           AR+QP+RC IVD+ H FQ VA +ILNIVWEL+QKR  P   K D
Sbjct: 181 ARDQPERCRIVDATHPFQDVAAHILNIVWELMQKRSFPRPPKGD 224


>gi|209549399|ref|YP_002281316.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535155|gb|ACI55090.1| dTMP kinase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 226

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 150/211 (71%), Gaps = 3/211 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+   +DV VTREPGG+P AEA RHVLLS   + 
Sbjct: 4   GTGLFVTFEGGEGAGKSTQIRRLAEALKGDGHDVLVTREPGGSPGAEAVRHVLLSGAAEA 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GKI+LCDRF+DSS  YQG   + Q  F+++LQ
Sbjct: 64  FGTRMEAILFAAARNDHVEEVIRPALAAGKIVLCDRFMDSSRVYQGVTGNLQPDFIETLQ 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  VMPDCT+ILD+P  IGL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 124 RIAINGVMPDCTVILDIPAKIGLERAQKRAA---TDAPDRFEKERLETHEKRREAFLDIA 180

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +P+RCH++++  S +++A  I+ IV +L+
Sbjct: 181 AREPERCHVINAMQSEEAIAAEIVAIVRQLM 211


>gi|241204716|ref|YP_002975812.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858606|gb|ACS56273.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 236

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 151/211 (71%), Gaps = 3/211 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ + +DV +TREPGG+P AEA RHVLLS   + 
Sbjct: 14  GTGLFVTFEGGEGAGKSTQIRRLAEALKGEGHDVLMTREPGGSPGAEAVRHVLLSGAAEA 73

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GK++LCDRF+DSS  YQG   + +  F+++LQ
Sbjct: 74  FGTRMEAILFAAARNDHVEEVIRPALASGKVVLCDRFMDSSRVYQGITGNLEPDFIETLQ 133

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  VMPDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 134 RIAINGVMPDCTVILDIPAKVGLERAQKRAA---ADAPDRFEKERLETHEKRREAFLDIA 190

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +P+RCH+V++  S +++A  IL IV +L+
Sbjct: 191 AREPERCHVVNAMQSEEAIAAEILAIVQQLL 221


>gi|116252223|ref|YP_768061.1| thymidylate kinase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256871|emb|CAK07965.1| putative thymidylate kinase (ec 2.7.4.9) (dtmp kinase) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 226

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 109/211 (51%), Positives = 151/211 (71%), Gaps = 3/211 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ + +DV +TREPGG+P AEA RHVLLS   + 
Sbjct: 4   GTGLFVTFEGGEGAGKSTQIRRLAEALKGEGHDVLMTREPGGSPGAEAVRHVLLSGAAEA 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GK++LCDRF+DSS  YQG   + +  F+++LQ
Sbjct: 64  FGTRMEAILFAAARNDHVEEVIRPALAAGKVVLCDRFMDSSRVYQGITGNLEPDFIETLQ 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  VMPDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 124 RIAINGVMPDCTVILDIPAKVGLERAQKRAA---ADAPDRFEKERLETHEKRREAFLDIA 180

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +P+RCH+V++  + +++A  IL IV +L+
Sbjct: 181 AREPERCHVVNAMQTEEAIAAEILAIVKQLL 211


>gi|190891837|ref|YP_001978379.1| thymidylate kinase protein [Rhizobium etli CIAT 652]
 gi|190697116|gb|ACE91201.1| thymidylate kinase protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/210 (51%), Positives = 150/210 (71%), Gaps = 3/210 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ + ++V VTREPGG+P AEA RHVLLS   + 
Sbjct: 14  GTGLFVTFEGGEGAGKSTQIRRLAETLKGEGHEVLVTREPGGSPGAEAVRHVLLSGAAEA 73

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GKI+LCDRF+DSS  YQG   + +  F+++LQ
Sbjct: 74  FGTRMEAILFAAARNDHVEEVIRPALAAGKIVLCDRFMDSSRVYQGITGNLEPDFIETLQ 133

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  V+PDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 134 RIAINGVVPDCTLILDIPAKVGLERAQKRSA---AEAPDRFEKERLETHEKRREAFLDIA 190

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
             +P+RCH+V++  + +++A  IL IV +L
Sbjct: 191 AREPERCHVVNAMQTEEAIAAEILAIVKQL 220


>gi|218682276|ref|ZP_03529877.1| thymidylate kinase [Rhizobium etli CIAT 894]
          Length = 226

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 148/211 (70%), Gaps = 3/211 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ +  DV +TREPGG+P AEA RHVLLS   + 
Sbjct: 4   GTGLFVTFEGGEGAGKSTQIRRLAAALKGEGQDVLMTREPGGSPGAEAVRHVLLSGAAEA 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +G   EAI+FAAAR DHVE VIRPAL  GKI+LCDRF+DSS  YQG   S    F+++LQ
Sbjct: 64  YGTRMEAILFAAARNDHVEEVIRPALTAGKIVLCDRFMDSSRVYQGITGSLDPDFIETLQ 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +++  V PDCT+ILD+P  IGL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 124 RVAINGVTPDCTVILDIPAKIGLERAQKRAA---ADAPDRFEKERLETHEKRREAFLDIA 180

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +P+RCH+V++  S +++A  IL IV +L+
Sbjct: 181 AREPERCHVVNAMQSEEAIAAEILAIVKQLL 211


>gi|86357778|ref|YP_469670.1| thymidylate kinase protein [Rhizobium etli CFN 42]
 gi|86281880|gb|ABC90943.1| thymidylate kinase protein [Rhizobium etli CFN 42]
          Length = 236

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 148/210 (70%), Gaps = 3/210 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEG EGAGK+T I  L   L+ + ++V VTREPGG+P AEA RHVLLS   + 
Sbjct: 14  GTGLFVTFEGGEGAGKSTQIRRLAEALKGEGHEVLVTREPGGSPGAEAVRHVLLSGAAEA 73

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  GKI+LCDRF+DSS  YQG   +    F+++LQ
Sbjct: 74  FGTRMEAILFAAARNDHVEEVIRPALAAGKIVLCDRFMDSSRVYQGITGNLDPDFIETLQ 133

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  V+PDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA
Sbjct: 134 RIAINGVVPDCTLILDIPAKVGLERAQKRSA---AEAPDRFEKERLETHEKRREAFLDIA 190

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
             +P+RC +V++  + +++A  IL IV +L
Sbjct: 191 AREPERCRVVNAMQTEEAIAAEILAIVKQL 220


>gi|222086013|ref|YP_002544545.1| thymidylate kinase [Agrobacterium radiobacter K84]
 gi|221723461|gb|ACM26617.1| thymidylate kinase [Agrobacterium radiobacter K84]
          Length = 227

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 149/215 (69%), Gaps = 6/215 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF+SFEG EGAGK+T I  L  +L+   +DV VTREPGG+P AEA RHVLLS   + F
Sbjct: 5   TGLFVSFEGGEGAGKSTQIRRLAAWLRELGHDVLVTREPGGSPGAEAVRHVLLSGAAEMF 64

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EAI+FAAAR DHVE +IRPAL  G I+LCDRF+DSS  YQG   + +  F+++LQ 
Sbjct: 65  GTRMEAILFAAARNDHVEEIIRPALAHGTIVLCDRFMDSSRVYQGITGNLEPDFIEALQR 124

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           ++V  V+PDCT+ILD+P ++GL+R + R S    A  D FE++++  HEKRR+ FLDIA 
Sbjct: 125 VAVNGVVPDCTLILDIPAELGLERARKRASA--DAAPDRFEKEELQTHEKRREAFLDIAA 182

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
             PDRCH+VD+      +A  I  I    ++KR+S
Sbjct: 183 RDPDRCHVVDAQRGEDVIADEIAAI----IEKRLS 213


>gi|218463772|ref|ZP_03503863.1| thymidylate kinase [Rhizobium etli Kim 5]
          Length = 220

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 105/207 (50%), Positives = 147/207 (71%), Gaps = 3/207 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +F++FEG EGAGK+T I  L   L+ + ++V VTREPGG+P AEA RHVLLS   + FG 
Sbjct: 1   MFVTFEGGEGAGKSTQIRRLAEALKGEGHEVLVTREPGGSPGAEAVRHVLLSGAAEAFGT 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EAI+FAAAR DHVE VIRPAL  GKI+LCDRF+DSS  YQG   + +  F+++LQ I+
Sbjct: 61  RMEAILFAAARNDHVEEVIRPALAAGKIVLCDRFMDSSRVYQGITGNLEPDFIETLQRIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +  V+PDCT+ILD+P  +GL+R Q R +   +   D FE++ +  HEKRR+ FLDIA  +
Sbjct: 121 INGVVPDCTLILDIPAKVGLERAQKRSA---AEAPDRFEKERLETHEKRREAFLDIAARE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWEL 211
           P+RC ++++  + +++A  IL IV +L
Sbjct: 178 PERCRVINAMQTEEAIAAEILAIVKQL 204


>gi|222148589|ref|YP_002549546.1| thymidylate kinase [Agrobacterium vitis S4]
 gi|221735575|gb|ACM36538.1| thymidylate kinase [Agrobacterium vitis S4]
          Length = 221

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 142/217 (65%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           + SGLF++FEG EGAGK+T I LL   L+   + V  +REPGG+P AEA RHVLLS   +
Sbjct: 3   VGSGLFVTFEGGEGAGKSTQIRLLANALEALGFAVVTSREPGGSPCAEALRHVLLSGAAE 62

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            FG E EAI+FAAAR DHVE  +RPAL+ G ++LCDRF+DSS  YQG   +    F++ L
Sbjct: 63  PFGVEMEAILFAAARNDHVEARLRPALLRGDMVLCDRFMDSSRVYQGATGNLSSAFIERL 122

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           Q I+V  V+PD TIILDLP +IGL R +NR         D FE++++ IHE+RR+ FL I
Sbjct: 123 QAIAVDGVVPDLTIILDLPANIGLARAKNRAGALGEDAPDRFEKEEIAIHERRREAFLAI 182

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           AR +P RC +VD+    + +A  I   V  L+   V 
Sbjct: 183 ARAEPARCRVVDARAGIEQIAEEIFAAVKPLLPHNVG 219


>gi|307312732|ref|ZP_07592363.1| thymidylate kinase [Sinorhizobium meliloti BL225C]
 gi|307317216|ref|ZP_07596657.1| thymidylate kinase [Sinorhizobium meliloti AK83]
 gi|306897304|gb|EFN28049.1| thymidylate kinase [Sinorhizobium meliloti AK83]
 gi|306899457|gb|EFN30089.1| thymidylate kinase [Sinorhizobium meliloti BL225C]
          Length = 234

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 145/224 (64%), Gaps = 3/224 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +  G FI+FEG EGAGK+T + LL   L  + Y V  TREPGG+  AEA RHVLLS   +
Sbjct: 11  LAKGFFITFEGGEGAGKSTQMRLLAEALSARGYRVLTTREPGGSVGAEAVRHVLLSGAAE 70

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            FG   EAI+FAAAR DHVE VIRPAL +G I+LCDRF+DSS  YQG   + +  F+++L
Sbjct: 71  SFGVRMEAILFAAARSDHVEEVIRPALEQGTIVLCDRFMDSSRVYQGVTGNLEPAFVETL 130

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + ++V  V+PDCTII DLP  +GL+R + R +   +   D FE++ +  HEKRR+ FLDI
Sbjct: 131 ERVAVNGVIPDCTIIFDLPASVGLERARRRAA---NDSPDRFEKEQLETHEKRREAFLDI 187

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKD 224
           A   P+RC +VD+     ++A  +L++V  L+     P  S  +
Sbjct: 188 AAADPERCRVVDANRPPTAIAAEVLSLVEALLPLEGKPQPSNAE 231


>gi|150396510|ref|YP_001326977.1| thymidylate kinase [Sinorhizobium medicae WSM419]
 gi|150028025|gb|ABR60142.1| dTMP kinase [Sinorhizobium medicae WSM419]
          Length = 234

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 142/212 (66%), Gaps = 3/212 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +  GLFI+FEG EGAGK+T + LL   L  + Y V  TREPGG+  AEA RHVLLS   +
Sbjct: 11  LAKGLFITFEGGEGAGKSTQMRLLAEALSARGYRVLTTREPGGSAGAEAVRHVLLSGAAE 70

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            FG   EAI+FAAAR DHVE VIRPAL +G I+LCDRF+DSS  YQG   + +  F+++L
Sbjct: 71  SFGVRMEAILFAAARSDHVEEVIRPALEDGTIVLCDRFMDSSRVYQGVTGNLEPSFVETL 130

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + ++V  V+PDCTII DLP  IGL+R + R +   +   D FE++ +  HEKRR+ FLDI
Sbjct: 131 ERVAVNGVIPDCTIIFDLPAAIGLERARRRAA---NNSPDRFEKEQLETHEKRREAFLDI 187

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A     RC +VD+     ++A ++LN+V  L+
Sbjct: 188 AATDSKRCRVVDANRPPAAIAADVLNLVKALL 219


>gi|15965357|ref|NP_385710.1| putative thymidylate kinase, dTMP kinase protein [Sinorhizobium
           meliloti 1021]
 gi|23821796|sp|Q92PW7|KTHY_RHIME RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|15074537|emb|CAC46183.1| Putative thymidylate kinase, dTMP kinase [Sinorhizobium meliloti
           1021]
          Length = 234

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 105/224 (46%), Positives = 144/224 (64%), Gaps = 3/224 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +  G FI+FEG EG GK+T + LL   L  + Y V  TREPGG+  AEA RHVLLS   +
Sbjct: 11  LAKGFFITFEGGEGTGKSTQMRLLAEALSARGYRVLTTREPGGSVGAEAVRHVLLSGAAE 70

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            FG   EAI+FAAAR DHVE VIRPAL +G I+LCDRF+DSS  YQG   + +  F+++L
Sbjct: 71  SFGVRMEAILFAAARSDHVEEVIRPALEQGTIVLCDRFMDSSRVYQGVTGNLEPAFVETL 130

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + ++V  V+PDCTII DLP  +GL+R + R +   +   D FE++ +  HEKRR+ FLDI
Sbjct: 131 ERVAVNGVIPDCTIIFDLPASVGLERARRRAA---NDSPDRFEKEQLETHEKRREAFLDI 187

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKD 224
           A   P+RC +VD+     ++A  +L++V  L+     P  S  +
Sbjct: 188 AAADPERCRVVDANRPPTAIAAEVLSLVEALLPLEGKPQPSNAE 231


>gi|153009407|ref|YP_001370622.1| thymidylate kinase [Ochrobactrum anthropi ATCC 49188]
 gi|151561295|gb|ABS14793.1| dTMP kinase [Ochrobactrum anthropi ATCC 49188]
          Length = 218

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 145/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL + L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 6   SGLFITFEGGEGAGKSTQIALLAKHLRANGFDPVITREPGGSPGAEAIRHVILSGNAENY 65

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           GA  EA++F AAR DHV  +IRPAL EG+++LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 66  GAAMEALLFGAARADHVNQLIRPALNEGRVVLCDRFIDSSRAYQGVTGNLDRTYMAAVER 125

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++  VMPD TIILD+P + GL R   R   R S   D FE++D+ +HE RRQ FL IA 
Sbjct: 126 IAIDGVMPDMTIILDIPAEKGLSRAGKR---RGSETADRFEKEDIAVHEARRQAFLAIAE 182

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P+RC ++D+      +A+++   V   +++R
Sbjct: 183 AEPERCKVIDADRLQDQIASDVAKEVDSALKER 215


>gi|227822155|ref|YP_002826126.1| thymidylate kinase [Sinorhizobium fredii NGR234]
 gi|227341155|gb|ACP25373.1| thymidylate kinase [Sinorhizobium fredii NGR234]
          Length = 234

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 147/221 (66%), Gaps = 3/221 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLF++FEG EGAGK+T + LL   L  + YDV  TREPGG+  AEA RHVLLS   + 
Sbjct: 12  TKGLFVTFEGGEGAGKSTQMRLLADSLSGRGYDVLTTREPGGSLGAEAVRHVLLSGAAES 71

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL +G+I+LCDRF+DSS  YQG   + +  F+++L+
Sbjct: 72  FGVRMEAILFAAARSDHVEEVIRPALQQGRIVLCDRFMDSSRVYQGVTGNLEPGFVETLE 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            ++V  V+PD TII DLP + GL+R + R SL  +   D FE++ +  HEKRR+ FLDIA
Sbjct: 132 RVAVNGVVPDRTIIFDLPAEAGLERARRR-SL--NVDPDRFEKEQLETHEKRREAFLDIA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSK 222
              P+RC +VD+    + +A  +L +V  L+     P SS+
Sbjct: 189 EADPERCRVVDATLPPEVIAAEVLRLVEALLPGDGEPQSSR 229


>gi|325292851|ref|YP_004278715.1| Thymidylate kinase [Agrobacterium sp. H13-3]
 gi|325060704|gb|ADY64395.1| Thymidylate kinase [Agrobacterium sp. H13-3]
          Length = 224

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 104/213 (48%), Positives = 143/213 (67%), Gaps = 2/213 (0%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLFISFEG EGAGK+T I  L   L+ + +DV VTREPGG+P AEA RHVLLS   + 
Sbjct: 4   KTGLFISFEGGEGAGKSTQIRTLAEALRDRGFDVIVTREPGGSPGAEAVRHVLLSGAAES 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  G I+LCDRFLDSS  YQG   + +  F+++LQ
Sbjct: 64  FGVRMEAILFAAARNDHVEEVIRPALERGAIVLCDRFLDSSRVYQGTTGNLEPDFIETLQ 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +++  V+P+ T+I D+  + GL R + R    E A  D FE++++  HEKRR+ +LDIA
Sbjct: 124 RVAIDGVVPELTLIFDIAAEKGLARARKRAD--EGAAPDRFEKEEIETHEKRREAYLDIA 181

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             +P RC IV++      V  ++++ V  L+++
Sbjct: 182 LAEPRRCRIVNADQPEDKVTEDVMSFVEPLLER 214


>gi|239831999|ref|ZP_04680328.1| thymidylate kinase [Ochrobactrum intermedium LMG 3301]
 gi|239824266|gb|EEQ95834.1| thymidylate kinase [Ochrobactrum intermedium LMG 3301]
          Length = 218

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 146/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL + L+   +D  +TREPGG+P AEA RHV+LS   +++
Sbjct: 6   SGLFITFEGGEGAGKSTQIALLAKHLRASGFDPVITREPGGSPGAEAIRHVILSGNAEKY 65

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRPAL EG+++LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 66  GPAMEALLFAAARADHVDQLIRPALDEGRVVLCDRFIDSSRAYQGVTGNLDSTYMSAVER 125

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++  +MPD TIILD+P + GL R   R   R S   D FE++D+ +HE RRQ FL IA 
Sbjct: 126 IAIDGIMPDMTIILDIPAEKGLSRAGKR---RGSETADRFEKEDIAVHEARRQAFLAIAE 182

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++ +     ++A+ I   +  ++++R
Sbjct: 183 AEPRRCKVIGADRPQDAIASEIAREIDSVLKER 215


>gi|23821779|sp|Q8UFA0|KTHY_AGRT5 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
          Length = 224

 Score =  211 bits (536), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 144/213 (67%), Gaps = 2/213 (0%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLFISFEG EGAGK+T I  L   L+ + ++V VTREPGG+P AEA RHV+LS   + 
Sbjct: 4   KTGLFISFEGGEGAGKSTQIRTLAEALRGRGFEVVVTREPGGSPGAEAVRHVILSGAAES 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EAI+FAAAR DHVE VIRPAL  G+I+LCDRFLDSS  YQG   + +  F+++LQ
Sbjct: 64  FGVRMEAILFAAARNDHVEEVIRPALARGEIVLCDRFLDSSRVYQGTTGNLEPDFIETLQ 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I++  V+P+ T+I D+  + GL R + R    E A  D FE++++  HEKRR+ +LDIA
Sbjct: 124 RIAIDGVVPELTLIFDIAAEKGLARARKRAD--EGATPDRFEKEEIETHEKRREAYLDIA 181

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             +P RC IV++      V  ++++ V  L+++
Sbjct: 182 LAEPRRCRIVNADQPEDKVTEDVMSFVEPLLER 214


>gi|261754954|ref|ZP_05998663.1| thymidylate kinase [Brucella suis bv. 3 str. 686]
 gi|306843867|ref|ZP_07476462.1| thymidylate kinase [Brucella sp. BO1]
 gi|38258158|sp|Q8G0U3|KTHY_BRUSU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|261744707|gb|EEY32633.1| thymidylate kinase [Brucella suis bv. 3 str. 686]
 gi|306275622|gb|EFM57346.1| thymidylate kinase [Brucella sp. BO1]
          Length = 214

 Score =  211 bits (536), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 146/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRPAL EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKIADEIRSVVDTILTEK 211


>gi|265984061|ref|ZP_06096796.1| thymidylate kinase [Brucella sp. 83/13]
 gi|306838352|ref|ZP_07471197.1| thymidylate kinase [Brucella sp. NF 2653]
 gi|264662653|gb|EEZ32914.1| thymidylate kinase [Brucella sp. 83/13]
 gi|306406492|gb|EFM62726.1| thymidylate kinase [Brucella sp. NF 2653]
          Length = 214

 Score =  211 bits (536), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 146/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRPAL EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKIADEIRSVVDTILAEK 211


>gi|163760148|ref|ZP_02167231.1| hypothetical protein HPDFL43_07799 [Hoeflea phototrophica DFL-43]
 gi|162282547|gb|EDQ32835.1| hypothetical protein HPDFL43_07799 [Hoeflea phototrophica DFL-43]
          Length = 226

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 101/212 (47%), Positives = 146/212 (68%), Gaps = 2/212 (0%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + G FI+FEG EG GK+T I+ L + L+R+  DV VTREPGG+  AEA RHVLLS   +E
Sbjct: 4   SKGRFITFEGGEGVGKSTQINRLAKVLRRRGMDVLVTREPGGSLGAEAVRHVLLSGAAEE 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           FG   EA++FAAAR DHVE VIRPAL EG I+LCDR++DSS  YQG   + +  F+ +L+
Sbjct: 64  FGIRMEAMLFAAARSDHVEEVIRPALAEGAIVLCDRYMDSSRVYQGVTGNLEPQFIVNLE 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I+V  ++PD T+ILDLP + GL+R + R     +   D FE+++V  HEKRR+ F+D+ 
Sbjct: 124 RIAVNSMVPDLTLILDLPAEAGLRRAKARVGA--NVAPDRFEKEEVATHEKRREAFIDLT 181

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           R++P+RC ++++      VA  +L+ V  +++
Sbjct: 182 RSEPERCKLINADQPEDMVALAVLSTVEPVLE 213


>gi|163843261|ref|YP_001627665.1| thymidylate kinase [Brucella suis ATCC 23445]
 gi|189028829|sp|B0CGE4|KTHY_BRUSI RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|163673984|gb|ABY38095.1| thymidylate kinase [Brucella suis ATCC 23445]
          Length = 214

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 146/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRPAL EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKLIDADRSQEKIADEIRSVVDTILTEK 211


>gi|110633933|ref|YP_674141.1| thymidylate kinase [Mesorhizobium sp. BNC1]
 gi|123162339|sp|Q11HZ9|KTHY_MESSB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|110284917|gb|ABG62976.1| thymidylate kinase [Chelativorans sp. BNC1]
          Length = 225

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 142/214 (66%), Gaps = 3/214 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T I LL   L+R+  DV  TREPGG+P AEA RHVLLS   + FG
Sbjct: 5   GFFITFEGGEGAGKSTQIHLLADRLRREGRDVLTTREPGGSPGAEAIRHVLLSGAAEPFG 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EAI+FAAAR DHVE VIRPA+  G I+LCDRFLDSS  YQG        F+ +L+ +
Sbjct: 65  ATLEAILFAAARSDHVEQVIRPAVESGAIVLCDRFLDSSRVYQGVTGGLASDFMAALERV 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V  ++PD T+ILD+  + GL+R   R   R  A  D FE++++ IH +RR+ FL+IA  
Sbjct: 125 TVNGLIPDLTVILDIDPEEGLRRASER---RGKATADRFEKENLEIHRRRREAFLNIAAR 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           +P RC ++D++ S  +V+ N+  IV  ++  R  
Sbjct: 182 EPQRCVVIDASRSADAVSENVTEIVLRVIFDRAG 215


>gi|319408563|emb|CBI82216.1| Thymidylate kinase [Bartonella schoenbuchensis R1]
          Length = 214

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/210 (48%), Positives = 142/210 (67%), Gaps = 2/210 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EGAGKTT ISLL ++L+ KNYDV +TREPGGT  AEA R+VLLS   +++
Sbjct: 2   SGYFITFEGGEGAGKTTQISLLAQYLRSKNYDVVITREPGGTAGAEAMRYVLLSGNTEQY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           GA  EA++F AAR+DHV  VI P+L  GKI+LCDRF+DS   YQG  +      L  L  
Sbjct: 62  GAFIEAVLFTAARVDHVSEVILPSLQAGKIILCDRFIDSMRVYQGLNNKVNSHLLSVLGR 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I +  VMP+ T +LD+P   G++R   R   +E   +DYFE+  + I E+RRQ FL +AR
Sbjct: 122 IGLGTVMPNLTFLLDIPATFGMERTDLRR--KEIGKIDYFEKDQLNIQEQRRQAFLQLAR 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           N+P R  ++D+  + +++A+ I +I  +L+
Sbjct: 180 NEPFRFRVIDATCAVETIASQIKDICHQLI 209


>gi|161618946|ref|YP_001592833.1| thymidylate kinase [Brucella canis ATCC 23365]
 gi|260566467|ref|ZP_05836937.1| thymidylate kinase [Brucella suis bv. 4 str. 40]
 gi|189028828|sp|A9MB09|KTHY_BRUC2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|161335757|gb|ABX62062.1| thymidylate kinase [Brucella canis ATCC 23365]
 gi|260155985|gb|EEW91065.1| thymidylate kinase [Brucella suis bv. 4 str. 40]
          Length = 214

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 145/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRPAL EG+I+LCDRF+DS  AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPALAEGRIVLCDRFIDSGRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKIADEIRSVVDTILTEK 211


>gi|17987272|ref|NP_539906.1| thymidylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|148558979|ref|YP_001258934.1| thymidylate kinase [Brucella ovis ATCC 25840]
 gi|189024159|ref|YP_001934927.1| Thymidylate kinase [Brucella abortus S19]
 gi|225627470|ref|ZP_03785507.1| thymidylate kinase [Brucella ceti str. Cudo]
 gi|225852497|ref|YP_002732730.1| thymidylate kinase [Brucella melitensis ATCC 23457]
 gi|237815418|ref|ZP_04594416.1| thymidylate kinase [Brucella abortus str. 2308 A]
 gi|260545335|ref|ZP_05821076.1| thymidylate kinase [Brucella abortus NCTC 8038]
 gi|260563999|ref|ZP_05834485.1| thymidylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260754728|ref|ZP_05867076.1| dTMP kinase [Brucella abortus bv. 6 str. 870]
 gi|260757951|ref|ZP_05870299.1| dTMP kinase [Brucella abortus bv. 4 str. 292]
 gi|260883749|ref|ZP_05895363.1| thymidylate kinase [Brucella abortus bv. 9 str. C68]
 gi|261213980|ref|ZP_05928261.1| dTMP kinase [Brucella abortus bv. 3 str. Tulya]
 gi|261222160|ref|ZP_05936441.1| thymidylate kinase [Brucella ceti B1/94]
 gi|261314279|ref|ZP_05953476.1| thymidylate kinase [Brucella pinnipedialis M163/99/10]
 gi|261325087|ref|ZP_05964284.1| thymidylate kinase [Brucella neotomae 5K33]
 gi|261752297|ref|ZP_05996006.1| thymidylate kinase [Brucella suis bv. 5 str. 513]
 gi|261758182|ref|ZP_06001891.1| thymidylate kinase [Brucella sp. F5/99]
 gi|265988662|ref|ZP_06101219.1| thymidylate kinase [Brucella pinnipedialis M292/94/1]
 gi|265991077|ref|ZP_06103634.1| thymidylate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994912|ref|ZP_06107469.1| thymidylate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|265998125|ref|ZP_06110682.1| thymidylate kinase [Brucella ceti M490/95/1]
 gi|265999472|ref|ZP_05466544.2| thymidylate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|294852415|ref|ZP_06793088.1| thymidylate kinase [Brucella sp. NVSL 07-0026]
 gi|297248318|ref|ZP_06932036.1| thymidylate kinase [Brucella abortus bv. 5 str. B3196]
 gi|23821787|sp|Q8YH15|KTHY_BRUME RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|166221724|sp|A5VQD7|KTHY_BRUO2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|238689366|sp|B2S5K6|KTHY_BRUA1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|254808281|sp|C0RIW8|KTHY_BRUMB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|17982949|gb|AAL52170.1| thymidylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|148370236|gb|ABQ60215.1| thymidylate kinase [Brucella ovis ATCC 25840]
 gi|189019731|gb|ACD72453.1| Thymidylate kinase [Brucella abortus S19]
 gi|225617475|gb|EEH14520.1| thymidylate kinase [Brucella ceti str. Cudo]
 gi|225640862|gb|ACO00776.1| thymidylate kinase [Brucella melitensis ATCC 23457]
 gi|237790255|gb|EEP64465.1| thymidylate kinase [Brucella abortus str. 2308 A]
 gi|260096742|gb|EEW80617.1| thymidylate kinase [Brucella abortus NCTC 8038]
 gi|260154015|gb|EEW89107.1| thymidylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260668269|gb|EEX55209.1| dTMP kinase [Brucella abortus bv. 4 str. 292]
 gi|260674836|gb|EEX61657.1| dTMP kinase [Brucella abortus bv. 6 str. 870]
 gi|260873277|gb|EEX80346.1| thymidylate kinase [Brucella abortus bv. 9 str. C68]
 gi|260915587|gb|EEX82448.1| dTMP kinase [Brucella abortus bv. 3 str. Tulya]
 gi|260920744|gb|EEX87397.1| thymidylate kinase [Brucella ceti B1/94]
 gi|261301067|gb|EEY04564.1| thymidylate kinase [Brucella neotomae 5K33]
 gi|261303305|gb|EEY06802.1| thymidylate kinase [Brucella pinnipedialis M163/99/10]
 gi|261738166|gb|EEY26162.1| thymidylate kinase [Brucella sp. F5/99]
 gi|261742050|gb|EEY29976.1| thymidylate kinase [Brucella suis bv. 5 str. 513]
 gi|262552593|gb|EEZ08583.1| thymidylate kinase [Brucella ceti M490/95/1]
 gi|262766025|gb|EEZ11814.1| thymidylate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|263001861|gb|EEZ14436.1| thymidylate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094155|gb|EEZ18077.1| thymidylate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660859|gb|EEZ31120.1| thymidylate kinase [Brucella pinnipedialis M292/94/1]
 gi|294821004|gb|EFG38003.1| thymidylate kinase [Brucella sp. NVSL 07-0026]
 gi|297175487|gb|EFH34834.1| thymidylate kinase [Brucella abortus bv. 5 str. B3196]
 gi|326409013|gb|ADZ66078.1| Thymidylate kinase [Brucella melitensis M28]
 gi|326538723|gb|ADZ86938.1| thymidylate kinase [Brucella melitensis M5-90]
          Length = 214

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 145/213 (68%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKIADEIRSVVDTILTEK 211


>gi|261317627|ref|ZP_05956824.1| thymidylate kinase [Brucella pinnipedialis B2/94]
 gi|261296850|gb|EEY00347.1| thymidylate kinase [Brucella pinnipedialis B2/94]
          Length = 214

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 144/213 (67%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+    GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAKRGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKIADEIRSVVDTILTEK 211


>gi|261218666|ref|ZP_05932947.1| thymidylate kinase [Brucella ceti M13/05/1]
 gi|261321836|ref|ZP_05961033.1| thymidylate kinase [Brucella ceti M644/93/1]
 gi|260923755|gb|EEX90323.1| thymidylate kinase [Brucella ceti M13/05/1]
 gi|261294526|gb|EEX98022.1| thymidylate kinase [Brucella ceti M644/93/1]
          Length = 214

 Score =  207 bits (528), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 144/213 (67%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +   I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKITDEIRSVVDTILTEK 211


>gi|260761774|ref|ZP_05874117.1| dTMP kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260672206|gb|EEX59027.1| dTMP kinase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 214

 Score =  207 bits (528), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 144/213 (67%), Gaps = 3/213 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AE  RHV+LS   + +
Sbjct: 2   SGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAETIRHVILSGNAETY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ 
Sbjct: 62  GPAMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIER 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR
Sbjct: 122 IAIDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIAR 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 179 QEPARCKVIDADRSQEKIADEIRSVVDTILTEK 211


>gi|23501873|ref|NP_698000.1| thymidylate kinase [Brucella suis 1330]
 gi|254704286|ref|ZP_05166114.1| thymidylate kinase [Brucella suis bv. 3 str. 686]
 gi|23347812|gb|AAN29915.1| thymidylate kinase [Brucella suis 1330]
          Length = 211

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/211 (45%), Positives = 144/211 (68%), Gaps = 3/211 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +G 
Sbjct: 1   MFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETYGP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR DHV+ +IRPAL EG+I+LCDRF+DSS AYQG   +    ++ +++ I+
Sbjct: 61  AMEALLFAAARADHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR +
Sbjct: 121 IDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIARQE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 178 PARCKVIDADRSQEKIADEIRSVVDTILTEK 208


>gi|254719070|ref|ZP_05180881.1| thymidylate kinase [Brucella sp. 83/13]
 gi|306840480|ref|ZP_07473239.1| thymidylate kinase [Brucella sp. BO2]
 gi|306289495|gb|EFM60713.1| thymidylate kinase [Brucella sp. BO2]
          Length = 211

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/211 (45%), Positives = 144/211 (68%), Gaps = 3/211 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +G 
Sbjct: 1   MFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETYGP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR DHV+ +IRPAL EG+I+LCDRF+DSS AYQG   +    ++ +++ I+
Sbjct: 61  AMEALLFAAARADHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR +
Sbjct: 121 IDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIARQE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 178 PARCKVIDADRSQEKIADEIRSVVDTILAEK 208


>gi|62289916|ref|YP_221709.1| thymidylate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82699843|ref|YP_414417.1| thymidylate kinase [Brucella melitensis biovar Abortus 2308]
 gi|254689223|ref|ZP_05152477.1| thymidylate kinase [Brucella abortus bv. 6 str. 870]
 gi|254693708|ref|ZP_05155536.1| thymidylate kinase [Brucella abortus bv. 3 str. Tulya]
 gi|254701744|ref|ZP_05163572.1| thymidylate kinase [Brucella suis bv. 5 str. 513]
 gi|254706812|ref|ZP_05168640.1| thymidylate kinase [Brucella pinnipedialis M163/99/10]
 gi|254730256|ref|ZP_05188834.1| thymidylate kinase [Brucella abortus bv. 4 str. 292]
 gi|256031574|ref|ZP_05445188.1| thymidylate kinase [Brucella pinnipedialis M292/94/1]
 gi|256044653|ref|ZP_05447557.1| thymidylate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061085|ref|ZP_05451240.1| thymidylate kinase [Brucella neotomae 5K33]
 gi|256113539|ref|ZP_05454365.1| thymidylate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|256159712|ref|ZP_05457459.1| thymidylate kinase [Brucella ceti M490/95/1]
 gi|256254974|ref|ZP_05460510.1| thymidylate kinase [Brucella ceti B1/94]
 gi|256257473|ref|ZP_05463009.1| thymidylate kinase [Brucella abortus bv. 9 str. C68]
 gi|256369414|ref|YP_003106922.1| thymidylate kinase [Brucella microti CCM 4915]
 gi|260168705|ref|ZP_05755516.1| thymidylate kinase [Brucella sp. F5/99]
 gi|62196048|gb|AAX74348.1| Tmk, thymidylate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82615944|emb|CAJ10967.1| Thymidylate kinase:ATP/GTP-binding site motif A (P-loop) [Brucella
           melitensis biovar Abortus 2308]
 gi|255999574|gb|ACU47973.1| thymidylate kinase [Brucella microti CCM 4915]
          Length = 211

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 143/211 (67%), Gaps = 3/211 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +G 
Sbjct: 1   MFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETYGP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ I+
Sbjct: 61  AMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR +
Sbjct: 121 IDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIARQE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 178 PARCKVIDADRSQEKIADEIRSVVDTILTEK 208


>gi|254710078|ref|ZP_05171889.1| thymidylate kinase [Brucella pinnipedialis B2/94]
          Length = 211

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 142/211 (67%), Gaps = 3/211 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +G 
Sbjct: 1   MFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETYGP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ I+
Sbjct: 61  AMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++LD+    GL R   R   R S   D FE++D+ +HE RRQ FL+IAR +
Sbjct: 121 IDGAMPDLTLVLDICAKRGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIARQE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 178 PARCKVIDADRSQEKIADEIRSVVDTILTEK 208


>gi|254714079|ref|ZP_05175890.1| thymidylate kinase [Brucella ceti M644/93/1]
 gi|254716864|ref|ZP_05178675.1| thymidylate kinase [Brucella ceti M13/05/1]
          Length = 211

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 142/211 (67%), Gaps = 3/211 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AEA RHV+LS   + +G 
Sbjct: 1   MFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNAETYGP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ I+
Sbjct: 61  AMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR +
Sbjct: 121 IDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIARQE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P RC ++D+  S + +   I ++V  ++ ++
Sbjct: 178 PARCKVIDADRSQEKITDEIRSVVDTILTEK 208


>gi|254697358|ref|ZP_05159186.1| thymidylate kinase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 211

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 142/211 (67%), Gaps = 3/211 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EGAGK+T I+LL   L+   +D  +TREPGG+P AE  RHV+LS   + +G 
Sbjct: 1   MFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAETIRHVILSGNAETYGP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR DHV+ +IRP L EG+I+LCDRF+DSS AYQG   +    ++ +++ I+
Sbjct: 61  AMEALLFAAARADHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++LD+  + GL R   R   R S   D FE++D+ +HE RRQ FL+IAR +
Sbjct: 121 IDGAMPDLTLVLDICAERGLSRAGKR---RGSDTADRFEKEDIAVHEARRQAFLEIARQE 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P RC ++D+  S + +A  I ++V  ++ ++
Sbjct: 178 PARCKVIDADRSQEKIADEIRSVVDTILTEK 208


>gi|319783485|ref|YP_004142961.1| thymidylate kinase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169373|gb|ADV12911.1| thymidylate kinase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 231

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 134/200 (67%), Gaps = 2/200 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +  G FI+FEG EGAGK+T I  L R ++ K YDV +TREPGG+P AEA RHVLLS   +
Sbjct: 8   LARGFFITFEGGEGAGKSTQIERLARKMRAKKYDVLLTREPGGSPGAEAVRHVLLSGAAE 67

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            FG + EA++FAAAR DHVE VIRPA+  G I+LCDRFLDSS  YQG        F+D+L
Sbjct: 68  PFGPKMEALLFAAARSDHVEQVIRPAVERGSIVLCDRFLDSSRVYQGVTGGIDPAFMDAL 127

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +++++  +MPD T+I D+    GL+R   R      A  D FE++ + IH+ RR+ FL I
Sbjct: 128 EQVAINGMMPDMTLIFDIDPAEGLRRATLRRGA--EAVADRFEKETLAIHQARREAFLAI 185

Query: 181 ARNQPDRCHIVDSAHSFQSV 200
           A+ +P+RC +VD+A    +V
Sbjct: 186 AKAEPERCIVVDAAAEPDAV 205


>gi|163868322|ref|YP_001609531.1| thymidylate kinase [Bartonella tribocorum CIP 105476]
 gi|161017978|emb|CAK01536.1| Thymidylate kinase [Bartonella tribocorum CIP 105476]
          Length = 214

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 137/215 (63%), Gaps = 2/215 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG +G GKT  ISLL  +L  + YDV  TREPGGT  AEA RH+LLS  V ++
Sbjct: 2   SGYFITFEGGDGVGKTVQISLLAEYLSHQGYDVVTTREPGGTAGAEAIRHILLSGKVQQY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++F AAR DHV  +I P+L +GKI+LCDRF+DS+  YQG  +      L  L+ 
Sbjct: 62  GPLIEAVLFTAARTDHVAEIIAPSLQKGKIVLCDRFIDSTRVYQGLNERVNSSLLSVLEC 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++  +MP  T +LD+P   G+KR   R    E   +DYFE+K + I E+RRQ FL +A+
Sbjct: 122 IALNGIMPHLTFLLDMPAACGIKRANLRRKKTEE--IDYFEKKPLEIQEQRRQAFLQLAK 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            +P R  ++D+  S + +A  I NI  +++  ++S
Sbjct: 180 QEPHRFRVIDATGSVEVIAHQIKNICHQVLLDKLS 214


>gi|121602268|ref|YP_989111.1| thymidylate kinase [Bartonella bacilliformis KC583]
 gi|120614445|gb|ABM45046.1| thymidylate kinase [Bartonella bacilliformis KC583]
          Length = 213

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 139/209 (66%), Gaps = 2/209 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG GKTT ISLL  + + K Y+V +TREPGGT  AE  R++LLS    ++G
Sbjct: 2   GYFITFEGGEGVGKTTQISLLAHYFRSKGYEVVITREPGGTAGAEIIRYILLSGSAIQYG 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           +  EA++F AAR DHV  VI+PAL  GKI+LCDRF+DS+  YQG  +      L  L+ I
Sbjct: 62  SFIEAVLFTAARADHVAEVIKPALQAGKIVLCDRFIDSTRVYQGLNNKVDSYLLSILECI 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  VMP+ T +LD+P    ++RV+ R   +ES  +D+FE+ ++ I E+RRQ FL +A+N
Sbjct: 122 GINGVMPNLTFLLDVPAISSMERVKLRR--KESGIIDHFEKDELKIQEQRRQAFLQLAKN 179

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +P+R  ++D+  + + +A  I +I  +++
Sbjct: 180 EPNRIQVIDATGTVEEIACQIKDICHQVI 208


>gi|319407218|emb|CBI80857.1| Thymidylate kinase [Bartonella sp. 1-1C]
          Length = 213

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 137/210 (65%), Gaps = 2/210 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EG GKTT ISLL ++L RK YDV +TREPGGT  AEA R++LLS  V ++
Sbjct: 2   SGYFITFEGGEGVGKTTQISLLSQYLGRKGYDVIITREPGGTAGAEAIRYILLSGSVAQY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   E  +F AAR DHV  +I P+L  GKI+LCDRF+DS+  YQG  +         L+ 
Sbjct: 62  GPFIETFLFTAARADHVSEIIIPSLQAGKIVLCDRFIDSTRVYQGINNKVDAHIFSILEH 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I ++ + PD T +LD+P  +G++RV  R    E   +DYFE+ D+ I E+RRQ FL++A+
Sbjct: 122 IGMKGIKPDLTFLLDIPTKLGIERVNLRRKRIEK--IDYFEKDDLAIQEQRRQAFLELAK 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           ++P R  ++D   + + +A  I +I  +L+
Sbjct: 180 HEPHRFQVIDGTCAVEVIADQIKDICHQLL 209


>gi|240850633|ref|YP_002972033.1| thymidylate kinase [Bartonella grahamii as4aup]
 gi|240267756|gb|ACS51344.1| thymidylate kinase [Bartonella grahamii as4aup]
          Length = 214

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 139/215 (64%), Gaps = 2/215 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG +G GKT  ISLL   L  + YDV  TREPGGT  AEA RH+LLS    ++
Sbjct: 2   SGYFITFEGGDGVGKTVQISLLAESLSHQGYDVVTTREPGGTLGAEAIRHILLSGQAQQY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++F AAR+DHV  VI P+L +GKI+LCDRF+DS+  YQG  D+     L  L+ 
Sbjct: 62  GPLIEAVLFTAARVDHVTEVIAPSLQKGKIVLCDRFIDSTRVYQGLNDTVSSSLLAVLEC 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I++  ++P  T +LD+P   G+KR   R   +E+  +DYFE+  + + E+RRQ FL +A+
Sbjct: 122 IALNGILPHLTFLLDMPAMCGMKRANLRR--KETEEIDYFEKDQLEVQEQRRQAFLQLAK 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            +P R  ++D+  S ++VA  I NI  +++  ++S
Sbjct: 180 QEPHRFRVIDATGSVEAVAHQIKNICHQVLLDKLS 214


>gi|319405648|emb|CBI79271.1| Thymidylate kinase [Bartonella sp. AR 15-3]
          Length = 210

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 133/205 (64%), Gaps = 5/205 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EGAGKTT ISLL + L RK YDV +TREPGGT  AEA R++LLS  V E+
Sbjct: 2   SGYFITFEGGEGAGKTTQISLLAQHLGRKGYDVIITREPGGTAGAEAIRYILLSGSVAEY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   E  +F AAR DHV  +I+P+L  GKI+LCDRF+DS+  YQG  +         L+ 
Sbjct: 62  GPFIETFLFTAARADHVSEIIKPSLQAGKIVLCDRFIDSTRVYQGLDNKVDAHIFSILEH 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I ++ + PD T +LD+P  +G++RV  R        +DYFE+  + + E+RRQ FL++A+
Sbjct: 122 IGMKGIKPDLTFLLDIPAKLGMERVNLR-----RKKIDYFEKASLALQEQRRQAFLELAK 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNI 207
           ++P R  ++D   S + +A  I +I
Sbjct: 177 HEPHRFQVIDGTCSVEVIADQIKDI 201


>gi|49474220|ref|YP_032262.1| thymidylate kinase [Bartonella quintana str. Toulouse]
 gi|59798258|sp|Q6FZU8|KTHY_BARQU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|49239724|emb|CAF26103.1| Thymidylate kinase [Bartonella quintana str. Toulouse]
          Length = 214

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 139/214 (64%), Gaps = 2/214 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EG GKTT ISLL ++L+ + YDV  TREPGGT  AEA RH+LLS     +
Sbjct: 2   SGYFITFEGGEGVGKTTQISLLAQYLRNQGYDVLTTREPGGTVGAEAIRHILLSGQAQNY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   E I+  AAR+DH+  VI P+L +GKI+LCDRF+DS+  YQG  ++     L  L+ 
Sbjct: 62  GPLIEVILLTAARIDHITEVIAPSLQKGKIVLCDRFIDSTRVYQGLNNTVGSSVLSVLEY 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +++  +MP  T +LD+P   G++R   R   +++  +DYFE+ ++ I E+RRQ FL +A+
Sbjct: 122 VALNGIMPCLTFLLDIPARCGMERANLRR--KKAETIDYFEKDELKIQEQRRQAFLQLAK 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            +P R  ++D+  + + +A  I NI  +++  +V
Sbjct: 180 QEPHRFRVIDATGAMEVIAQQIKNICHQVILDQV 213


>gi|319404208|emb|CBI77801.1| Thymidylate kinase [Bartonella rochalimae ATCC BAA-1498]
          Length = 217

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/215 (45%), Positives = 139/215 (64%), Gaps = 8/215 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EG GKTT ISLL ++L RK YDV +TREPGGT  AEA R++LLS  V ++
Sbjct: 2   SGYFITFEGGEGVGKTTQISLLAQYLGRKGYDVIITREPGGTAGAEAIRYILLSGSVAQY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDS-----SQHLFL 117
           G   E  +F AAR DHV  +I P+L  GKI+LCDRF+DS+  YQG           H+F 
Sbjct: 62  GPFIETFLFTAARADHVSEIIMPSLQAGKIVLCDRFIDSTRVYQGINKGINNRVDAHIF- 120

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
             L+ I ++ + PD T +LD+P  +G++RV  R    E   +DYFE+ D+ I E+RRQ F
Sbjct: 121 SILEHIGMKGIKPDLTFLLDIPAKLGIERVNLRRKKIEK--IDYFEKDDLAIQEQRRQAF 178

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           L++A+++P R  ++D   + + +A  I +I  +L+
Sbjct: 179 LELAKHEPYRFQVIDGTCAVEVIADQIKDICHQLL 213


>gi|146340769|ref|YP_001205817.1| thymidylate kinase [Bradyrhizobium sp. ORS278]
 gi|166221723|sp|A4YUL6|KTHY_BRASO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|146193575|emb|CAL77592.1| thymidylate kinase [Bradyrhizobium sp. ORS278]
          Length = 226

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 139/213 (65%), Gaps = 7/213 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F++FEG EGAGK+T I +L   L++    V +TREPGG+P AE  RH++LS      G
Sbjct: 13  GRFVTFEGGEGAGKSTQIKMLADRLEKDGVRVVLTREPGGSPGAEIMRHLVLSGMGKLLG 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AEAE ++FAAAR DHV NVI PAL +G  +LCDRF DS+ AYQG +       L+++Q +
Sbjct: 73  AEAETLLFAAARDDHVRNVILPALNQGSWVLCDRFFDSTRAYQGSQGKVAPDVLNAMQRV 132

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD T+ILD+PV++GL+R   R   R S   D FE +D+  H+  R  F  IA  
Sbjct: 133 TIGDLKPDLTLILDVPVEVGLQRASAR---RGSGAPDRFESEDIKFHKGLRDAFHKIAAT 189

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           +P RC ++D+  S ++V+    NIVW+ V++R+
Sbjct: 190 EPRRCVLIDATASAEAVS----NIVWDAVRERL 218


>gi|307942275|ref|ZP_07657626.1| thymidylate kinase [Roseibium sp. TrichSKD4]
 gi|307774561|gb|EFO33771.1| thymidylate kinase [Roseibium sp. TrichSKD4]
          Length = 229

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 128/206 (62%), Gaps = 1/206 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+FEG EGAGKTT I+ LK+ L+     + +TREPGG+P AE  R +LLS    + 
Sbjct: 2   TGQFITFEGGEGAGKTTQIARLKQRLEELGKTICLTREPGGSPGAEKIREMLLSGAARKL 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+ VI PAL+ G  ++CDRF DS+  YQGE        LD L+ 
Sbjct: 62  GPRGEAMLFAAARADHVDGVIAPALVRGDWVICDRFADSTRVYQGEAGVDNET-LDLLET 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I+V    PD TI++D+P DIGL RV +R    +S   D FE   +  HE+RR +FLD+A+
Sbjct: 121 IAVAGTRPDLTILIDIPADIGLSRVSSRSKTDDSGGPDRFEADTIATHERRRSLFLDLAK 180

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
            QP+R  +VD  H    VA  I   V
Sbjct: 181 QQPERFVVVDGRHDPDHVAGEIWWAV 206


>gi|319898926|ref|YP_004159019.1| Thymidylate kinase [Bartonella clarridgeiae 73]
 gi|319402890|emb|CBI76441.1| Thymidylate kinase [Bartonella clarridgeiae 73]
          Length = 210

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 138/210 (65%), Gaps = 5/210 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EGAGKTT ISLL + L  K YDV +TREPGGT  AEA R++LLS  V ++
Sbjct: 2   SGYFITFEGGEGAGKTTQISLLAQHLGSKGYDVIITREPGGTVGAEAIRYILLSGSVAQY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   E ++F AAR DHV  +I+P+L  GKI+LCDRF+DS+  YQG  +      L  L+ 
Sbjct: 62  GPFIETVLFTAARADHVAEIIKPSLQAGKIVLCDRFIDSTRVYQGINNKVDTHILSILEY 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I ++ + PD T +LD+P   G++R+    +LR    ++YFE+ D+ I E+RRQ FL++A+
Sbjct: 122 IGMKGIKPDLTFLLDIPAKFGIERI----NLRRKK-INYFEKDDLDIQEQRRQAFLELAK 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           ++P R  ++D   + + +A  I +I   ++
Sbjct: 177 HEPHRFQVIDGTCAVEVIADQIKDICHRVI 206


>gi|114704619|ref|ZP_01437527.1| THYMIDYLATE KINASE [Fulvimarina pelagi HTCC2506]
 gi|114539404|gb|EAU42524.1| THYMIDYLATE KINASE [Fulvimarina pelagi HTCC2506]
          Length = 226

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 132/203 (65%), Gaps = 3/203 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+FEG +G+GKTT +  L + L+   +DV  TREPGGTP A+A RHV+LS    +F
Sbjct: 2   AGKFITFEGGDGSGKTTQVLRLAKMLREYGFDVVTTREPGGTPGADAIRHVVLSGAARDF 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DH++ VIRPAL EG I++CDRF DS+  YQ         FLD L+ 
Sbjct: 62  GPNIEAVLFAAARADHLDKVIRPALEEGAIVICDRFHDSTRVYQAATKDLDLAFLDRLET 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++  V PD TIILD+P ++G +R + R S  E+   D FE   + +H +RR+ FL IA 
Sbjct: 122 ATLDGVAPDLTIILDVPAELGYERAKARRSEAEA---DRFESDALDVHAERRERFLAIAE 178

Query: 183 NQPDRCHIVDSAHSFQSVATNIL 205
           ++PDRC ++D     + +A +I+
Sbjct: 179 DEPDRCVVIDGRGEEEEIAEDIV 201


>gi|118589860|ref|ZP_01547264.1| THYMIDYLATE KINASE [Stappia aggregata IAM 12614]
 gi|118437357|gb|EAV43994.1| THYMIDYLATE KINASE [Stappia aggregata IAM 12614]
          Length = 241

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 135/215 (62%), Gaps = 5/215 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EGAGK+T I+ LK +L+     V VTREPGG+P AE  R +LLS G  + 
Sbjct: 15  SGHFITFEGGEGAGKSTQIARLKTYLEGMGQSVVVTREPGGSPGAEKIRTMLLSGGAKDL 74

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G   EA++FAAAR DHV+  I+PAL  G  +LCDR+ DS++ YQGE    +  +L  L+ 
Sbjct: 75  GPRGEAMLFAAARADHVDTTIKPALERGDWVLCDRYADSTWVYQGEAGVDRE-YLKLLET 133

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +V  V PD TI++D+PV+IGL RV  R     S   D FE +D+ +H++RR++FL++A+
Sbjct: 134 AAVAGVYPDLTILIDVPVEIGLGRVAERSRTDNSGGPDRFEDEDLKVHQRRRELFLELAK 193

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            +  R  ++D +     VA  I     E VQK  S
Sbjct: 194 IESFRFAVIDGSKGLDEVAAAIR----EAVQKTFS 224


>gi|158423797|ref|YP_001525089.1| thymidylate kinase [Azorhizobium caulinodans ORS 571]
 gi|158330686|dbj|BAF88171.1| thymidylate kinase [Azorhizobium caulinodans ORS 571]
          Length = 235

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/223 (43%), Positives = 136/223 (60%), Gaps = 13/223 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GK+T    L   LQ+   +V +TREPGG+  AEA RHVLLS    +FG
Sbjct: 6   GRFITLEGGEGTGKSTQARRLAAALQKGGLEVVLTREPGGSAGAEAVRHVLLSGAAKDFG 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + EA++FAAAR DHV+++IRPAL  GK ++CDRF+DS+  YQG   +     LDSL+ +
Sbjct: 66  PQGEALLFAAARADHVDSLIRPALAAGKWVICDRFIDSTRVYQGAVGAVPGALLDSLEWV 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +  E  PD T++LD+P ++GL R   R    E A  D FE + +  H + R  FL +A+ 
Sbjct: 126 AAAEARPDLTLVLDVPPEVGLSRAAGRG---EGA--DRFESEGLAFHTRVRDAFLALAKA 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV----SPLSSK 222
            P RC IVD++     VA     +VW  V++R+     PLS+K
Sbjct: 181 DPARCVIVDASGGPDDVAA----LVWSSVRERLVPPERPLSAK 219


>gi|13470654|ref|NP_102223.1| thymidylate kinase [Mesorhizobium loti MAFF303099]
 gi|23821805|sp|Q98MV4|KTHY_RHILO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|14021396|dbj|BAB48009.1| thymidylate kinase [Mesorhizobium loti MAFF303099]
          Length = 224

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 136/216 (62%), Gaps = 2/216 (0%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EGAGK+T I  L R +  K YDV +TREPGG+P AEA RHVLLS   +
Sbjct: 1   MARGFFITFEGGEGAGKSTQIERLARKMHAKKYDVLLTREPGGSPGAEAVRHVLLSGAAE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            FG + EA++FAAAR DHVE VIRPA+  G I+LCDRFLDSS  YQG        F+ +L
Sbjct: 61  PFGPKMEALLFAAARSDHVEQVIRPAVERGSIVLCDRFLDSSRVYQGVTGGIDPAFMATL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++I++  +MPD T+I D+    GL+R   R      A  D FE++ + IH+ RR  FL I
Sbjct: 121 EQIAINGMMPDMTLIFDIDPAEGLRRATLRRG--SDAGADRFEKETLAIHQARRAAFLAI 178

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           A  +P+RC +VD++    +V   +   V+  ++ R 
Sbjct: 179 AAAEPERCIVVDASADPNTVEDVVTAAVFAALEARA 214


>gi|260459470|ref|ZP_05807725.1| thymidylate kinase [Mesorhizobium opportunistum WSM2075]
 gi|259035024|gb|EEW36280.1| thymidylate kinase [Mesorhizobium opportunistum WSM2075]
          Length = 248

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 137/213 (64%), Gaps = 2/213 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T I  L R ++ K YDV +TREPGG+P AEA RHVLLS   + FG
Sbjct: 28  GFFITFEGGEGAGKSTQIERLARKMRAKKYDVLLTREPGGSPGAEAVRHVLLSGAAEPFG 87

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + EA++FAAAR DHVE VIRPA+  G I+LCDRFLDSS  YQG        F+ +L+++
Sbjct: 88  PKMEALLFAAARSDHVEQVIRPAVERGSIVLCDRFLDSSRVYQGVTGGIDPAFMATLEQV 147

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++  +MPD T+I D+    GL+R   R    + A  D FE++ + IH+ RR  FL IA  
Sbjct: 148 AINGMMPDMTLIFDIDPAEGLRRATLRRGSDDGA--DRFEKETLAIHQARRAAFLAIAAA 205

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           +P+RC +VD++    +V   +   V+  ++ R 
Sbjct: 206 EPERCIVVDASAKPDTVEDVVTAAVFAALEARA 238


>gi|49475610|ref|YP_033651.1| thymidylate kinase [Bartonella henselae str. Houston-1]
 gi|59798266|sp|Q6G5D6|KTHY_BARHE RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|49238417|emb|CAF27644.1| Thymidylate kinase [Bartonella henselae str. Houston-1]
          Length = 215

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 131/207 (63%), Gaps = 5/207 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE- 61
           SG FI+FEG EG GKTT I LL + L  K YDV  TREPGGT  AE  RH+LLS  V + 
Sbjct: 2   SGYFITFEGGEGVGKTTQIFLLAQHLYGKGYDVLTTREPGGTAGAEVIRHILLSGQVQQH 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +G   EAI+F AAR+DHV  VI P+L +GK++LCDRF+DS+  YQG  D      L  L+
Sbjct: 62  YGPLIEAILFTAARIDHVSEVIMPSLQKGKVVLCDRFIDSTRVYQGLNDKVSSSTLAVLE 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA-CLDYFERKDVMIHEKRRQIFLDI 180
            +++ ++ P  T +LD+P    +KR   R   RE A  +DYFE+ ++ I E+RRQ FL +
Sbjct: 122 CLALNKIKPQITFLLDIPARCSMKRANLR---REKAETIDYFEKDELKIQEQRRQAFLQL 178

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNI 207
           A+ +P R  ++D   + + +A  I +I
Sbjct: 179 AKQEPHRFRVIDGTDTVEVIAQQIRDI 205


>gi|90417679|ref|ZP_01225591.1| thymidylate kinase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337351|gb|EAS51002.1| thymidylate kinase [Aurantimonas manganoxydans SI85-9A1]
          Length = 222

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 133/202 (65%), Gaps = 3/202 (1%)

Query: 7   ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEA 66
           ++FEG EG+GKTT I+ L   L+ + +DV  TREPGG+P A+A RHV+LS   +  G E 
Sbjct: 1   MTFEGGEGSGKTTQIARLAGHLRSEGHDVVTTREPGGSPGADALRHVILSGAAEGLGVEV 60

Query: 67  EAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQ 126
           EA++FAAAR DHV+ +IRPAL  GKI+LCDRF DS+  YQ         + D+++  ++ 
Sbjct: 61  EAMLFAAARADHVDTLIRPALDAGKIVLCDRFHDSTRVYQFLDSELDQDYRDAMERAALG 120

Query: 127 EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPD 186
           +++P+ TIILD+P  +G++R + R   R     D FE++D  +HE+RRQ F  +A ++P+
Sbjct: 121 DLLPNLTIILDVPASVGVERARQR---RADHSPDRFEKEDEALHERRRQAFRKLAEDEPE 177

Query: 187 RCHIVDSAHSFQSVATNILNIV 208
           RC IVD   +   VA  I +++
Sbjct: 178 RCVIVDGTQAEDKVAAEIRDLI 199


>gi|90424201|ref|YP_532571.1| thymidylate kinase [Rhodopseudomonas palustris BisB18]
 gi|122476154|sp|Q214D4|KTHY_RHOPB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|90106215|gb|ABD88252.1| thymidylate kinase [Rhodopseudomonas palustris BisB18]
          Length = 230

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 135/215 (62%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF- 62
           G FI+FEG EGAGK+T I LL   L        +TREPGG+P AE  RH++LS G+    
Sbjct: 13  GRFITFEGGEGAGKSTQIKLLAERLNAGRIRCVLTREPGGSPGAEIIRHMILS-GIGSLI 71

Query: 63  -GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G EAE ++FAAAR DHV  VI PAL +G  +LCDRF DS+ AYQG+  +     L+++Q
Sbjct: 72  GGTEAETLLFAAARDDHVHTVIEPALAQGSWVLCDRFTDSTRAYQGQMGAVAPALLNAMQ 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +++ ++ PD TIILD+PV+IG+KR + R   R +A  D FE + +  H K R+ +  IA
Sbjct: 132 RVTIGDLKPDLTIILDVPVEIGVKRARLR---RGAAEPDRFEAESLEFHRKLREAYRQIA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            ++P RC ++D+    + VA      VW  VQKR+
Sbjct: 189 ADEPQRCVLIDANAKVKPVAAK----VWAAVQKRL 219


>gi|192291490|ref|YP_001992095.1| thymidylate kinase [Rhodopseudomonas palustris TIE-1]
 gi|238692602|sp|B3QKH1|KTHY_RHOPT RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|192285239|gb|ACF01620.1| dTMP kinase [Rhodopseudomonas palustris TIE-1]
          Length = 230

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 138/215 (64%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF- 62
           G FI+FEG EGAGK+T I LL + L++      VTREPGG+P AEA R  LL+ G+ +  
Sbjct: 13  GRFITFEGGEGAGKSTQIRLLAKRLEKARLRTLVTREPGGSPGAEAIRSALLA-GIGKLI 71

Query: 63  -GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            GA+AEA++FAAAR DHV  +I PAL  G+ +LCDRF DS+ AYQG+  +     L++LQ
Sbjct: 72  GGADAEALLFAAARDDHVRTLIEPALARGEWVLCDRFYDSTRAYQGKLGAVSLDLLNALQ 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++++ ++ PD T+ILD+PV+IGL R   R   R S   D FE + +  H   R++F  IA
Sbjct: 132 QVTIGDMKPDLTVILDIPVEIGLARAAVR---RGSETPDRFESEAIDFHRGLREVFRQIA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             +P+RC ++D+    + VA  I    W+ V+ R+
Sbjct: 189 AQEPERCALIDANAEPEEVADRI----WQAVRLRL 219


>gi|316934063|ref|YP_004109045.1| thymidylate kinase [Rhodopseudomonas palustris DX-1]
 gi|315601777|gb|ADU44312.1| thymidylate kinase [Rhodopseudomonas palustris DX-1]
          Length = 230

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 139/215 (64%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF- 62
           G FI+FEG EGAGK+T I LL + L++      VTREPGG+P AEA R  LL+ G+ +  
Sbjct: 13  GRFITFEGGEGAGKSTQIRLLAKRLEKARLRTLVTREPGGSPGAEAIRSALLA-GIGKLI 71

Query: 63  -GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            GA+AEA++FAAAR DHV  +I PAL  G+ +LCDRF DS+ AYQG+  + +   L++LQ
Sbjct: 72  GGADAEALLFAAARDDHVRTLIEPALARGEWVLCDRFYDSTRAYQGKLGAVRLELLEALQ 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++++ ++ PD T+ILD+PV+IGL R   R   R S   D FE + +  H   R++F  IA
Sbjct: 132 QVTIGDMKPDLTVILDIPVEIGLARAAVR---RGSETPDRFESEAIDFHRGLREVFRQIA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             +P+RC ++D+    + VA      VW+ V+ R+
Sbjct: 189 AQEPERCVLIDANAEPEEVADR----VWQAVRLRL 219


>gi|39935842|ref|NP_948118.1| thymidylate kinase [Rhodopseudomonas palustris CGA009]
 gi|81562489|sp|Q6N643|KTHY_RHOPA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|39649696|emb|CAE28217.1| thymidylate kinase [Rhodopseudomonas palustris CGA009]
          Length = 230

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 138/215 (64%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF- 62
           G FI+FEG EGAGK+T I LL + L++      VTREPGG+P AEA R  LL+ G+ +  
Sbjct: 13  GRFITFEGGEGAGKSTQIRLLAKRLEKARLRTLVTREPGGSPGAEAIRSALLA-GIGKLI 71

Query: 63  -GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            GA+AEA++FAAAR DHV  +I PAL  G+ +LCDRF DS+ AYQG+  +     L++LQ
Sbjct: 72  GGADAEALLFAAARDDHVRTLIEPALARGEWVLCDRFYDSTRAYQGKLGAVSLDLLNALQ 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++++ ++ PD T+ILD+PV+IGL R   R   R S   D FE + +  H   R++F  IA
Sbjct: 132 QVTIGDMKPDLTVILDIPVEIGLARAAVR---RGSETPDRFESEAIDFHRGLREVFRQIA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             +P+RC ++D+    + VA  I    W+ V+ R+
Sbjct: 189 AQEPERCVLIDANAEPEEVADRI----WQAVRLRL 219


>gi|92117540|ref|YP_577269.1| thymidylate kinase [Nitrobacter hamburgensis X14]
 gi|122417817|sp|Q1QLT8|KTHY_NITHX RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|91800434|gb|ABE62809.1| thymidylate kinase [Nitrobacter hamburgensis X14]
          Length = 230

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (61%), Gaps = 7/213 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG+GK+T I++L   L        VTREPGG+P AE  RH++LS      G
Sbjct: 13  GRFITFEGGEGSGKSTQINILAERLNAAKLRAIVTREPGGSPGAEIIRHLVLSGMGKLLG 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A AE ++FAAAR DHV  VI+PAL +G  +LCDRF DS+ AYQG         L++L+ +
Sbjct: 73  AYAETLLFAAARDDHVHTVIKPALEQGIWVLCDRFADSTRAYQGRLGDVLPGVLNALERV 132

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD T+ILD+PV+IG++R   R   R S   D FE +DV  H+K R  + DIA +
Sbjct: 133 TIGDLKPDLTVILDVPVEIGMQRAAVR---RGSGAPDRFEAEDVAFHQKLRDAYRDIAAS 189

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            P RC ++D+     +VA      VW  ++ RV
Sbjct: 190 DPQRCVVIDANADVNTVAAG----VWAALRDRV 218


>gi|115524871|ref|YP_781782.1| thymidylate kinase [Rhodopseudomonas palustris BisA53]
 gi|115518818|gb|ABJ06802.1| thymidylate kinase [Rhodopseudomonas palustris BisA53]
          Length = 229

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 133/215 (61%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF- 62
           G FISFEG EGAGK+T I LL + L+R      +TREPGG+P AE  RH+LLS G+    
Sbjct: 12  GRFISFEGGEGAGKSTQIKLLAQRLERAGLRTKITREPGGSPGAEIIRHLLLS-GIGSLI 70

Query: 63  -GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            GA AE ++FAAAR DHV  VI PAL +G  +LCDRF DS+ AYQG   +     L++L+
Sbjct: 71  GGASAETVLFAAARDDHVHTVIAPALAQGTWVLCDRFSDSTRAYQGRLGAVPPALLNALE 130

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +++  + PD T+ILD+PV+ G++R   R   R  A  D FE + +  H   R+ +  IA
Sbjct: 131 RVTIDGLKPDLTLILDVPVETGVRRAAVR---RGDATPDRFEAEGLEFHRGLREAYRQIA 187

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            + P RC ++D+  + ++VA      VW  V++R+
Sbjct: 188 ADNPQRCVLIDADAALETVAER----VWNAVRQRL 218


>gi|295689513|ref|YP_003593206.1| thymidylate kinase [Caulobacter segnis ATCC 21756]
 gi|295431416|gb|ADG10588.1| thymidylate kinase [Caulobacter segnis ATCC 21756]
          Length = 208

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 128/214 (59%), Gaps = 6/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FISFEG EGAGK+T I  L   LQ   +DV VTREPGG+P AEA R +L++   D
Sbjct: 1   MTQGFFISFEGGEGAGKSTQIRRLAERLQAAGHDVVVTREPGGSPGAEAIRELLVNGAAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    E ++  AAR DHVE VIRPAL  G ++LCDRF DS+ AYQG    +    + SL
Sbjct: 61  RWSPVTETLLMYAARRDHVERVIRPALARGAVVLCDRFADSTRAYQGAGGDAPASLIASL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++  +   +PD T+ILDLP +IGL+R + R           FE K +  HE+ R  +L+I
Sbjct: 121 EDHVLSGTVPDLTLILDLPAEIGLERAEAR------GGAARFESKGLAFHERLRAGYLEI 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           AR +P+RC ++++     +V   I   V + +++
Sbjct: 175 ARREPERCVVIEANADIDAVTAAISRTVDQRLER 208


>gi|163853588|ref|YP_001641631.1| dTMP kinase [Methylobacterium extorquens PA1]
 gi|163665193|gb|ABY32560.1| dTMP kinase [Methylobacterium extorquens PA1]
          Length = 244

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 131/210 (62%), Gaps = 7/210 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG EGAGK+T I+ L   L+R    +V  TREPGGT  AEA R  LL      +
Sbjct: 8   GVFITFEGGEGAGKSTQIARLAETLRRVSGREVVTTREPGGTERAEALRAALLRGVAKPY 67

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G  AEA++FAAAR+DH+EN+IRPAL  G I+LCDRF DS+ AYQG         +DSL+ 
Sbjct: 68  GPFAEALMFAAARIDHIENLIRPALDRGAIVLCDRFSDSTRAYQGAAGGLDPALIDSLER 127

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           ++++++ PD T+ILDLP + GL R + R +   +   D FE + +  HE+ R  F  IA 
Sbjct: 128 VTLEDLRPDLTLILDLPPEAGLARARRRGAGEPA---DRFEAEGMRFHERLRTAFRSIAE 184

Query: 183 NQPDRCHIVDSAHSFQSVATNI---LNIVW 209
            +P+RC ++D+     +V T I   + + W
Sbjct: 185 AEPERCRVIDADLGLDAVETAIAAAIAVRW 214


>gi|296445855|ref|ZP_06887807.1| thymidylate kinase [Methylosinus trichosporium OB3b]
 gi|296256683|gb|EFH03758.1| thymidylate kinase [Methylosinus trichosporium OB3b]
          Length = 238

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 126/207 (60%), Gaps = 2/207 (0%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + G FI+ EG EGAGK+T + LL+  L  +  +   TREPGG+P AEA R  LL      
Sbjct: 16  HPGRFITLEGGEGAGKSTQMRLLQERLAERGVEAIATREPGGSPHAEALREALLGGKAAP 75

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G   EAI+F+AAR+DH++ +I+PAL  G  ++CDRF DS+ AYQG R       +  L+
Sbjct: 76  LGPLGEAILFSAARIDHLDRLIKPALARGAWVICDRFADSTRAYQGARGGVDARLITLLE 135

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +++    PD TIILD+P +IGL+R   R    ES   D FER+ +  HE  R+ FLDIA
Sbjct: 136 RVALLGAKPDLTIILDIPAEIGLERASRRRRPDESP--DRFEREGLAFHEGLRRAFLDIA 193

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
             +P+RC +VD+    + VA  I +IV
Sbjct: 194 AGEPERCCVVDARAPEREVAQAIWHIV 220


>gi|240141008|ref|YP_002965488.1| thymidylate kinase [Methylobacterium extorquens AM1]
 gi|240010985|gb|ACS42211.1| thymidylate kinase [Methylobacterium extorquens AM1]
          Length = 249

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 128/206 (62%), Gaps = 4/206 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG EGAGK+T I+ L   L+R    +V  TREPGGT  AEA R  LL      +
Sbjct: 8   GVFITFEGGEGAGKSTQIARLAETLRRVSGREVVTTREPGGTERAEALRAALLRGVAKPY 67

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G  AEA++FAAAR+DH+ N+IRPAL  G I+LCDRF DS+ AYQG         +DSL+ 
Sbjct: 68  GPFAEALMFAAARIDHIGNLIRPALDRGAIVLCDRFSDSTRAYQGAAGGLDPALIDSLER 127

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           ++++++ PD T+ILDLP + GL R + R +       D FE + +  HE+ R  F  IA 
Sbjct: 128 VTLEDLRPDLTLILDLPPEAGLARARRRGA---GEPADRFEAEGMRFHERLRTAFRSIAE 184

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
            +P+RC ++D+     +V T I N +
Sbjct: 185 AEPERCRVIDADLGPDAVETAIANAI 210


>gi|85715533|ref|ZP_01046514.1| thymidylate kinase [Nitrobacter sp. Nb-311A]
 gi|85697728|gb|EAQ35604.1| thymidylate kinase [Nitrobacter sp. Nb-311A]
          Length = 230

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 136/214 (63%), Gaps = 9/214 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLL-KRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FI+FEG EG+GK+T I +L +R L  K + + VTREPGG+P AE  RH++LS      
Sbjct: 13  GRFITFEGGEGSGKSTQIKILAERLLAAKQHAI-VTREPGGSPGAEIIRHLVLSGVGKLL 71

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G +AE ++FAAAR DHV  VIRPAL +G  +LCDRF DS+  YQG+  +     L++++ 
Sbjct: 72  GVDAETLLFAAARDDHVRTVIRPALEQGVWVLCDRFADSTRVYQGQLGNVLPGVLNAMER 131

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +++ ++ PD T+ILD+PV++GL+R   R   R S   D FE +D+  H K R  + +IA 
Sbjct: 132 VTIGDLKPDLTVILDVPVEVGLQRAAAR---RGSGAPDRFEAEDLAFHRKLRDAYREIAA 188

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           N P RC ++D+     +VA  I    W  +++R+
Sbjct: 189 NDPQRCVVIDADTDLDTVAARI----WAALRERM 218


>gi|328543898|ref|YP_004304007.1| Thymidylate kinase [Polymorphum gilvum SL003B-26A1]
 gi|326413642|gb|ADZ70705.1| Thymidylate kinase [Polymorphum gilvum SL003B-26A1]
          Length = 231

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 123/192 (64%), Gaps = 2/192 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T I  L   L     DV VTREPGG+P AE  R +LLS G    G
Sbjct: 3   GRFITFEGGEGAGKSTQIRRLHDRLAALGIDVVVTREPGGSPGAEFIRDLLLSGGARGLG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA++FAAAR DHV+  IRPAL  GK +LCDRF DS+  YQGE     HL L  L+  
Sbjct: 63  PRGEAMLFAAARADHVDATIRPALEAGKWVLCDRFADSTRVYQGEAGVDAHL-LGLLETA 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNR-YSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +  ++ PD T+++D+P D+GLKRV  R  +       D FE + + +HE+RR +FL++AR
Sbjct: 122 ATLDLRPDLTVLIDVPADVGLKRVAARSRNAGADRGPDRFEDEALGVHERRRALFLELAR 181

Query: 183 NQPDRCHIVDSA 194
           ++P+R  IVD +
Sbjct: 182 DEPERIRIVDGS 193


>gi|254469249|ref|ZP_05082654.1| thymidylate kinase [Pseudovibrio sp. JE062]
 gi|211961084|gb|EEA96279.1| thymidylate kinase [Pseudovibrio sp. JE062]
          Length = 227

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 132/215 (61%), Gaps = 5/215 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG+FISFEG EGAGK+T I  L+  L  K  +   TREPGG+  AE  R VLLS    ++
Sbjct: 2   SGIFISFEGGEGAGKSTQIQRLRDKLAAKGIEAVTTREPGGSQGAELVREVLLSGAAKDY 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G  AEA++FAAAR DH++ +I+PAL  GK +LCDRF DSS  YQGE        +++LQ+
Sbjct: 62  GVTAEAVLFAAARADHIDTLIKPALENGKWVLCDRFADSSRVYQGESGVPTPT-VEALQQ 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +++    P+ T+++++  ++GL RV  R +  E    D FE   +  H +R+++FL++AR
Sbjct: 121 VAIAGHNPNMTLLINVTPEVGLARVSKRTAPVEFDGPDRFETDTLETHRRRQELFLEMAR 180

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           N+PDR  ++D       V  +I    W  VQ R +
Sbjct: 181 NEPDRIVVIDGDQPQDKVTEDI----WRAVQDRFA 211


>gi|254503506|ref|ZP_05115657.1| thymidylate kinase [Labrenzia alexandrii DFL-11]
 gi|222439577|gb|EEE46256.1| thymidylate kinase [Labrenzia alexandrii DFL-11]
          Length = 224

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 133/214 (62%), Gaps = 1/214 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEG EGAGK+T I+ LK FL+     V VTREPGG+P AE  R +LLS    + G
Sbjct: 3   GHFISFEGGEGAGKSTQIARLKAFLESLGKTVIVTREPGGSPGAEKIRAMLLSGEARDLG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA++FAAAR DHV+ +I+PAL  G  +LCDR+ DS+  YQGE     + +L  L+  
Sbjct: 63  PRGEAMLFAAARADHVDTLIKPALDRGDWVLCDRYSDSTLVYQGEAGVDLN-YLRLLETA 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V  V P+ TI++D+P ++GL RVQ R     S   D FE + + +HE RR+ FLD+A  
Sbjct: 122 AVAGVRPELTILIDVPAELGLARVQERAKTDTSGGPDRFEGEALRVHEGRRKRFLDLAAE 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           +  R  ++D +   ++V+ +I + V    Q +++
Sbjct: 182 EAYRFAVIDGSKDLEAVSASIQSAVEAAFQDQLT 215


>gi|27379629|ref|NP_771158.1| thymidylate kinase [Bradyrhizobium japonicum USDA 110]
 gi|46576547|sp|Q89LM5|KTHY_BRAJA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|27352781|dbj|BAC49783.1| thymydilate kinase [Bradyrhizobium japonicum USDA 110]
          Length = 228

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 129/215 (60%), Gaps = 7/215 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG GK+T I  L   L+       VTREPGG+P AE  RH++LS      G
Sbjct: 13  GRFITFEGGEGTGKSTQIKKLADRLKAARMRTLVTREPGGSPGAEIMRHLVLSGMGKLLG 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            EAE ++FAAAR DHV  VI PAL +G  +LCDRF DS+ AYQG   S     ++++Q +
Sbjct: 73  PEAETLLFAAARDDHVHTVIEPALKQGIWVLCDRFADSTRAYQGSLGSVSPGLINAMQRV 132

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD TIILDLPV+IGL+R   R   R S   D FE + +  H+  R+ +  IA +
Sbjct: 133 TIGDLKPDLTIILDLPVEIGLQRAAAR---RGSGTPDRFEGEQLSFHQGLREAYRKIAAD 189

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSP 218
           +P RC ++D+     +VA      VW  ++ R+ P
Sbjct: 190 EPARCVLIDANSDPDTVAGR----VWSALRDRLLP 220


>gi|16126067|ref|NP_420631.1| thymidylate kinase [Caulobacter crescentus CB15]
 gi|221234837|ref|YP_002517273.1| thymidylate kinase [Caulobacter crescentus NA1000]
 gi|10720067|sp|Q9RQJ9|KTHY_CAUCR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|6318310|gb|AAF06831.1|AF099189_1 thymydilate kinase [Caulobacter crescentus CB15]
 gi|13423259|gb|AAK23799.1| thymidylate kinase [Caulobacter crescentus CB15]
 gi|220964009|gb|ACL95365.1| thymidylate kinase [Caulobacter crescentus NA1000]
          Length = 208

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 125/208 (60%), Gaps = 6/208 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FISFEG EGAGK+T I  L   L+   +DV VTREPGG+P AEA R +L++   D
Sbjct: 1   MTQGFFISFEGGEGAGKSTQIRRLADRLKAAGHDVIVTREPGGSPGAEAIRELLVNGAAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    E+++  AAR DH+E VIRP L  G ++LCDRF DS+ AYQG    +    + +L
Sbjct: 61  RWSPVTESLLMYAARRDHIERVIRPGLARGAVVLCDRFADSTRAYQGAGGDAPASLIAAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +E  +   +P  T+ILDLP ++GL+R + R           FE K +  HE+ R  +L+I
Sbjct: 121 EEHVLGGTVPVLTLILDLPAEVGLQRAEARGGAAR------FESKGLAFHERLRAGYLEI 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           AR +PDRC ++D+     +V   I ++V
Sbjct: 175 ARREPDRCVVIDADAELDAVTAAISDVV 202


>gi|159184784|ref|NP_354504.2| thymydilate kinase [Agrobacterium tumefaciens str. C58]
 gi|159140072|gb|AAK87289.2| thymydilate kinase [Agrobacterium tumefaciens str. C58]
          Length = 188

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 120/178 (67%), Gaps = 2/178 (1%)

Query: 37  VTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCD 96
           VTREPGG+P AEA RHV+LS   + FG   EAI+FAAAR DHVE VIRPAL  G+I+LCD
Sbjct: 3   VTREPGGSPGAEAVRHVILSGAAESFGVRMEAILFAAARNDHVEEVIRPALARGEIVLCD 62

Query: 97  RFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRES 156
           RFLDSS  YQG   + +  F+++LQ I++  V+P+ T+I D+  + GL R + R    E 
Sbjct: 63  RFLDSSRVYQGTTGNLEPDFIETLQRIAIDGVVPELTLIFDIAAEKGLARARKRAD--EG 120

Query: 157 ACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A  D FE++++  HEKRR+ +LDIA  +P RC IV++      V  ++++ V  L+++
Sbjct: 121 ATPDRFEKEEIETHEKRREAYLDIALAEPRRCRIVNADQPEDKVTEDVMSFVEPLLER 178


>gi|254563522|ref|YP_003070617.1| thymidylate kinase [Methylobacterium extorquens DM4]
 gi|254270800|emb|CAX26805.1| thymidylate kinase [Methylobacterium extorquens DM4]
          Length = 244

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 126/200 (63%), Gaps = 4/200 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG EGAGK+T I+ L   L+R    +V  TREPGGT  AEA R  LL      +
Sbjct: 8   GVFITFEGGEGAGKSTQIARLAETLRRVSGREVVTTREPGGTERAEALRAALLRGVAKPY 67

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G  AEA++FAAAR+DH+EN+IRPAL  G I+LCDRF DS+ AYQG         +DSL+ 
Sbjct: 68  GPFAEALMFAAARIDHIENLIRPALDRGAIVLCDRFSDSTRAYQGAAGGLDPALIDSLER 127

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           ++++++ PD T+ILDLP + GL R + R +       D FE + +  HE+ R  F  IA 
Sbjct: 128 VTLEDLRPDLTLILDLPPEAGLARARRRGA---GEPADRFEAEGMRFHERLRAAFRSIAE 184

Query: 183 NQPDRCHIVDSAHSFQSVAT 202
            +P+RC ++D+     +V T
Sbjct: 185 AEPERCRVIDADLGPDAVET 204


>gi|148255489|ref|YP_001240074.1| thymidylate kinase [Bradyrhizobium sp. BTAi1]
 gi|166221722|sp|A5EJ24|KTHY_BRASB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|146407662|gb|ABQ36168.1| thymidylate kinase [Bradyrhizobium sp. BTAi1]
          Length = 226

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 132/213 (61%), Gaps = 7/213 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F++FEG EGAGK+T I +L   L+ +   V +TREPGG+P AE  RH++LS      G
Sbjct: 13  GRFVTFEGGEGAGKSTQIKMLAARLESEGMRVVLTREPGGSPGAEIMRHLVLSGMGKLLG 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AEAE ++FAAAR DHV NVI PAL +G  +LCDRF DS+ AYQG         L+++Q +
Sbjct: 73  AEAETLLFAAARDDHVRNVILPALSQGSWVLCDRFFDSTRAYQGSLGKVAPDVLNAMQRV 132

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD T+ILD+PV++GLKR   R         D FE +D+  H+  R  F  IA +
Sbjct: 133 TIGDLKPDLTLILDVPVEVGLKRAAARRGAGAP---DRFEAEDIKFHKGLRDAFHKIADD 189

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            P RC ++D+      V+     +VW+ V++R+
Sbjct: 190 DPKRCVLIDATAGPDPVSL----LVWDAVRERL 218


>gi|304391675|ref|ZP_07373617.1| thymidylate kinase [Ahrensia sp. R2A130]
 gi|303295904|gb|EFL90262.1| thymidylate kinase [Ahrensia sp. R2A130]
          Length = 215

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 126/205 (61%), Gaps = 3/205 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T I  L + L+   ++V VTREPGGT  AEA RHV+LS     FG
Sbjct: 3   GHFITFEGGEGAGKSTQIKRLAKKLEDDGHEVVVTREPGGTTGAEAVRHVVLSGAAQPFG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E EA++FAAAR D+V  +I+PAL  G I+LCDRF+DSS  YQG         +D L+  
Sbjct: 63  TELEAVLFAAARADNVRELIKPALARGAIVLCDRFMDSSRVYQGASGGVSSNMMDMLERA 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
             ++  PD T++ DL  + GLKR  + +   +    D +E + +     RR  +L IA+ 
Sbjct: 123 VTEDARPDLTLLFDLSPEEGLKRAADVW---KDDGPDRYESEALAQQHIRRDAYLAIAKA 179

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +PDRC I+D++ + ++V+  +  ++
Sbjct: 180 EPDRCKIIDASKTLRTVSKQVDRVI 204


>gi|209885250|ref|YP_002289107.1| thymidylate kinase [Oligotropha carboxidovorans OM5]
 gi|229621734|sp|B6JEC6|KTHY_OLICO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|209873446|gb|ACI93242.1| thymidylate kinase [Oligotropha carboxidovorans OM5]
          Length = 228

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 130/214 (60%), Gaps = 7/214 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG+GK+T I LL   L+ +  +  VTREPGG+P AE  RH+LLS      G
Sbjct: 13  GRFITFEGGEGSGKSTQIQLLAERLKGQGIETLVTREPGGSPGAEIVRHLLLSGVGKLLG 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+AE ++FAAAR DHV  VI PAL +G  +LCDRF DS+ AYQG        F+++L   
Sbjct: 73  ADAETLLFAAARDDHVHQVIEPALKKGVWVLCDRFTDSTAAYQGAAGKVDAAFIEALTHA 132

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD T+ILD+PV +GL R   R   R  A  D FE++ +  HE  R  +  IA +
Sbjct: 133 TIGDLEPDLTLILDVPVAVGLHRAIKR---RGKAVADRFEQESLSFHESLRDAYRKIAAD 189

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            P RC +VD+     +V+  I    WE +Q R++
Sbjct: 190 NPKRCAVVDANADAATVSERI----WETMQHRLA 219


>gi|218532450|ref|YP_002423266.1| dTMP kinase [Methylobacterium chloromethanicum CM4]
 gi|218524753|gb|ACK85338.1| dTMP kinase [Methylobacterium chloromethanicum CM4]
          Length = 244

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 122/191 (63%), Gaps = 4/191 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG EGAGK+T I+ L   L+R    +V  TREPGGT  AEA R  LL      +
Sbjct: 8   GVFITFEGGEGAGKSTQIARLAETLRRVSGREVVTTREPGGTERAEALRAALLRGVAKPY 67

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G  AEA++FAAAR+DH+EN+IRPAL  G I+LCDRF DS+ AYQG         +DSL+ 
Sbjct: 68  GPFAEALMFAAARIDHIENLIRPALDRGAIVLCDRFSDSTRAYQGAAGGLDPALIDSLER 127

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +++ ++ PD T+ILDLP + GL R + R +       D FE + +  HE+ R  F  IA 
Sbjct: 128 VTLVDLRPDLTLILDLPPEAGLARARRRGA---GEPADRFEAEGMRFHERLRTAFRSIAE 184

Query: 183 NQPDRCHIVDS 193
            +P+RC ++D+
Sbjct: 185 AEPERCRVIDA 195


>gi|299133890|ref|ZP_07027084.1| thymidylate kinase [Afipia sp. 1NLS2]
 gi|298591726|gb|EFI51927.1| thymidylate kinase [Afipia sp. 1NLS2]
          Length = 232

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 127/218 (58%), Gaps = 7/218 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG+GK+T I +L   L+ +  +  VTREPGG+P AE  RH+LLS      G
Sbjct: 17  GRFITFEGGEGSGKSTQIQMLADHLKSQGIETLVTREPGGSPGAEIVRHLLLSGVGKLLG 76

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+AE ++FAAAR DHV  VIRPAL +G  +LCDRF DS+ AYQG        F+ +L   
Sbjct: 77  ADAETLLFAAARDDHVHQVIRPALDKGTWVLCDRFTDSTAAYQGAAGKVDPAFIQALTHA 136

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++  + PD T ILD+PV +GL+R   R   R     D FE + +  HE  R+ +  IA +
Sbjct: 137 TIGRLEPDLTFILDVPVAVGLQRAIKR---RGRTAADRFEGESLAFHESLREAYRRIAAD 193

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSS 221
            P RC ++D+      VA  I     E +Q R+   SS
Sbjct: 194 NPARCVVIDANAEPAKVAERI----REALQSRLPAPSS 227


>gi|154253550|ref|YP_001414374.1| dTMP kinase [Parvibaculum lavamentivorans DS-1]
 gi|154157500|gb|ABS64717.1| dTMP kinase [Parvibaculum lavamentivorans DS-1]
          Length = 209

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 128/217 (58%), Gaps = 8/217 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M    FI+ EG EGAGK+T +  L   L+     V +TREPGG P AEA RH+L++  V 
Sbjct: 1   MPRARFITLEGGEGAGKSTQVRRLAARLEAAGQRVTITREPGGAPGAEAIRHLLVTGDVA 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +  +AE ++  AAR DH+   IRPAL  G  ++CDRF+DS+ AYQG         ++ L
Sbjct: 61  RWTPKAEMLLHFAAREDHLSRTIRPALERGDWVICDRFVDSTMAYQGFAQGLGPELVNEL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +EI + + MP  T+ILDLPV+ GL R  +R    E    D +ER D+  HE  RQ F  I
Sbjct: 121 KEIVIGDDMPGLTLILDLPVETGLARAGSRGQGAE----DRYERMDLRFHETLRQAFETI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           A+N+P+RC +VD++ +   VA  I    W  V+ R+S
Sbjct: 177 AKNEPERCVMVDASQTEDEVAEAI----WAEVKPRLS 209


>gi|144899825|emb|CAM76689.1| Thymidylate kinase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 211

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 123/208 (59%), Gaps = 5/208 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EGAGK+T + LL   L+ +  +V +TREPGG   AEA R +L+S  VD
Sbjct: 1   MTDGRFITFEGGEGAGKSTQVRLLAESLRGRKREVVLTREPGGADGAEAIRTLLVSGAVD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + A  EA++ +AAR DH+   + PAL  G  ++CDRF DS+ AYQG         +  L
Sbjct: 61  RWDARTEALLHSAARRDHLVRTVWPALERGAWVICDRFADSTLAYQGYGHGLDRALIGQL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E+++    PD T+ILDLPV+ GLKR   R         D +ER  +  H++ RQ FL I
Sbjct: 121 AEVTMGRFRPDLTLILDLPVEEGLKRAGGR-----GGAEDRYERMGLDFHQRLRQGFLAI 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A  +P RC ++D+  S ++V  +IL  V
Sbjct: 176 ASAEPRRCAVIDATRSPEAVHQDILAAV 203


>gi|75675656|ref|YP_318077.1| thymidylate kinase [Nitrobacter winogradskyi Nb-255]
 gi|123613520|sp|Q3SSL6|KTHY_NITWN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|74420526|gb|ABA04725.1| thymidylate kinase [Nitrobacter winogradskyi Nb-255]
          Length = 230

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 120/188 (63%), Gaps = 3/188 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG+GK+T I +L   LQ       VTREPGG+P AE  RH++LS      G
Sbjct: 13  GRFITFEGGEGSGKSTQIRILAERLQAAKLRAIVTREPGGSPGAEIIRHLVLSGVGKLLG 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+AE ++FAAAR DHV  VI+PAL +G  +LCDRF DS+  YQG+  +     L++++ +
Sbjct: 73  ADAETLLFAAARDDHVHTVIKPALEQGIWVLCDRFADSTRVYQGQLGNVLPGVLNAMERV 132

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD T+ILD+PV++GL+R   R   R S   D FE +D+  H K R  +  IA +
Sbjct: 133 TIGDLKPDLTVILDVPVEVGLQRAAAR---RGSGAPDRFEAEDIAFHRKLRDAYRAIAAS 189

Query: 184 QPDRCHIV 191
            P RC ++
Sbjct: 190 DPQRCVVI 197


>gi|188583893|ref|YP_001927338.1| dTMP kinase [Methylobacterium populi BJ001]
 gi|179347391|gb|ACB82803.1| dTMP kinase [Methylobacterium populi BJ001]
          Length = 236

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 123/197 (62%), Gaps = 10/197 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQ-------RKNYDVHVTREPGGTPAAEAARHVLLS 56
           G+FI+FEG EGAGK+T I+ L   L+        +  ++  TREPGGTP AEA R  LL 
Sbjct: 8   GVFITFEGGEGAGKSTQIARLAATLRDEGGGREGRGREIVTTREPGGTPRAEALRAALLR 67

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
                +G  AEA++FAAAR+DH+EN IRPAL  G I+LCDRF DS+ AYQG     +   
Sbjct: 68  GVAKPYGPFAEALMFAAARIDHIENRIRPALARGAIVLCDRFSDSTRAYQGAAGGLEPEL 127

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           + SL+ +++ ++ PD T+ILDLP + GL R Q+R     +   D FE + +  H++ R  
Sbjct: 128 IASLERVTLGDLRPDLTLILDLPPEAGLARAQSRGGGEPA---DRFEAEGMRFHQRLRTA 184

Query: 177 FLDIARNQPDRCHIVDS 193
           F  IA  +P+RC I+D+
Sbjct: 185 FRAIAEAEPERCRIIDA 201


>gi|167646661|ref|YP_001684324.1| thymidylate kinase [Caulobacter sp. K31]
 gi|167349091|gb|ABZ71826.1| dTMP kinase [Caulobacter sp. K31]
          Length = 208

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 125/217 (57%), Gaps = 10/217 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FISFEG EGAGK+T I  L   L+    DV +TREPGG+P AE  R ++L+  VD
Sbjct: 1   MTRGTFISFEGGEGAGKSTQIRRLAERLKADGADVVLTREPGGSPGAEQIRDLILNGHVD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    E ++  A+R DHVE VIRPAL  G I+LCDRF DS+ AYQG    +    + +L
Sbjct: 61  RWSPITETLLMYASRRDHVERVIRPALERGAIVLCDRFADSTRAYQGAGGEAPIALIKAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +E  +   +PD T+I D+P ++GL R   R           FE K +  HE+  + FL+I
Sbjct: 121 EEHVLGGTVPDLTLIFDIPAEVGLARALAR------GGEARFESKGLAFHERLGEAFLEI 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           AR +P+RC ++++  +  +V  +    VW  V  R+ 
Sbjct: 175 ARREPERCVVIEADDAIDAVWAD----VWGAVSARLG 207


>gi|302038227|ref|YP_003798549.1| thymidylate kinase [Candidatus Nitrospira defluvii]
 gi|300606291|emb|CBK42624.1| Thymidylate kinase [Candidatus Nitrospira defluvii]
          Length = 241

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 118/211 (55%), Gaps = 6/211 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+ EG EG GK+T   LL   L+ + YD   TREPGGTP AE  R VLL    +   
Sbjct: 11  GLFITLEGTEGCGKSTQAKLLGEHLRNQGYDTVETREPGGTPLAEKIRSVLLDRADEPVA 70

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E EA +  AAR  HV  VI PAL  G I+LCDRF+DS+ AYQG         L+ L  +
Sbjct: 71  PETEAFLVLAARRQHVAQVIEPALARGSIVLCDRFIDSTLAYQGYARGLDIATLERLNRL 130

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   +MPD T++ DLPV  GL R       R +A L+  +R+ +  H + R  FLD+A+ 
Sbjct: 131 ATHTLMPDLTLVFDLPVSTGLAR------RRSAAELNRLDRESLRFHRRVRAGFLDLAKR 184

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            P R  IV +  S ++VA  +  IV  L+ +
Sbjct: 185 HPRRIQIVSARASRETVARAVARIVTPLLDR 215


>gi|170744323|ref|YP_001772978.1| dTMP kinase [Methylobacterium sp. 4-46]
 gi|168198597|gb|ACA20544.1| dTMP kinase [Methylobacterium sp. 4-46]
          Length = 226

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 121/194 (62%), Gaps = 3/194 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLFI+ EG EGAGK+T ++ L  +L+R + +V  TREPGG+P AE  R  LL+    +
Sbjct: 6   RPGLFITLEGGEGAGKSTQVARLAEWLRRSDREVVTTREPGGSPRAEQIRTALLAGAAKD 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G  AEA++F+AARLDH+ ++IRPAL  G +++CDRF DS+ AYQG         + +L+
Sbjct: 66  HGPFAEALLFSAARLDHLASLIRPALARGAVVVCDRFADSTRAYQGVAGGIDPECVAALE 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNR-YSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + V    PD T+ILDLP +IGL R + R   L      D FE + +  H++ R+ F  I
Sbjct: 126 RVVVGATRPDLTLILDLPPEIGLARARGRERGLARGP--DRFEAEALAFHQRLREAFRGI 183

Query: 181 ARNQPDRCHIVDSA 194
           A  +P RC +VD+A
Sbjct: 184 AAREPARCALVDAA 197


>gi|95930676|ref|ZP_01313410.1| Thymidylate kinase [Desulfuromonas acetoxidans DSM 684]
 gi|95133328|gb|EAT14993.1| Thymidylate kinase [Desulfuromonas acetoxidans DSM 684]
          Length = 216

 Score =  164 bits (415), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 127/213 (59%), Gaps = 6/213 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG GKTT I LL   L+ + +DV  TREPGG   A+  R VLL    +   
Sbjct: 2   GQFITFEGIEGCGKTTQIRLLATALRHQGHDVIETREPGGCDIADQIRAVLLDAKNNRMT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---SL 120
           +  E +++AAAR  HV  VIRPAL  GK +LCDRF D++ AYQG     + L +D   +L
Sbjct: 62  SPTELLLYAAARAQHVAEVIRPALDAGKTVLCDRFCDATLAYQG---YGRQLDIDQITTL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              + Q V PD T++LDLPV+IGL R + R         D FE++ +  H++ RQ +L +
Sbjct: 119 NAYACQGVRPDTTLLLDLPVEIGLGRARQRNEQHSGPNEDRFEQESLNFHQRIRQAYLQL 178

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A N+P R  I+D+    Q+VA  I + +  ++Q
Sbjct: 179 ADNEPQRFLIIDAQGKPQTVAERIASAMNTIIQ 211


>gi|39997327|ref|NP_953278.1| thymidylate kinase [Geobacter sulfurreducens PCA]
 gi|59798354|sp|Q74AX0|KTHY_GEOSL RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|39984218|gb|AAR35605.1| thymidylate kinase [Geobacter sulfurreducens PCA]
 gi|298506264|gb|ADI84987.1| thymidylate kinase [Geobacter sulfurreducens KN400]
          Length = 213

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 123/212 (58%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG GKTT I    + L+   + V VTREPGG P A+  R +LL  G     
Sbjct: 2   GYFITFEGIEGCGKTTQIKRAAQSLREAGHRVVVTREPGGCPIADDIRAILLDAGNSAMV 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++AAAR  HV  VI PAL EG ++LCDRF DS+  YQG   +     +  L  +
Sbjct: 62  PTTELLLYAAARAQHVAEVIAPALAEGAVVLCDRFTDSTLVYQGFGRNLDRDLIARLNTL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +  ++ PD TI+LD PV +GL R   R + R++   + FER+ ++ HE+ R+ FL +A  
Sbjct: 122 AAGQIRPDLTILLDCPVAVGLARAAARINSRQTNREERFERESLLFHERVREGFLSLAGG 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           +P R  ++D     ++ AT + +++   V +R
Sbjct: 182 EPHRFAVIDGNDGVEATATAVADVLLNRVPRR 213


>gi|170747926|ref|YP_001754186.1| dTMP kinase [Methylobacterium radiotolerans JCM 2831]
 gi|170654448|gb|ACB23503.1| dTMP kinase [Methylobacterium radiotolerans JCM 2831]
          Length = 240

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 119/194 (61%), Gaps = 2/194 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQ-RKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            G FI+FEG EGAGK+T I+ L   L+ R    V VTREPGG+P AE  R  LL      
Sbjct: 13  GGTFITFEGGEGAGKSTQIARLAATLRARSGRPVCVTREPGGSPRAEEIRAALLDGVAKP 72

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +G  AEA++F+AAR+DH++ +IRPAL  G+ +LCDRF+DS+ AYQG         +D+L+
Sbjct: 73  YGPFAEALLFSAARIDHLDRLIRPALRRGETVLCDRFIDSTRAYQGAAGGLDPGIVDALE 132

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + V    PD T+ILDL  + GL R   R + R     D FE + +  H + R+ FL IA
Sbjct: 133 RVVVGPTRPDLTLILDLAPESGLARAAGRGA-RTGQGADRFEAEALDFHVRLREAFLAIA 191

Query: 182 RNQPDRCHIVDSAH 195
             +PDRC ++D++ 
Sbjct: 192 GAEPDRCAVIDASR 205


>gi|302383105|ref|YP_003818928.1| thymidylate kinase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193733|gb|ADL01305.1| thymidylate kinase [Brevundimonas subvibrioides ATCC 15264]
          Length = 208

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 120/208 (57%), Gaps = 5/208 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ G FI+FEG EG GK+T ++LL   L  +  DV  TREPGG+P  EA R +++S   D
Sbjct: 1   MSRGRFITFEGGEGTGKSTQVALLVDRLGARGRDVIRTREPGGSPGGEAIRSLVVSGSAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + A  E ++  AAR DH+E  IRPAL  G+ ++CDRF DSS AYQG    ++  F+++L
Sbjct: 61  RWSARTELLLMFAARSDHLERTIRPALEAGQWVVCDRFADSSRAYQGLAGGAETAFVEAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
               V    PD T+I DLP ++GL+R     +L  +     FE K +  H+  R+ F  I
Sbjct: 121 DAHVVGTNQPDLTLIFDLPAEVGLER-----ALARAQGDTRFESKGLAFHQNLRRAFQTI 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           AR  P+RC ++D+  S   V   +   V
Sbjct: 176 ARAHPERCRLIDATGSIDDVQARVWAAV 203


>gi|329889614|ref|ZP_08267957.1| thymidylate kinase [Brevundimonas diminuta ATCC 11568]
 gi|328844915|gb|EGF94479.1| thymidylate kinase [Brevundimonas diminuta ATCC 11568]
          Length = 208

 Score =  160 bits (406), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 86/216 (39%), Positives = 123/216 (56%), Gaps = 9/216 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EGAGKTT   LL   L+ +  DV  TREPGG+P AE  R++ +S   D
Sbjct: 1   MQRGRFITFEGGEGAGKTTQARLLVERLRARGLDVLQTREPGGSPGAEEIRNIAVSGEAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + A  E ++  AAR DH+E  I PAL  G+ ++CDRF DSS  YQG    +    +++L
Sbjct: 61  RWSARTETLLMYAARSDHLERTILPALEAGRWVVCDRFADSSRVYQGAGGGTPESLIEAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +  V    PD T++ DLPV++GL R   R  L E+     FE K +  H+K R  FL +
Sbjct: 121 DDAVVNGDQPDLTLVFDLPVEVGLDRAFGR-GLFET----RFESKGLAFHQKLRDGFLKV 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           A   P+RC ++D+      V+  +    W +V++R+
Sbjct: 176 AERHPERCVVLDATGEVDEVSARL----WAVVEERL 207


>gi|220926669|ref|YP_002501971.1| thymidylate kinase [Methylobacterium nodulans ORS 2060]
 gi|219951276|gb|ACL61668.1| thymidylate kinase [Methylobacterium nodulans ORS 2060]
          Length = 225

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 117/190 (61%), Gaps = 3/190 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             G+FI+ EG EGAGK+T I+ L   L+  + +V  TREPGG+P AE  R  LL+    +
Sbjct: 6   QPGVFITVEGGEGAGKSTQIARLAERLRAGDREVITTREPGGSPRAEQIRTALLAGAAKD 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G  AEA++F+AARLDH+  +IRPAL  G ++LCDRF DS+ AYQG         + +L+
Sbjct: 66  HGPFAEALLFSAARLDHLNTLIRPALARGAVVLCDRFADSTRAYQGAAGGIDPQEVAALE 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + V    PD T+ILDLP ++GL R + R S   S   D FE + +  H++ R+ F  IA
Sbjct: 126 RVVVGPTRPDLTLILDLPPELGLARARRRAS---SPGPDRFEAETLSFHQRLREAFRAIA 182

Query: 182 RNQPDRCHIV 191
             +P+RC ++
Sbjct: 183 AQEPERCVLI 192


>gi|114570004|ref|YP_756684.1| thymidylate kinase [Maricaulis maris MCS10]
 gi|114340466|gb|ABI65746.1| thymidylate kinase [Maricaulis maris MCS10]
          Length = 211

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 117/196 (59%), Gaps = 5/196 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EGAGKTT I  L   L  ++ DV VTREPGGTP AE  R +LL+  V+
Sbjct: 1   MKHGKFITLEGGEGAGKTTLIQGLTHALADRDIDVVVTREPGGTPGAELLRDLLLNGEVE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + +  EA++  AAR+DHVE  I+PAL  G  +LCDRF DS+ AYQG     +   L  L
Sbjct: 61  RWSSRTEALLMYAARVDHVERRIKPALSRGAWVLCDRFADSTRAYQGVAGGLEPAELADL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           Q  ++ +   D T+I+DL  +IGLKR     +L+    +  FE+ D   H + RQ FLDI
Sbjct: 121 QRFALGDFSADMTLIVDLDPEIGLKR-----TLQRGEKITRFEKFDTSYHRRLRQAFLDI 175

Query: 181 ARNQPDRCHIVDSAHS 196
           A   P+RC ++D   S
Sbjct: 176 ASEDPERCVVLDGTQS 191


>gi|312115143|ref|YP_004012739.1| thymidylate kinase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220272|gb|ADP71640.1| thymidylate kinase [Rhodomicrobium vannielii ATCC 17100]
          Length = 249

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/246 (37%), Positives = 126/246 (51%), Gaps = 36/246 (14%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EGAGKTT   +L   L+RK  +V +TREPGGTP AEA R VLLS     FG
Sbjct: 3   GRFITLEGGEGAGKTTQAKVLAERLRRKGINVLLTREPGGTPRAEAIREVLLSGKAKRFG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA++F AAR  H+E  IRPAL  G  ++CDRF DS+ AYQG         ++++ + 
Sbjct: 63  ALGEAVLFYAARESHLELGIRPALERGTWVICDRFSDSTRAYQGAAGGLPLSVIETIDKA 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRY-------------------------------- 151
            V +  PD T+I DLP ++GLKR   R                                 
Sbjct: 123 VVGDTRPDLTLIFDLPPELGLKRAAERLRGGVVSAAVGGERAEPAAAAGGSPGAAAGSDV 182

Query: 152 ----SLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNI 207
                L ++   D FE  ++  H   R  FL IA+ +PDRC +VD++ +   V   + +I
Sbjct: 183 IAPAPLVDAPASDRFETMNLTFHRSLRAEFLAIAKAEPDRCAVVDASDTPNRVEDKVWSI 242

Query: 208 VWELVQ 213
           V +  Q
Sbjct: 243 VRDRFQ 248


>gi|83588915|ref|YP_428924.1| thymidylate kinase [Moorella thermoacetica ATCC 39073]
 gi|83571829|gb|ABC18381.1| thymidylate kinase [Moorella thermoacetica ATCC 39073]
          Length = 207

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 122/214 (57%), Gaps = 16/214 (7%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG +G+GKTT +  L+ +L R+   V  TREPGGT  +EA R +LL     
Sbjct: 1   MGRGLFITLEGPDGSGKTTQMDRLEEYLHRRGLAVERTREPGGTLLSEAIRRLLLEPSYS 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A AE  ++AAAR  HV   IRPAL  GKI+LCDRF DS+ AYQG         ++ L
Sbjct: 61  PVDARAELFLYAAARAQHVAERIRPALAAGKIVLCDRFSDSTLAYQGYGRQLGAELVERL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +++   + PD T ++D+PV IGL         R S   D  E++D+  H + RQ +LD+
Sbjct: 121 NDLATGNLRPDITFLIDVPVAIGLG--------RHSGGSDRLEQEDLEFHRRVRQGYLDL 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           AR +P R H++D   S         ++VWE +++
Sbjct: 173 ARREPRRVHLIDGTPS--------PDVVWEEIKE 198


>gi|51894393|ref|YP_077084.1| thymidylate kinase [Symbiobacterium thermophilum IAM 14863]
 gi|59798210|sp|Q67JB0|KTHY_SYMTH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|51858082|dbj|BAD42240.1| thymidylate kinase [Symbiobacterium thermophilum IAM 14863]
          Length = 214

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/211 (40%), Positives = 124/211 (58%), Gaps = 7/211 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FISFEG++G+GK+T I LL ++L  ++     TREPGGTP AE  R VLL         
Sbjct: 3   VFISFEGVDGSGKSTQIRLLLQYLDEQSVPYVFTREPGGTPIAEQIRRVLLDPANRGMSV 62

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAAAR +HV   IRPAL EGK+++CDRF+DSS  YQG        FL  + E++
Sbjct: 63  ITEALLFAAARAEHVSRTIRPALEEGKVVICDRFVDSSLVYQGVAGGLPVEFLTQINEMA 122

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + P  TI+LDL  ++ L R       R     D  ER+    H+  R+ +LD+AR +
Sbjct: 123 TGALRPHRTIVLDLAPEVALAR-------RTGEEADRIERQSREYHQLVREGYLDLARAE 175

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           P R  +VD++ S + V  +I  +V E++ +R
Sbjct: 176 PRRVKVVDASRSVEEVQKDIRRLVEEVLPRR 206


>gi|154248245|ref|YP_001419203.1| dTMP kinase [Xanthobacter autotrophicus Py2]
 gi|154162330|gb|ABS69546.1| dTMP kinase [Xanthobacter autotrophicus Py2]
          Length = 217

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 120/208 (57%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG GK+T    L   L+   + V  TREPGG+P AEA RHVLLS   +
Sbjct: 1   MTQGRFITLEGGEGTGKSTQARRLAAHLRTLGHTVVETREPGGSPGAEAVRHVLLSGAAE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
             G  AEA++FAAAR DHV+ +IRPAL  G I++CDRF+DS+  YQG         LD+L
Sbjct: 61  PLGPVAEALLFAAARTDHVQTLIRPALAAGTIVICDRFIDSTRVYQGAVGQVAPPLLDAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +E++     PD T+ILD+P + GL R     + R +   D FE++    H   R+ F+  
Sbjct: 121 EEMATGGTRPDLTLILDVPPETGLARA----AARGNGDPDRFEKEGAAYHAAVREAFVAR 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P RC +VD+     +VA  I  IV
Sbjct: 177 AAAAPARCVLVDATPDPDAVAAQIAGIV 204


>gi|116050964|ref|YP_790211.1| thymidylate kinase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122260093|sp|Q02PC5|KTHY_PSEAB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|115586185|gb|ABJ12200.1| thymidylate kinase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 210

 Score =  157 bits (397), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 122/212 (57%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R +LL+ G +  
Sbjct: 2   TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPGDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG       + + +L+ 
Sbjct: 62  AADTELLLMFAARAQHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEVRIAALES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++D    E  RQ +L  A 
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLARAAAR------GRLDRFEQEDRRFFEAVRQTYLQRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P+R  ++D+      V   +  ++  L+++
Sbjct: 176 QAPERYQVLDAGLPLTEVQAGLDRLLPNLLER 207


>gi|296388546|ref|ZP_06878021.1| thymidylate kinase [Pseudomonas aeruginosa PAb1]
          Length = 210

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 122/212 (57%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R +LL+ G +  
Sbjct: 2   TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPGDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG       + + +L+ 
Sbjct: 62  AADTELLLMFAARAQHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEVRIAALES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++D    E  RQ +L  A 
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLARAAAR------GRLDRFEQEDRRFFEAVRQTYLQRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P+R  ++D+      V   +  ++  L+++
Sbjct: 176 QAPERYQVLDAGLPLAEVQAGLDRLLPNLLER 207


>gi|91977186|ref|YP_569845.1| thymidylate kinase [Rhodopseudomonas palustris BisB5]
 gi|91683642|gb|ABE39944.1| thymidylate kinase [Rhodopseudomonas palustris BisB5]
          Length = 252

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 132/215 (61%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF- 62
           G FI+FEG EG+GK+T I LL + L+  N    VTREPGG+P AE  RH+LL+ GV    
Sbjct: 13  GRFITFEGGEGSGKSTQIKLLAKRLEGANLRTLVTREPGGSPGAEIVRHLLLA-GVGRLI 71

Query: 63  -GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            GAEAEA++FAAAR DHV  +I+PAL  G  +LCDRF DS+  YQG         L++LQ
Sbjct: 72  GGAEAEALLFAAARDDHVRTLIQPALESGVWVLCDRFFDSTRVYQGRLGEVSPAMLNALQ 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++++  + PD T+ILD+PV+IGL R   R   R S   D FE + +  H + R  +  IA
Sbjct: 132 DVTIGAMKPDLTVILDVPVEIGLARAAVR---RGSEAPDRFESESIDFHRRLRDAYRQIA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             +P+RC ++D+      VA  I    W  VQ+R+
Sbjct: 189 AAEPERCVVIDANAEPHVVAARI----WLTVQERL 219


>gi|86749796|ref|YP_486292.1| thymidylate kinase [Rhodopseudomonas palustris HaA2]
 gi|86572824|gb|ABD07381.1| thymidylate kinase [Rhodopseudomonas palustris HaA2]
          Length = 246

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/214 (45%), Positives = 137/214 (64%), Gaps = 8/214 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS-CGVDEF 62
           G FI+FEG EGAGK+T I LL + L++   +  VTREPGG+P AE  RH+LL+  G    
Sbjct: 13  GHFITFEGGEGAGKSTQIRLLAQRLEKAGLETLVTREPGGSPGAEIIRHLLLAGVGRAIG 72

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           GAEAEA++FAAAR DHV  +I+PAL  G  +LCDRF DS+  YQG         L++LQ+
Sbjct: 73  GAEAEALLFAAARDDHVRTLIQPALDRGVWVLCDRFYDSTRVYQGRLGDVSPGMLNALQD 132

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +++  + PD T+ILD+PV+IGL R   R   R S   D FE +++  H + R  +  IAR
Sbjct: 133 VTIGTMKPDLTVILDVPVEIGLARAAVR---RGSDAPDRFESENIDFHRRLRDAYRQIAR 189

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            +P+RC +VD AH+   V   + + +W  VQ+R+
Sbjct: 190 AEPERCVLVD-AHAEPKV---VADRIWLTVQERL 219


>gi|297717894|gb|ADI50090.1| thymidylate kinase [Candidatus Odyssella thessalonicensis L13]
          Length = 205

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 118/200 (59%), Gaps = 5/200 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M++G FI+FEG EG GK+T   LL  +L+++ Y+V +TREPGGT  AE  R +L+S  V+
Sbjct: 1   MSAGKFITFEGGEGTGKSTQCQLLADYLRQQGYEVILTREPGGTDGAELIRALLVSGDVN 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    EA++  AAR+DH E VI PAL  G  ++CDRF DS+ AYQG        FL +L
Sbjct: 61  RWSGVTEALLLNAARVDHWEKVISPALNRGAWVICDRFADSTIAYQGFGRGLDIDFLWNL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
               +  V PD T + DL   IG+ R  +R   R S     FE+ D+  H + R  +L+I
Sbjct: 121 HNSVLPGVQPDLTFVFDLDPAIGINRALSR---RTSEV--RFEKMDIEFHNRMRHGYLEI 175

Query: 181 ARNQPDRCHIVDSAHSFQSV 200
           A+N P RC +VD+     ++
Sbjct: 176 AKNHPQRCRLVDAGQDINTI 195


>gi|218960693|ref|YP_001740468.1| thymidylate kinase [Candidatus Cloacamonas acidaminovorans]
 gi|167729350|emb|CAO80261.1| thymidylate kinase [Candidatus Cloacamonas acidaminovorans]
          Length = 217

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 119/211 (56%), Gaps = 7/211 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + GLFI+FEGIEG+GKTT I +L   L+ K      TREPGGT  +EA R +LL+    E
Sbjct: 12  SKGLFITFEGIEGSGKTTQIIMLVEVLKAKGIPYVTTREPGGTKISEAIRDLLLNPKFME 71

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              E E +++ A+R  H   +I PAL EGKI++ DR+ DS+YAYQG         ++ L 
Sbjct: 72  MKPETELLLYCASRAQHTAELILPALEEGKIVISDRYFDSTYAYQGAARELDEEVINVLT 131

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             S     PD T +LDLPV++GL R++NR        LD  E++ +  HEK R+ FL IA
Sbjct: 132 RFSTYGRNPDLTFLLDLPVEVGLARIKNR-------NLDRLEQETLSFHEKVRRQFLSIA 184

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
              P R  ++D     + +   IL+ +   +
Sbjct: 185 NKYPSRYIVLDGESQAEIIHRQILSTLQPFI 215


>gi|83858301|ref|ZP_00951823.1| thymidylate kinase [Oceanicaulis alexandrii HTCC2633]
 gi|83853124|gb|EAP90976.1| thymidylate kinase [Oceanicaulis alexandrii HTCC2633]
          Length = 211

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 118/208 (56%), Gaps = 5/208 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EGAGKTT    L   L+ +     +TREPGGTP AEA R++L+    +
Sbjct: 1   MTQGRFITLEGGEGAGKTTLAKALSESLESQGVRTLITREPGGTPNAEALRNLLVEGDTE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + A +E ++  AAR+DHVE +IRP+L +G  ++CDRF DS+ AYQG         +D +
Sbjct: 61  RWSALSETLLLYAARVDHVERLIRPSLDQGIWVICDRFSDSTRAYQGAAGGMSTAQIDEI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              S+    PD T ++DL  + GL+R + R    E A    FERK    H   R  FLDI
Sbjct: 121 DRASMHGFGPDLTFVVDLDPETGLERTRLRG---EGAT--RFERKPAAFHHALRVAFLDI 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           AR  P+RC ++D A     VAT+   I+
Sbjct: 176 ARAAPERCVVLDGAMPADQVATSAFEIL 203


>gi|197105068|ref|YP_002130445.1| thymidylate kinase [Phenylobacterium zucineum HLK1]
 gi|196478488|gb|ACG78016.1| thymidylate kinase [Phenylobacterium zucineum HLK1]
          Length = 211

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 123/217 (56%), Gaps = 9/217 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EGAGK+T +  L   L+ +  +V  TREPGG+  AE+ R ++L+   D
Sbjct: 1   MARGRFITFEGGEGAGKSTQVKRLAARLEAQGLEVVTTREPGGSAGAESIRALVLNGEAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    E ++  AAR DH+E VIRPAL  G  ++CDRF DS+ AYQG    +    + +L
Sbjct: 61  RWSPVTETLLMYAARRDHIERVIRPALARGAWVICDRFADSTRAYQGAAGGTDPALIAAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +   +++V PD T++ DLP ++GL+R   R     +     FE K +  H++ R+ F  I
Sbjct: 121 EAHILEDVRPDLTLVFDLPPEVGLERAHAR-----AGAEMRFESKGMAFHQRLREGFRAI 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           A  +P RC ++D+     +V       VW  V +R++
Sbjct: 176 AAAEPQRCAVIDATAPMDAVE----GAVWTAVSERLA 208


>gi|330878246|gb|EGH12395.1| thymidylate kinase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 210

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 125/211 (59%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDESM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAGVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLNRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A S   V  ++  ++ EL++
Sbjct: 176 AEPARYRLVDAAQSLADVQASLDKLLPELLE 206


>gi|148265181|ref|YP_001231887.1| dTMP kinase [Geobacter uraniireducens Rf4]
 gi|189028834|sp|A5G696|KTHY_GEOUR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|146398681|gb|ABQ27314.1| thymidylate kinase [Geobacter uraniireducens Rf4]
          Length = 213

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 118/206 (57%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG+EG GKTT I LL + L  + + V VTREPGG P A+ AR +LL        
Sbjct: 2   GCFITFEGVEGCGKTTQIKLLAQHLTEQGHTVIVTREPGGCPIADQARAILLDADNRAMT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++AAAR  HV+ +++PAL   K++LCDRF D++ AYQG         +  L ++
Sbjct: 62  PTTELLLYAAARAQHVQEIVKPALAANKVVLCDRFTDATIAYQGYGRGLDPATIAYLNDL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   + P  T++LD PV++GLKR  +R +    A  + FE + V+ H K R  +L +A +
Sbjct: 122 ATDGLKPRLTVLLDCPVEVGLKRAFDRINGAAGAREERFELESVLFHRKVRDGYLKLAED 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVW 209
           +P+R  I+D +   Q     I   V 
Sbjct: 182 EPERFIIIDGSQGVQETEAAITAAVL 207


>gi|310816869|ref|YP_003964833.1| thymidylate kinase [Ketogulonicigenium vulgare Y25]
 gi|308755604|gb|ADO43533.1| thymidylate kinase [Ketogulonicigenium vulgare Y25]
          Length = 205

 Score =  155 bits (391), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 120/208 (57%), Gaps = 10/208 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFISFEGI+G+GK+T   +L   L+ + +DV +TREPGG+P AE  R ++L+   D
Sbjct: 1   MTCGLFISFEGIDGSGKSTQARVLADALRGRGHDVVLTREPGGSPGAEEIRRLVLTGATD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + AE E ++F AAR DH+E  I PAL  G+I++ DRF DS+ AYQG         +D+L
Sbjct: 61  RWSAETETLLFTAARRDHLEKTILPALAAGQIVITDRFADSTRAYQGATRGDLRGIVDAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYS--LRESACLDYFERKDVMIHEKRRQIFL 178
             + +    PD T ++D      L R   R +  LR       FE   + + +K R ++L
Sbjct: 121 HALMIGR-EPDLTFVIDADPAASLTRGLARSTDELR-------FEEFGLPLQQKMRAVYL 172

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILN 206
           DIA  QP RC ++D A +  +VA  IL 
Sbjct: 173 DIAHAQPQRCIVIDGAGTIDAVAARILT 200


>gi|313885558|ref|ZP_07819308.1| dTMP kinase [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619288|gb|EFR30727.1| dTMP kinase [Eremococcus coleocola ACS-139-V-Col8]
          Length = 212

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 125/206 (60%), Gaps = 4/206 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFIS EG +G+GK++ I  L   L +  +D+ +TREPGG+P AE  R V+L       
Sbjct: 4   NGLFISIEGPDGSGKSSAIQGLATRLSQDGFDLVLTREPGGSPIAEQIRQVILDVNNTAM 63

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  H+++ I PAL  GK+++ DRF+DSS AYQG   +     + ++ +
Sbjct: 64  DPMTEALLYAAGRRQHLKDTILPALAAGKVVISDRFVDSSLAYQGVGRNLSQTDIWNINQ 123

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++Q  +PD T++LD+P ++GLKR+   Y  R     D  +++D+  H K RQ FLD+A 
Sbjct: 124 YAIQGHLPDITLLLDVPAEVGLKRI---YQARNQRQFDRLDQEDLSFHNKVRQAFLDLAA 180

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
           +Q DR H++D+  +   V  +   ++
Sbjct: 181 DQ-DRIHVIDARQAVDQVVEDAFQVL 205


>gi|28870981|ref|NP_793600.1| thymidylate kinase [Pseudomonas syringae pv. tomato str. DC3000]
 gi|38257966|sp|Q87YH1|KTHY_PSESM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|28854230|gb|AAO57295.1| thymidylate kinase [Pseudomonas syringae pv. tomato str. DC3000]
 gi|331019150|gb|EGH99206.1| thymidylate kinase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 210

 Score =  154 bits (390), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 125/211 (59%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEGM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLNRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A S   V  ++  ++ EL++
Sbjct: 176 AEPARYRLVDAAQSLADVQASLDKLLPELLE 206


>gi|330962619|gb|EGH62879.1| thymidylate kinase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 210

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 126/211 (59%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAARLRAQGVEVLLTREPGGTPLAERVRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLPHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ AR
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRTTYLNRAR 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD++ +   V  ++  ++ +L++
Sbjct: 176 AEPARYRLVDASQTLAQVQASLDTLLPQLLE 206


>gi|78223521|ref|YP_385268.1| thymidylate kinase [Geobacter metallireducens GS-15]
 gi|78194776|gb|ABB32543.1| thymidylate kinase [Geobacter metallireducens GS-15]
          Length = 217

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 112/195 (57%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG GK+T + L+   L R  + V VTREPGG P A+A R +LL        
Sbjct: 2   GFFITFEGIEGCGKSTQVRLVAERLSRAGHGVVVTREPGGCPIADAIRAILLDARNSAMV 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++AAAR  HV  VI PAL  GKI+LCDRF DS+ AYQG         +  L  +
Sbjct: 62  PMAELLLYAAARAQHVAEVIEPALAAGKIVLCDRFTDSTMAYQGFGRKLDRELIAQLNSL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   + PD T++LD  V+ GL R   R +   +A  + FE++ ++ HE+ R  FL +A  
Sbjct: 122 AAGSIRPDLTLLLDCSVETGLARAMARINTSSAAREERFEQESILFHERIRDGFLSLAAA 181

Query: 184 QPDRCHIVDSAHSFQ 198
           +P R  ++D +   +
Sbjct: 182 EPGRFVVLDGSGGIE 196


>gi|83949598|ref|ZP_00958331.1| thymidylate kinase [Roseovarius nubinhibens ISM]
 gi|83837497|gb|EAP76793.1| thymidylate kinase [Roseovarius nubinhibens ISM]
          Length = 210

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 117/207 (56%), Gaps = 6/207 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +G+FISFEGI+G+GK+T +  L   LQ +   V +TREPGG+P AE  R ++L    D 
Sbjct: 5   RAGVFISFEGIDGSGKSTQVRRLADHLQARGLRVRLTREPGGSPGAEDIRKLVLEGAGDR 64

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +  E E ++F AAR DH+E VI PAL  G++++CDRF DS+  YQG   +     +D L 
Sbjct: 65  WSPETEILLFTAARRDHMERVILPALAAGEVVICDRFADSTRMYQGLASAEMRALVDQLH 124

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++ +    PD T+++D+  ++GL R   R    E      FE + +    + R  FLD+A
Sbjct: 125 DLMIGR-EPDLTLLIDMDPEVGLARALARQGGEE-----RFEGRGIEWQRRMRAGFLDLA 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
              PDR  +VD A    +VA  I  + 
Sbjct: 179 EAHPDRIRVVDGAGEIDAVAGQIATLT 205


>gi|77919289|ref|YP_357104.1| thymidylate kinase [Pelobacter carbinolicus DSM 2380]
 gi|123574092|sp|Q3A3X3|KTHY_PELCD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|77545372|gb|ABA88934.1| thymidylate kinase [Pelobacter carbinolicus DSM 2380]
          Length = 216

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 115/200 (57%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
            FIS EGIEG+GKTT I  L   L+   + V +TREPGG P A+  R +LL         
Sbjct: 3   FFISLEGIEGSGKTTQIKRLADRLESLGHAVLITREPGGCPIADQIRQILLHPDNGHLDP 62

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           +AE +++AAAR  HV  VIRPAL +GKI+LCDR+ D++ AYQG         +  L E++
Sbjct: 63  KAELLLYAAARAQHVAEVIRPALDQGKIVLCDRYCDATLAYQGYARGLDLPMVKQLNELA 122

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
                P  T++LD+P D GL R ++R +L        FE++ +  H K RQ +LD+AR +
Sbjct: 123 AGNCRPHLTLLLDMPHDRGLLRARSRNALGAGPEEGRFEQESLAFHNKVRQGYLDLARQE 182

Query: 185 PDRCHIVDSAHSFQSVATNI 204
           P R  +VD+  +   V   I
Sbjct: 183 PQRIKVVDANGTLDEVCHRI 202


>gi|237800352|ref|ZP_04588813.1| thymidylate kinase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023209|gb|EGI03266.1| thymidylate kinase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 210

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 124/211 (58%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERVRELLLAPSEESM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHQRIATLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV++GL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEVGLARAAAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A +   V  ++  ++ +L++
Sbjct: 176 AEPARYRLVDAAQTLAEVQASLDTLLPQLLE 206


>gi|325295138|ref|YP_004281652.1| Thymidylate kinase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065586|gb|ADY73593.1| Thymidylate kinase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 206

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 120/204 (58%), Gaps = 7/204 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T   LL  +  +K  +  +TREPGGTPAAE  R+ +L    + F A
Sbjct: 1   MFITFEGIEGCGKSTQAKLLYDWFLKKGKEAILTREPGGTPAAEEIRNFILRPRKETFPA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE  ++ AAR  HVEN+I+PAL +G  ++CDRF+DS+ AYQG         ++ L E +
Sbjct: 61  FAELCLYMAARGFHVENLIKPALKKGIWVVCDRFVDSTVAYQGYGRGINVELIEKLNEEA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + PD T ++D+PV+IG  R++ R        LD  E++++  HE+ RQ FL IA   
Sbjct: 121 TGNLKPDLTFLIDVPVEIGFSRIKRR-------DLDRMEQEEMDFHERVRQGFLRIAEKN 173

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
            +R  ++D       +   ILN +
Sbjct: 174 SERVIVIDGTKKVDEIFDEILNTL 197


>gi|49078908|gb|AAT49833.1| PA2962 [synthetic construct]
          Length = 211

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 120/212 (56%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         + +L+ 
Sbjct: 62  AADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++D    E  RQ +L  A 
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLARAAAR------GRLDRFEQEDRRFFEAVRQTYLQRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P+R  ++D+      V   +  ++  L+++
Sbjct: 176 QAPERYQVLDAGLPLAEVQAGLDRLLPNLLER 207


>gi|15598158|ref|NP_251652.1| thymidylate kinase [Pseudomonas aeruginosa PAO1]
 gi|107102512|ref|ZP_01366430.1| hypothetical protein PaerPA_01003575 [Pseudomonas aeruginosa PACS2]
 gi|218890840|ref|YP_002439704.1| thymidylate kinase [Pseudomonas aeruginosa LESB58]
 gi|254235937|ref|ZP_04929260.1| thymidylate kinase [Pseudomonas aeruginosa C3719]
 gi|313108146|ref|ZP_07794281.1| thymidylate kinase [Pseudomonas aeruginosa 39016]
 gi|14285514|sp|Q9HZN8|KTHY_PSEAE RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|226732662|sp|B7V167|KTHY_PSEA8 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|9949060|gb|AAG06350.1|AE004722_6 thymidylate kinase [Pseudomonas aeruginosa PAO1]
 gi|126167868|gb|EAZ53379.1| thymidylate kinase [Pseudomonas aeruginosa C3719]
 gi|218771063|emb|CAW26828.1| thymidylate kinase [Pseudomonas aeruginosa LESB58]
 gi|310880783|gb|EFQ39377.1| thymidylate kinase [Pseudomonas aeruginosa 39016]
          Length = 210

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 120/212 (56%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         + +L+ 
Sbjct: 62  AADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++D    E  RQ +L  A 
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLARAAAR------GRLDRFEQEDRRFFEAVRQTYLQRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P+R  ++D+      V   +  ++  L+++
Sbjct: 176 QAPERYQVLDAGLPLAEVQAGLDRLLPNLLER 207


>gi|167032505|ref|YP_001667736.1| thymidylate kinase [Pseudomonas putida GB-1]
 gi|189030837|sp|B0KF60|KTHY_PSEPG RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|166858993|gb|ABY97400.1| dTMP kinase [Pseudomonas putida GB-1]
          Length = 210

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 123/212 (58%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+ EG EGAGK+T+   L   L+    DV +TREPGGTP AE  R +LL+   +  
Sbjct: 2   SGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTPLAERVRELLLAPSDESM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         + +L++
Sbjct: 62  AADTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIATLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
                + PD T++ DLPV++GL R   R        LD FE++     E  RQ +L  A+
Sbjct: 122 FVQGGLRPDLTLVFDLPVEVGLARAAAR------GRLDRFEQEGQAFFEAVRQAYLQRAQ 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P R  ++D+A S ++V  +I  ++  +V++
Sbjct: 176 RAPQRYSLLDAAQSLEAVQRDIDALLPGIVER 207


>gi|281356872|ref|ZP_06243362.1| thymidylate kinase [Victivallis vadensis ATCC BAA-548]
 gi|281316430|gb|EFB00454.1| thymidylate kinase [Victivallis vadensis ATCC BAA-548]
          Length = 219

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 123/213 (57%), Gaps = 3/213 (1%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSC-GVD 60
           + G  I+FEG EGAGK+T + LL  +L+ K ++V  TREPGGTP AE  R V+ +  G +
Sbjct: 9   HPGRLITFEGPEGAGKSTQLKLLAGYLEEKGFEVIATREPGGTPLAERLRAVIKAFEGEE 68

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E ++  AAR  HV  VIRPAL  GKI+LCDR+ DS+ AYQG         +D+L
Sbjct: 69  KLHNTTELLLIEAARSQHVREVIRPALAAGKIVLCDRYFDSTTAYQGGARGFDAEAIDAL 128

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            ++++ E  PD T++ DL  + G  R + R   +     D FE + +  H + R+ +L I
Sbjct: 129 NDLAIAECAPDLTLLFDLTPEAGFARTRTRTETQGEH--DRFEEEKLEFHRQVRESYLTI 186

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A  +P+R  +V +    Q + T +  +V EL++
Sbjct: 187 AAREPERVRVVAADRPAQEIQTEVRKLVDELIR 219


>gi|302187273|ref|ZP_07263946.1| thymidylate kinase [Pseudomonas syringae pv. syringae 642]
          Length = 210

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 125/211 (59%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHQRIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A +   V  ++  ++ +L++
Sbjct: 176 AEPARYRLVDAAQTLADVQASLDTLLPQLLE 206


>gi|152985503|ref|YP_001347571.1| thymidylate kinase [Pseudomonas aeruginosa PA7]
 gi|166223103|sp|A6V3D6|KTHY_PSEA7 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|150960661|gb|ABR82686.1| thymidylate kinase [Pseudomonas aeruginosa PA7]
          Length = 210

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 119/212 (56%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFVTLEGPEGAGKSTNRDYLAERLRERGVEVQLTREPGGTPLAERIRELLLAPSDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         + +L+ 
Sbjct: 62  AADTELLLMFAARAQHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++D    E  RQ +L  A 
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLARAAAR------GRLDRFEQEDRRFFEAVRQTYLQRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P R  ++D+      V   +  ++  L+++
Sbjct: 176 QAPQRYQVLDAGLPLAEVQAGLDRLLPNLLER 207


>gi|66044897|ref|YP_234738.1| thymidylate kinase [Pseudomonas syringae pv. syringae B728a]
 gi|75502746|sp|Q4ZVX2|KTHY_PSEU2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|63255604|gb|AAY36700.1| Thymidylate kinase [Pseudomonas syringae pv. syringae B728a]
          Length = 210

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 124/211 (58%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERVRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHQRIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ AR
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAR 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A +   V   +  ++ +L++
Sbjct: 176 AEPARYRLVDAAQTLADVQACLDTLLPQLLE 206


>gi|90415870|ref|ZP_01223803.1| thymidylate kinase [marine gamma proteobacterium HTCC2207]
 gi|90332244|gb|EAS47441.1| thymidylate kinase [marine gamma proteobacterium HTCC2207]
          Length = 208

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 123/215 (57%), Gaps = 15/215 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GKTT+I  ++ ++  K      TREPGGTP AE  R +LL+   +   
Sbjct: 3   GKFITIEGTEGVGKTTNIKFIQDWMDSKKLTYGCTREPGGTPLAEQVRELLLAPREESVC 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ-- 121
             AE ++  AAR  H+  VI P L EG  +LCDRF D++YAYQG   + +H+  D ++  
Sbjct: 63  NTAELLMVFAARAQHLNQVIEPMLGEGAWVLCDRFTDATYAYQG---AGRHMRDDLIRDL 119

Query: 122 EISVQ-EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E+ VQ  + PD T+ILD+PV IGL R   R      +  D FE++ V   E+ R  +L I
Sbjct: 120 ELMVQGSLQPDLTLILDIPVQIGLARASER------STPDRFEQEQVAFFERVRNRYLQI 173

Query: 181 ARNQPDRCHIVDSAHSFQSVA---TNILNIVWELV 212
           A++ P RC ++D++ + + V    T  L   WE V
Sbjct: 174 AQDNPQRCVVIDASLTLEGVQAQITQTLETFWETV 208


>gi|330952693|gb|EGH52953.1| thymidylate kinase [Pseudomonas syringae Cit 7]
          Length = 210

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 125/211 (59%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGIQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A +   V  ++  ++ +L++
Sbjct: 176 AEPARYRLVDAAQTLADVQASLDTLLPQLLE 206


>gi|218289082|ref|ZP_03493319.1| dTMP kinase [Alicyclobacillus acidocaldarius LAA1]
 gi|218240907|gb|EED08085.1| dTMP kinase [Alicyclobacillus acidocaldarius LAA1]
          Length = 213

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 120/214 (56%), Gaps = 3/214 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GL I+FEGI+GAGKTT +  L  +L+ +   V VTREPGGT   +A R +LL     
Sbjct: 1   MRKGLLITFEGIDGAGKTTQLLRLAAWLEAQGLPVIVTREPGGTRIGDAVRAILLDPRHQ 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++AA+R  HVE +IRPAL  G+I+LCDRF+D+S AYQG        ++++L
Sbjct: 61  EMAPRTEALLYAASRAQHVEELIRPALARGEIVLCDRFVDASIAYQGAGLGLGEAWVEAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E ++  + PD T+  DL       R++ R    E   LD  ER+D    E+    F  +
Sbjct: 121 NEYALGGLRPDLTLWFDLDWPTARSRLRARV---EGGGLDRIERRDEAFFERVADAFERL 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R  P+    +D+A S   +   I  +VW L+Q+
Sbjct: 178 WRAMPEVRKRIDAARSPDDIEQEIRALVWNLIQQ 211


>gi|222055245|ref|YP_002537607.1| dTMP kinase [Geobacter sp. FRC-32]
 gi|254808294|sp|B9M910|KTHY_GEOSF RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|221564534|gb|ACM20506.1| dTMP kinase [Geobacter sp. FRC-32]
          Length = 214

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 117/195 (60%), Gaps = 7/195 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG GKTT I LL++ L  K + V +TREPGG P A+  R +LL        
Sbjct: 2   GCFITFEGIEGCGKTTQIKLLEQHLAEKGFKVLLTREPGGCPIADQIRAILLDAANSAMT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS---L 120
             AE +++AAAR  HVE VI+PAL +  I+LCDRF D++ AYQG     + L LDS   L
Sbjct: 62  PSAELLLYAAARAQHVEEVIKPALADDCIVLCDRFTDATVAYQG---YGRGLDLDSIGYL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYS-LRESACLDYFERKDVMIHEKRRQIFLD 179
            +++   + P  TI+LD PV++GLKR   R + +   A  + FE +  + H+K R  +L 
Sbjct: 119 NQLATSGLKPQLTILLDCPVEVGLKRALARINGISAGAREERFELESTLFHQKVRNGYLK 178

Query: 180 IARNQPDRCHIVDSA 194
           +A N+  R  IVD  
Sbjct: 179 LAENEKGRFLIVDGG 193


>gi|258510140|ref|YP_003183574.1| thymidylate kinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257476866|gb|ACV57185.1| thymidylate kinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 213

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 120/214 (56%), Gaps = 3/214 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GL I+FEGI+GAGKTT +  L  +L+ +   V VTREPGGT   +A R +LL     
Sbjct: 1   MRKGLLITFEGIDGAGKTTQLLRLAAWLEAQGLPVIVTREPGGTRIGDAVRAILLDPRHQ 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++AA+R  HVE +IRPAL  G+I+LCDRF+D+S AYQG        ++++L
Sbjct: 61  EMAPRTEALLYAASRAQHVEELIRPALARGEIVLCDRFVDASIAYQGAGLGLGEAWVEAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E ++  + PD T+  DL       R++ R    E   LD  ER+D    E+    F  +
Sbjct: 121 NEYALGGLRPDLTLWFDLDWPTARSRLRARA---EGGGLDRIERRDEAFFERVADAFERL 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R  P+    +D+A S   +   I  +VW L+Q+
Sbjct: 178 WRAAPEVRKRIDAARSPDDIEQEIRALVWNLIQQ 211


>gi|330973853|gb|EGH73919.1| thymidylate kinase [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 210

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 124/211 (58%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELMLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHQRIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ AR
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAR 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+A +   V   +  ++ +L++
Sbjct: 176 AEPARYRLVDAAQTLADVQACLDTLLPQLLE 206


>gi|330966243|gb|EGH66503.1| thymidylate kinase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 210

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 125/211 (59%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDESM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VI PAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVICPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLNRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P+R  +VD+A S   V  ++  ++ EL++
Sbjct: 176 AEPERYRLVDAAQSLADVQASLDKLLPELLE 206


>gi|167768112|ref|ZP_02440165.1| hypothetical protein CLOSS21_02667 [Clostridium sp. SS2/1]
 gi|317499447|ref|ZP_07957714.1| thymidylate kinase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167709636|gb|EDS20215.1| hypothetical protein CLOSS21_02667 [Clostridium sp. SS2/1]
 gi|291559963|emb|CBL38763.1| thymidylate kinase [butyrate-producing bacterium SSC/2]
 gi|316893319|gb|EFV15534.1| thymidylate kinase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 208

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 124/205 (60%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++ EG +GAGKTT I LL+ +L  K YD+ V REPGGTP +EA R+V+L+    E G
Sbjct: 2   GLFLTVEGPDGAGKTTQIELLRDYLSDKGYDIIVCREPGGTPISEAVRNVILNKEFTEMG 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++AAAR   +E VIRPAL +GKI++CDRF++SS  YQG         +  + + 
Sbjct: 62  HMTELLLYAAARAQLIEEVIRPALEDGKIVICDRFVESSAVYQGIARGMGIDLVYKVNQF 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ + MPD TI++DL  + G+ R       ++ A LD  E + +  H+K  + +  +A  
Sbjct: 122 AIGDTMPDLTIMIDLDAEAGISRK------KKQAELDRMESETIDFHKKVVEGYRQLASL 175

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            PDR + VD + + + +   I++ V
Sbjct: 176 HPDRIYTVDGSLTIEEIHQKIVSQV 200


>gi|288958657|ref|YP_003448998.1| dTMP kinase [Azospirillum sp. B510]
 gi|288910965|dbj|BAI72454.1| dTMP kinase [Azospirillum sp. B510]
          Length = 229

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 123/218 (56%), Gaps = 13/218 (5%)

Query: 4   GLFISFEGIEGAGKTTHI----SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           G  I+ EG EGAGK+T +      L+  L+ +   +  TREPGG+P AE  R +L++   
Sbjct: 11  GRLITLEGGEGAGKSTQLRRLAGRLRETLRARGAGLVTTREPGGSPGAEEIRALLVTGET 70

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
             +    EA++ +AAR DH+E  + PAL  G  +LCDRFLDS+ AYQG         +++
Sbjct: 71  GRWSPVTEALLHSAARRDHLERTVWPALETGDWVLCDRFLDSTMAYQGYGLGLGRALVET 130

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +Q  ++ +  PD T+ILD+ V+ GL+R   R+        D +ER D+  H++ R  FLD
Sbjct: 131 VQRAALGDFRPDLTLILDIEVEKGLRRAVARH-----GGEDRYERMDIGFHQRLRDGFLD 185

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           IAR +PDRC +VD+     +V       VW+ V  R+ 
Sbjct: 186 IARREPDRCAVVDADADPDTVQAR----VWDAVSGRLG 219


>gi|313499927|gb|ADR61293.1| Tmk [Pseudomonas putida BIRD-1]
          Length = 210

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 124/212 (58%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+ EG EGAGK+T+   L   L+    DV +TREPGGTP AE  R +LL+   +  
Sbjct: 2   SGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTPLAEKVRELLLTPSDEGM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         +  L++
Sbjct: 62  AADTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAVLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV++GL R   R        LD FE++     E  RQ +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEVGLARAAAR------GRLDRFEQEGQAFFEAVRQAYLQRAQ 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + P R  ++D+A S ++V  +I  ++  ++++
Sbjct: 176 SAPQRYSLLDAAQSLEAVQRDIDALLPGILER 207


>gi|148549001|ref|YP_001269103.1| thymidylate kinase [Pseudomonas putida F1]
 gi|166223106|sp|A5W709|KTHY_PSEP1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|148513059|gb|ABQ79919.1| thymidylate kinase [Pseudomonas putida F1]
          Length = 210

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 123/212 (58%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+ EG EGAGK+T+   L   L+    DV +TREPGGTP AE  R +LL+   +  
Sbjct: 2   SGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTPLAEKVRELLLTPSDEGM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         +  L++
Sbjct: 62  AADTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAVLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV++GL R   R        LD FE++     E  RQ +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEVGLARAAAR------GRLDRFEQEGQAFFEAVRQAYLQRAQ 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P R  ++D+A S ++V  +I  ++  ++++
Sbjct: 176 GAPQRYSLLDAAQSLEAVQRDIDALLPGILER 207


>gi|163746821|ref|ZP_02154178.1| thymidylate kinase [Oceanibulbus indolifex HEL-45]
 gi|161379935|gb|EDQ04347.1| thymidylate kinase [Oceanibulbus indolifex HEL-45]
          Length = 214

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 120/206 (58%), Gaps = 6/206 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLF++FEGI+G+GK+T   LL   L  + +DV +TREPGG+P AE  R ++L    D +
Sbjct: 10  SGLFVTFEGIDGSGKSTQARLLADHLTAQGHDVVLTREPGGSPGAEEIRALVLQGDPDRW 69

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++F AAR DH+E  IRPAL  GKI++CDRF DS+  YQG         +D L  
Sbjct: 70  SAQTEILLFTAARRDHLERTIRPALDAGKIVICDRFADSTRMYQGLSRGDLRQMVDDLHA 129

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +  V PD T+++D+    GL+R  +R +  E      FE   V +  + R  FL++A+
Sbjct: 130 LMIG-VEPDLTVLIDMDPANGLERALSRQTAEE-----RFEDFGVELQAQMRAGFLNLAK 183

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
              DR H++D      +VA ++   V
Sbjct: 184 EFSDRFHVIDGGREIDTVARDVTATV 209


>gi|256822417|ref|YP_003146380.1| thymidylate kinase [Kangiella koreensis DSM 16069]
 gi|256795956|gb|ACV26612.1| thymidylate kinase [Kangiella koreensis DSM 16069]
          Length = 216

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 132/217 (60%), Gaps = 12/217 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GK+T+I+ +K + + KN  +  TREPGGTP AE  R +LLS   ++  
Sbjct: 7   GKFITIEGTEGVGKSTNIAFIKAWFEAKNISLLHTREPGGTPFAEEIRELLLSQREEQVD 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A++E ++  AAR  HV   I+PAL + + +LCDRF D+S+AYQG   + + L L+ L E+
Sbjct: 67  AKSELLLMYAARAQHVSQKIKPALEQRQWVLCDRFSDASFAYQG---AGRALGLNKLSEL 123

Query: 124 S---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
               ++   PD TI+LDLPV++GL R Q R        +D FE + V   E+ RQ +L I
Sbjct: 124 DQWVLEGFKPDLTILLDLPVEVGLSRAQER------GPIDRFEEEKVEFFEQVRQGYLQI 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           A+ +P+R  IVD+  S + V   I  ++    Q++V+
Sbjct: 178 AQQEPERMKIVDARGSLEKVQQQIEQVLIHFYQQQVT 214


>gi|292493122|ref|YP_003528561.1| thymidylate kinase [Nitrosococcus halophilus Nc4]
 gi|291581717|gb|ADE16174.1| thymidylate kinase [Nitrosococcus halophilus Nc4]
          Length = 213

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 124/213 (58%), Gaps = 5/213 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FIS EGIEGAGK+T +  +++ L+     V VTREPGGTP  E  R +LL+  ++
Sbjct: 1   MGRGCFISVEGIEGAGKSTQLKFIQQLLESAGKAVTVTREPGGTPLGEQIRTLLLTPRLE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              AE E ++  AAR++HV  VI PAL  G+ +LCDRF  +SYAYQG         +++L
Sbjct: 61  GMSAETELLLMFAARVEHVRQVISPALARGRWVLCDRFTGASYAYQGGGRGLPLARIEAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +  ++  + PD T++LD+PV +GL+R  +R   R+    D FE++     E  R+ +L +
Sbjct: 121 EHWALNHLRPDLTLLLDVPVGVGLQRAASR---RQQP--DRFEQEQAGFFECVRKAYLSL 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A+ + D   ++D++     V   I  ++   ++
Sbjct: 176 AKERVDEFRLIDASMPLPEVQEAIQQVIMAFIE 208


>gi|149184555|ref|ZP_01862873.1| thymidylate kinase [Erythrobacter sp. SD-21]
 gi|148831875|gb|EDL50308.1| thymidylate kinase [Erythrobacter sp. SD-21]
          Length = 209

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 118/212 (55%), Gaps = 4/212 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EG GK+T   LL+  L+++  +V +TREPGGTP AEA R +LL    +
Sbjct: 1   MRKGKFIAFEGGEGMGKSTQARLLRDALEQRGIEVELTREPGGTPGAEAIREMLLHPPGE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +GA+AEA++FAAAR DHV  +IRPA+  G+ ++CDRFLDSS AYQG         +  L
Sbjct: 61  GWGAQAEALLFAAARADHVARLIRPAVEAGRWVVCDRFLDSSRAYQGSAGELGDEQVRKL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            EI    ++PD TI++    D     V  R   R+    D    +D   H    + F   
Sbjct: 121 HEIGTGGLLPDLTIVIGAHSD----EVSARLRARDGDTSDAIGGRDETYHRSVNKAFERF 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A  +P+R   +D + S + V   I+  +  L+
Sbjct: 177 AEEEPNRFARIDGSGSIEDVHVRIMTALAGLL 208


>gi|327481307|gb|AEA84617.1| thymidylate kinase [Pseudomonas stutzeri DSM 4166]
          Length = 210

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 122/212 (57%), Gaps = 12/212 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++ EG EGAGK+T+   L   L+ +  DV +TREPGGTP AE  R +LL+   +   
Sbjct: 3   GLFVTLEGPEGAGKSTNREYLAERLRARGLDVVLTREPGGTPLAERIRELLLTPADEPMA 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG     + L L+ + ++
Sbjct: 63  VDTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQG---GGRGLSLERIAQL 119

Query: 124 SV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
                 ++ PD T+I DLPVD+GL R   R        LD FE++ +   E  R  +L  
Sbjct: 120 ETFVQGDLRPDLTLIFDLPVDVGLARAAAR------GRLDRFEQEGMRFFEAVRSAYLQR 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A+  P R  ++D+  +  +V  ++  ++ EL+
Sbjct: 174 AKAAPSRYRVIDAGQALNAVQCDVEALIPELL 205


>gi|110833935|ref|YP_692794.1| dTMP kinase; thymidylate kinase [Alcanivorax borkumensis SK2]
 gi|123050570|sp|Q0VQM6|KTHY_ALCBS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|110647046|emb|CAL16522.1| dTMP kinase; thymidylate kinase [Alcanivorax borkumensis SK2]
          Length = 208

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 123/209 (58%), Gaps = 6/209 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+ EG EGAGK++++  L   L+ +   V V+REPGGT  AE+ R VLL+   +  
Sbjct: 2   SGRFITLEGGEGAGKSSNLVWLAEALRAEGKTVMVSREPGGTALAESIREVLLAPSNEVM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + E ++  AAR  H+E  IRPAL  G+ +LCDRFLD+++AYQG         + +L+ 
Sbjct: 62  ADDTELLLVFAARAQHLEQKIRPALARGEWVLCDRFLDATWAYQGAGRGLDSAAIAALEA 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +++  PD TI+ D+PV++G+ R   R      A LD  E++D    ++ RQ +L  A 
Sbjct: 122 LVIRDTRPDMTILFDVPVEVGMARAGKR------AALDRIEQEDRAFFDRIRQCYLARAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWEL 211
            +P+R   VD++   +SV   +  IV E+
Sbjct: 176 QEPNRFRTVDASQPLESVQQQLARIVEEM 204


>gi|260434141|ref|ZP_05788112.1| thymidylate kinase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417969|gb|EEX11228.1| thymidylate kinase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 210

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 123/211 (58%), Gaps = 6/211 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+F++FEGI+G+GK+T   +L   L+   ++V +TREPGG+P AE  R ++L    D + 
Sbjct: 5   GMFLTFEGIDGSGKSTQARMLAEHLRLSGHEVVLTREPGGSPGAEEIRRLVLEGDPDRWS 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE E ++F AAR DH+E  I PAL EGKI++CDRF DS+  YQG         +D L ++
Sbjct: 65  AETEILLFTAARRDHLERTIEPALAEGKIVICDRFADSTRMYQGLSRGDLRAIVDQLHQL 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            ++   PD T+++D+  + GL R + R+   E      FE     +  + R+ FL++A  
Sbjct: 125 MIRRE-PDLTLLIDMDPETGLARAKGRHGGEER-----FEDFGPDLQRRMRKGFLELAEE 178

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            P+R  ++D      SV+ ++  I  + +Q+
Sbjct: 179 FPERFRVIDGNRDMDSVSRDVTQIALQALQQ 209


>gi|330502601|ref|YP_004379470.1| thymidylate kinase [Pseudomonas mendocina NK-01]
 gi|328916887|gb|AEB57718.1| thymidylate kinase [Pseudomonas mendocina NK-01]
          Length = 210

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 119/211 (56%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +  DV +TREPGGTP AE  R +LL    +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAERLRERGIDVLLTREPGGTPLAERIRELLLEPSDESM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H++ VIRPAL  G ++LCDRF D++YAYQG         +  L++
Sbjct: 62  AADTELLLVFAARAQHLQQVIRPALANGCVVLCDRFTDATYAYQGGGRGLSIERIAQLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               E+ PD T+I DLPV+IGL R   R        LD FE++     E  RQ +L  A 
Sbjct: 122 FVQGELRPDLTLIFDLPVEIGLARAAAR------GRLDRFEQEGRGFFEAVRQAYLQRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
             P R  ++D+  +   V  +I  ++  L++
Sbjct: 176 QAPQRYRVLDAGQTLAQVQADIDALLPSLLE 206


>gi|84499967|ref|ZP_00998233.1| thymidylate kinase [Oceanicola batsensis HTCC2597]
 gi|84391901|gb|EAQ04169.1| thymidylate kinase [Oceanicola batsensis HTCC2597]
          Length = 217

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF+SFEGI+G+GK+T   +L   L+ +  DV +TREPGG+P AE  R ++L    D + 
Sbjct: 9   GLFLSFEGIDGSGKSTQARMLAEALRAEGRDVVLTREPGGSPGAEEIRALVLQGDPDRWS 68

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  E ++F AAR DH+E  IRPAL  G +++CDRF DS+  YQG         +D L  +
Sbjct: 69  AATEILLFTAARRDHLERTIRPALDRGAVVICDRFADSTRMYQGLSRGDLRRTVDDLHAL 128

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  + PD T+++D+  ++GL R + R  + E      FE     +  + R  FLD+AR 
Sbjct: 129 MIG-IEPDLTLLIDMDPEVGLSRAKGRQGIEE-----RFEDFGAGLQARMRTGFLDLARE 182

Query: 184 QPDRCHIVDSAHSFQSVATNILN 206
            P R  ++D A    +VA ++L 
Sbjct: 183 FPARFRVIDGARPEGTVAADVLT 205


>gi|289671976|ref|ZP_06492866.1| thymidylate kinase [Pseudomonas syringae pv. syringae FF5]
          Length = 210

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 124/211 (58%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+  +   V  ++  ++ +L++
Sbjct: 176 AEPARYRLVDAGQTLADVQDSLDTLLPQLLE 206


>gi|330901144|gb|EGH32563.1| thymidylate kinase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 210

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 124/211 (58%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEVM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+  +   V  ++  ++ +L++
Sbjct: 176 AEPARYRLVDAGQTLADVQASLDTLLPQLLE 206


>gi|319789392|ref|YP_004151025.1| thymidylate kinase [Thermovibrio ammonificans HB-1]
 gi|317113894|gb|ADU96384.1| thymidylate kinase [Thermovibrio ammonificans HB-1]
          Length = 206

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 115/206 (55%), Gaps = 7/206 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T   L   +L  + Y   +TREPGGTPAAE  R VLL    + F  
Sbjct: 1   MFITFEGIEGCGKSTQARLTYEWLLDRGYTSVLTREPGGTPAAEKVREVLLKRWEERFPP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE  ++ AAR  HVEN+I+PAL EG I++CDRF DS+ AYQ         F+  L   +
Sbjct: 61  MAELFLYEAARAFHVENLIKPALQEGSIVICDRFTDSTLAYQSFGRGLSREFVALLNRKA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + PD T+++DLPV+   +R+  +         D  E + +  H + R+ FL IAR +
Sbjct: 121 TGGLKPDLTLLIDLPVEEAFRRIAQKSR-------DRMESEPLEFHRRVREGFLSIAREE 173

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWE 210
           P+R  ++D   +   V   +  ++ E
Sbjct: 174 PERVAVIDGRGTVSEVFERVKRVIEE 199


>gi|298291754|ref|YP_003693693.1| thymidylate kinase [Starkeya novella DSM 506]
 gi|296928265|gb|ADH89074.1| thymidylate kinase [Starkeya novella DSM 506]
          Length = 243

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 8/213 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T +  L+  L     +   TREPGG+  AE  RH++LS      G
Sbjct: 28  GRFITFEGGEGAGKSTQVRRLREKLAELGIEAVATREPGGSTGAEIMRHLILSGAAKPLG 87

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA +FAAAR DH++  IRPAL  G  ++CDRF DS+ AYQG   +     + +L+E+
Sbjct: 88  PLAEAALFAAARADHLDATIRPALARGAWVVCDRFADSTRAYQGVLGNIDPRLIAALEEV 147

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V +  PD T+ILD+P + GL    +R S R     D FE + V  H + R+ F  +A N
Sbjct: 148 TVGDTRPDLTLILDIPAEEGL----SRASARSGVAADRFESEGVGFHRRLREAFRALAEN 203

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           +P RC ++D+     +VA  I    W  VQ+R+
Sbjct: 204 EPQRCVLIDARPDADTVAEAI----WTAVQERL 232


>gi|30250115|ref|NP_842185.1| thymidylate kinase [Nitrosomonas europaea ATCC 19718]
 gi|46576512|sp|Q82SW5|KTHY_NITEU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|30139222|emb|CAD86092.1| Thymidylate kinase [Nitrosomonas europaea ATCC 19718]
          Length = 215

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 7/208 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EGI+GAGK+TH++ L+RFLQ K  +V VTREPGGT   EA R +LL     
Sbjct: 1   MQRGKFITVEGIDGAGKSTHLAWLERFLQDKGLEVVVTREPGGTALGEALRQLLLDH-RQ 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               E EA++  AAR +H++ VI PAL  G  ++ DRF D+S+AYQG         LD+L
Sbjct: 60  AMHPETEALLMFAARREHLDKVILPALDRGAWVVSDRFTDASFAYQGGGRGVAQSKLDNL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++    E+ PD T+  D+PV +G +R+Q+      +   D FE +  +  E+ RQ +L  
Sbjct: 120 EQWVQAELSPDLTVYFDVPVIVGRERLQS------TRVADRFEMESNLFFERVRQAYLQR 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P R  +VD +     V T +  IV
Sbjct: 174 AEQFPQRIRVVDGSRLLAEVKTAVAEIV 201


>gi|300023248|ref|YP_003755859.1| thymidylate kinase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525069|gb|ADJ23538.1| thymidylate kinase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 209

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 121/212 (57%), Gaps = 12/212 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EG GK+T    L   L+R    V +TREPGGTP  E  R +++     
Sbjct: 1   MKRGKFITFEGGEGVGKSTQAKRLAERLERAGVPVIITREPGGTPVGEDVRDLIMKDRPT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E ++FAAAR +HV +VIRPAL +G  ++ DRF+DS+  YQG+R   +   +  L
Sbjct: 61  D--PMTELLLFAAARAEHVTSVIRPALDDGTWVISDRFIDSTRVYQGKRYGLEPELISLL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +  +V    PD T+ILDLP   G++R QNR        L  ++ + +  HE  R+ FL+I
Sbjct: 119 ERYTVSPDFPDLTLILDLPATEGVERAQNR------GTLSRYDAERIETHEVLRKGFLEI 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A ++P RC ++D++    SV T     VW+ V
Sbjct: 173 ATSEPKRCVLIDASLPVSSVETA----VWQAV 200


>gi|146282956|ref|YP_001173109.1| thymidylate kinase [Pseudomonas stutzeri A1501]
 gi|166223107|sp|A4VMR6|KTHY_PSEU5 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|145571161|gb|ABP80267.1| thymidylate kinase [Pseudomonas stutzeri A1501]
          Length = 210

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 121/212 (57%), Gaps = 12/212 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++ EG EGAGK+T+   L   L+ +  DV +TREPGGTP AE  R +LL+   +   
Sbjct: 3   GLFVTLEGPEGAGKSTNREYLAERLRARGLDVVLTREPGGTPLAERIRELLLTPADEPMA 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG     + L L+ + ++
Sbjct: 63  VDTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQG---GGRGLSLERIAQL 119

Query: 124 SV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
                 ++ PD T+I DLPVD+GL R   R        LD FE++ +   E  R  +L  
Sbjct: 120 ETFVQGDLRPDLTLIFDLPVDVGLARAAAR------GRLDRFEQEGMRFFEAVRSAYLQR 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A   P R  ++D+  +  +V  ++  ++ EL+
Sbjct: 174 AEAAPSRYRVIDAGQALNAVQCDVEALIPELL 205


>gi|330722496|gb|EGH00323.1| Thymidylate kinase [gamma proteobacterium IMCC2047]
          Length = 216

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 123/203 (60%), Gaps = 6/203 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +G+FI+ EGIEG GKTT+++ ++++LQ    D+ VTREPGGTP AE  R +LL+   + 
Sbjct: 4   QAGVFITVEGIEGVGKTTNMAFIQQYLQALGVDLTVTREPGGTPLAEEIRGLLLNNRDEA 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              +AE ++  AAR  H+  +I+P L +G  +L DRF D++YAYQG         + +L+
Sbjct: 64  LNNDAELLLVFAARAQHLGQLIKPTLAQGGWVLSDRFTDATYAYQGGGRELSMEMIANLE 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++   ++ P+ T++LD+PV++GL R   R        LD FER+     EK R  +L  A
Sbjct: 124 QMVQGDLRPNLTLLLDVPVEVGLSRAGQR------GELDRFEREKQAFFEKVRHTYLQRA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
           + +P+R  +VD++    +V  +I
Sbjct: 178 QAEPERFCVVDASQPLAAVQADI 200


>gi|170720716|ref|YP_001748404.1| thymidylate kinase [Pseudomonas putida W619]
 gi|259494278|sp|B1J4Z5|KTHY_PSEPW RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|169758719|gb|ACA72035.1| dTMP kinase [Pseudomonas putida W619]
          Length = 207

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 122/210 (58%), Gaps = 6/210 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG EGAGK+T+   L   L+ +  DV +TREPGGTP AE  R +LL+   +   A
Sbjct: 1   MFITLEGPEGAGKSTNRDYLAARLREQGLDVVLTREPGGTPLAEKVRELLLAPSDEVMAA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           + E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         + +L++  
Sbjct: 61  DTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAALEQFV 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
             E+ PD T++ DLPV++GL R   R        LD FE++     E  RQ +L  AR +
Sbjct: 121 QGELRPDLTLVFDLPVEVGLARAAAR------GRLDRFEQEGQAFFEAVRQAYLQRARRE 174

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           P R  ++D+A   ++V   I  ++  ++++
Sbjct: 175 PQRYDLLDAAQPLEAVQRAIDALLPGILER 204


>gi|254428585|ref|ZP_05042292.1| thymidylate kinase [Alcanivorax sp. DG881]
 gi|196194754|gb|EDX89713.1| thymidylate kinase [Alcanivorax sp. DG881]
          Length = 208

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 120/210 (57%), Gaps = 6/210 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+ EG EGAGK++++  L   L+     V V+REPGGT  AE+ R VLL+ G +  
Sbjct: 2   SGRFITLEGGEGAGKSSNLEWLADALRAAGKTVTVSREPGGTALAESIRGVLLAPGDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + E ++  AAR  H+E  IRPAL  G+ +LCDRF+D+++AYQG         +  L+ 
Sbjct: 62  ADDTELLLVFAARAQHLEQKIRPALARGEWVLCDRFVDATWAYQGAGRGLDSAAIADLES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +++  PD T++ D+PV++G+ R   R      A LD  E++D    E+ RQ +L  A 
Sbjct: 122 LVIRDTRPDMTVLFDVPVEVGMARAGKR------AALDRIEQEDRAFFERIRQCYLARAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +P R   VD+     SV   +  IV E++
Sbjct: 176 QEPSRFRTVDAGQPLGSVQQQLGAIVEEML 205


>gi|56697578|ref|YP_167947.1| thymidylate kinase [Ruegeria pomeroyi DSS-3]
 gi|81558404|sp|Q5LPV9|KTHY_SILPO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|56679315|gb|AAV95981.1| thymidylate kinase [Ruegeria pomeroyi DSS-3]
          Length = 211

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 116/207 (56%), Gaps = 6/207 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLF++FEGI+G+GK+T   LL   L+   +DV +TREPGG+P AE  R ++L    D 
Sbjct: 3   GTGLFLTFEGIDGSGKSTQARLLAETLRAAGHDVVLTREPGGSPGAEEIRRLVLEGDPDR 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  I PAL  G++++CDRF DS+  YQG         +D L 
Sbjct: 63  WSAETEILLFTAARRDHLERTIEPALAAGRVVICDRFADSTRMYQGLSRGDLRQLVDQLH 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD T+++D+  + GL R + R    E      FE     + ++ R  FLD+A
Sbjct: 123 ALMIGR-EPDLTLLVDMDPETGLSRAKGRQGSEER-----FEDFGPELQQRMRAGFLDLA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           R    R  I+D      SVA ++  IV
Sbjct: 177 REYAHRFRIIDGNRDMDSVAADVTEIV 203


>gi|330975208|gb|EGH75274.1| thymidylate kinase [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 210

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 123/211 (58%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+ +LCDRF D++YAYQG      H  + +L++
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEGVLCDRFTDATYAYQGGGRGLSHERIAALEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L+ A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLERAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P R  +VD+  +   V  ++  ++ +L++
Sbjct: 176 AEPTRYRLVDAGQTLADVQASLDTLLPQLLE 206


>gi|104780789|ref|YP_607287.1| thymidylate kinase [Pseudomonas entomophila L48]
 gi|166223104|sp|Q1ICY2|KTHY_PSEE4 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|95109776|emb|CAK14481.1| thymidylate kinase [Pseudomonas entomophila L48]
          Length = 210

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 113/202 (55%), Gaps = 6/202 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+ EG EGAGK+T+   L   L+ +  DV +TREPGGTP AE  R +LL+   +  
Sbjct: 2   SGLFITLEGPEGAGKSTNREYLAARLREQGVDVVMTREPGGTPLAERIRELLLAPSEEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         +  L+ 
Sbjct: 62  AVDTELLLMFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAILES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               E+ PD T++ DLPV++GL R   R        LD FE++     E  RQ +L  A 
Sbjct: 122 FVQGELRPDLTLVFDLPVEVGLARAAAR------GRLDRFEQEGQAFFEAVRQAYLQRAG 175

Query: 183 NQPDRCHIVDSAHSFQSVATNI 204
            QP R  ++D+A    +V   I
Sbjct: 176 QQPQRYSLLDAAQPLAAVQRAI 197


>gi|71735430|ref|YP_273889.1| thymidylate kinase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257487544|ref|ZP_05641585.1| thymidylate kinase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289624541|ref|ZP_06457495.1| thymidylate kinase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649352|ref|ZP_06480695.1| thymidylate kinase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|123637325|sp|Q48L36|KTHY_PSE14 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|71555983|gb|AAZ35194.1| thymidylate kinase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320327699|gb|EFW83707.1| thymidylate kinase [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330869264|gb|EGH03973.1| thymidylate kinase [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 210

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG         +  L+E
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
             P R  +VD+A     V  ++  ++ +L++ R
Sbjct: 176 ADPARYRLVDAAQPLADVQASLDTLLPQLLELR 208


>gi|330985597|gb|EGH83700.1| thymidylate kinase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 210

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG         +  L+E
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFADATYAYQGGGRGLSQQRIAVLEE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
             P R  +VD+A     V  ++  ++ +L++ R
Sbjct: 176 ADPARYRLVDAAQPLADVQASLDTLLPQLLELR 208


>gi|297172305|gb|ADI23282.1| thymidylate kinase [uncultured actinobacterium HF0770_13M05]
          Length = 208

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 120/220 (54%), Gaps = 12/220 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG+EG GKTT+I  L+  L++K  DV VTREPGGTP AE  R VLL    +
Sbjct: 1   MTRGRFITLEGVEGVGKTTNIGFLREILEQKGIDVLVTREPGGTPLAEEVREVLLQMRDE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA++  AAR  HV  VI PAL +G+ +LCDR+ D++YAYQG         L+ L
Sbjct: 61  SMDPITEALLIFAARSQHVSAVIEPALNDGRWVLCDRYTDATYAYQGGGRGVPLDTLERL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E +   + PD TI LD PV+I L R+ +R         D FE +D     + R  +L I
Sbjct: 121 AEFAQGSLWPDLTIFLDAPVNIALGRIADRQH-------DRFESEDSEFFARVRAGYLAI 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLS 220
              + +R  ++D+  S + V + +     EL+   + PL 
Sbjct: 174 VERE-ERAVLIDATRSLEDVQSRLA----ELINNFLEPLG 208


>gi|226943614|ref|YP_002798687.1| thymidylate kinase [Azotobacter vinelandii DJ]
 gi|226718541|gb|ACO77712.1| thymidylate kinase [Azotobacter vinelandii DJ]
          Length = 211

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 118/215 (54%), Gaps = 6/215 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ GLFI+ EG EGAGK+T+   L   L+    +V +TREPGGTP AE  R +LL+   +
Sbjct: 1   MSRGLFITLEGPEGAGKSTNRDYLAEGLRAAGREVVLTREPGGTPLAERIRELLLAPASE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               + E ++  AAR  H+  VIRPAL+ G ++LCDRF D+SYAYQG         +  L
Sbjct: 61  PMAVDTELLLVFAARAQHLAGVIRPALVRGAVVLCDRFTDASYAYQGAGRGVPEARIAIL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +     ++ PD T++ DLPV++GL R   R         D FE++D    E  RQ +L  
Sbjct: 121 EHFVQGDLRPDLTLLFDLPVEVGLARAAAR------GRPDRFEQEDRAFFEAVRQAYLRR 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A N   R  +VD+      V   +  ++ +L++ R
Sbjct: 175 AANDSARYRVVDAGRPLAEVQRTLDGLLPQLLESR 209


>gi|83593038|ref|YP_426790.1| thymidylate kinase [Rhodospirillum rubrum ATCC 11170]
 gi|83575952|gb|ABC22503.1| thymidylate kinase [Rhodospirillum rubrum ATCC 11170]
          Length = 214

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 120/223 (53%), Gaps = 9/223 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EGAGKTT +S L + L     +V  TREPGG+P AEA R +L++ G +
Sbjct: 1   MTGGRFITLEGGEGAGKTTQLSRLAQALAPLVPEVVTTREPGGSPGAEAIRGLLVAGGAE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    EA++ AAAR DH+   + PAL  G  ++CDRF DS+ AYQG         LD+L
Sbjct: 61  RWDPRGEALLHAAARRDHLLRTVWPALARGAWVVCDRFADSTSAYQGGGHGLPQDELDAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
                    PD T+I DLPV +GL R   R         D +ER D   H++    +  I
Sbjct: 121 HAFVCGGFQPDLTVIFDLPVAVGLARAGRR-----GGGEDRYERMDPAFHQRLFDRYHAI 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           A   P+RC ++++  + ++V   +    W +V +R   L+ ++
Sbjct: 176 ASAFPERCRLIEADGAIEAVHARL----WAVVLERFPELTERR 214


>gi|298486225|ref|ZP_07004288.1| Thymidylate kinase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159232|gb|EFI00290.1| Thymidylate kinase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 210

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG         +  L+E
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
             P R  +VD+A     V  ++  ++ +L++ R
Sbjct: 176 ADPARYRLVDAAQPLADVQASLDALLPQLLELR 208


>gi|320325316|gb|EFW81383.1| thymidylate kinase [Pseudomonas syringae pv. glycinea str. B076]
          Length = 210

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG         +  L+E
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAVAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
             P R  +VD+A     V  ++  ++ +L++ R
Sbjct: 176 ADPARYRLVDAAQPLADVQASLDTLLPQLLELR 208


>gi|296131635|ref|YP_003638882.1| thymidylate kinase [Thermincola sp. JR]
 gi|296030213|gb|ADG80981.1| thymidylate kinase [Thermincola potens JR]
          Length = 211

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 112/192 (58%), Gaps = 1/192 (0%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+FEG +GAGKTT +    + LQ K Y+V +TREPGGT   E+ R +LL    +  
Sbjct: 2   TGKFITFEGPDGAGKTTQMKRAAQALQEKGYEVILTREPGGTEIGESIRSILLDP-QNRM 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  HVE +I PAL  GK++LCDRF DS+ AYQG         L+ +  
Sbjct: 61  SHRTEALLYAAARAQHVEELILPALQAGKVVLCDRFADSTLAYQGYGRGINLNLLNIVNS 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +++  + PD TIILDL   +GL R++N+         D  E + V  H++ R+ FL IA 
Sbjct: 121 LAIGSLKPDLTIILDLDPQVGLNRIRNKRLAVAGETEDRIEMEKVEFHQRVREGFLSIAL 180

Query: 183 NQPDRCHIVDSA 194
             P R  I+ + 
Sbjct: 181 QDPGRYKIIAAG 192


>gi|325275807|ref|ZP_08141675.1| thymidylate kinase [Pseudomonas sp. TJI-51]
 gi|324099059|gb|EGB97037.1| thymidylate kinase [Pseudomonas sp. TJI-51]
          Length = 210

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 121/212 (57%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+ EG EGAGK+T+   L   L+    DV +TREPGGTP AE  R +LL+   +  
Sbjct: 2   SGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTPLAEKVRELLLAPSDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF D++YAYQG         + +L++
Sbjct: 62  AADTELLLVFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIATLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ P  T++ DLPV++GL R   R        LD FE++     +  RQ +L  A+
Sbjct: 122 FVQGDLRPQLTLVFDLPVEVGLARAAAR------GRLDRFEQEGQAFFQAVRQAYLQRAQ 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            +P R  ++D+A    +V   I  ++  +V++
Sbjct: 176 REPQRYSLLDAAQPLPAVQRAIDALLPAIVER 207


>gi|229592102|ref|YP_002874221.1| thymidylate kinase [Pseudomonas fluorescens SBW25]
 gi|259494277|sp|C3K0M9|KTHY_PSEFS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229363968|emb|CAY51499.1| thymidylate kinase [Pseudomonas fluorescens SBW25]
          Length = 210

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 121/212 (57%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R VLL+ G ++ 
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAERLRSEGIEVVLTREPGGTPLAERIREVLLAPGEEQM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + E ++  AAR  H+  VIRPAL  G +++CDRF DS+YAYQG         + +L+ 
Sbjct: 62  NPDTELLLVFAARAQHLAEVIRPALARGAVVICDRFTDSTYAYQGGGRGLSLARIATLET 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV++GL R   R        LD FE +     +  R  FL  A 
Sbjct: 122 FVQGDLRPDLTLVFDLPVEVGLARASAR------GRLDRFELEGQAFFDAVRTAFLTRAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            +P+R +++D+A     V   I  ++  L+++
Sbjct: 176 AEPERYYLLDAAQPLAHVQQAIDALLPTLLER 207


>gi|221632235|ref|YP_002521456.1| thymidylate kinase [Thermomicrobium roseum DSM 5159]
 gi|254808313|sp|B9KXL4|KTHY_THERP RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|221155655|gb|ACM04782.1| thymidylate kinase [Thermomicrobium roseum DSM 5159]
          Length = 210

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 125/214 (58%), Gaps = 8/214 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EGAGKTT  +LL   L+   Y + VTREPGGTP  E  R  LL+   +    E
Sbjct: 4   FITFEGPEGAGKTTQCALLAARLREAGYSLLVTREPGGTPLGETIREWLLAG--EALRPE 61

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++F AAR +HV + IRPAL  G I+LCDR++DS+ AYQG        +L  L  I+ 
Sbjct: 62  TEALLFTAARAEHVWDRIRPALERGTIVLCDRYVDSTLAYQGAGRGLDEGWLRELHRIAT 121

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
            ++ PD TI+LD+PV++GL R +       +A +   +++++  H + R  +   A+  P
Sbjct: 122 GDLWPDLTILLDVPVEVGLARRRA-----AAATITRLDQEELAFHRRVRAWYHAAAQRDP 176

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK-RVSP 218
            R  +VD+    + VA  +   V E++++ R SP
Sbjct: 177 QRWRVVDATLPPEVVADAVWATVTEVMKRGRRSP 210


>gi|291296874|ref|YP_003508272.1| thymidylate kinase [Meiothermus ruber DSM 1279]
 gi|290471833|gb|ADD29252.1| thymidylate kinase [Meiothermus ruber DSM 1279]
          Length = 205

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 124/202 (61%), Gaps = 11/202 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLFI+FEG EGAGK+T   LL  +L+ K  +V +TREPGGT   +A R +LL    D  
Sbjct: 2   KGLFITFEGPEGAGKSTQARLLAEWLRAKGREVVLTREPGGTRLGQAIRGLLLH--QDPM 59

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AEAE ++++A R +H++ VI+PAL  G I+LCDR+LDSS AYQG        +L ++ +
Sbjct: 60  CAEAEYLLYSADRAEHMQRVIQPALGLGHIVLCDRWLDSSLAYQGYGRGLDLGWLRAVAQ 119

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            + Q + P  T + DLP ++GL+R + R         D  ER+ +  H + RQ +L++A+
Sbjct: 120 GATQGIRPHKTFLFDLPPEVGLERFEGR---------DRLEREPLEFHRRVRQGYLELAQ 170

Query: 183 NQPDRCHIVDSAHSFQSVATNI 204
            +P+R  ++D+    +++ T +
Sbjct: 171 AEPERFVLLDATQPLEALHTQL 192


>gi|46203463|ref|ZP_00208978.1| COG0125: Thymidylate kinase [Magnetospirillum magnetotacticum MS-1]
          Length = 212

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 115/205 (56%), Gaps = 5/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T + LL   L+ +   V  TREPGG+  AEA R +L+      + 
Sbjct: 6   GRFITFEGGEGAGKSTQVRLLADSLRDEGLMVVTTREPGGSTGAEAIRALLVEGDTARWD 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA++  AAR DH+   + PAL  G  ++CDRF DS+ AYQG         + SL  +
Sbjct: 66  GVTEALLHFAARRDHLLKTVWPALERGAWVICDRFADSTLAYQGFGHGLDPDVIASLYRV 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V    PD T++LDLPV+ GL+R   R         D +ER  +  H++ RQ FL IA +
Sbjct: 126 AVGHFAPDLTLVLDLPVETGLERAGAR-----GGAEDRYERMGLGFHQRLRQGFLGIAAS 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P RC ++D+  S   V  +I++ V
Sbjct: 181 NPMRCAVIDATRSPDEVHGDIMSTV 205


>gi|90021281|ref|YP_527108.1| thymidylate kinase [Saccharophagus degradans 2-40]
 gi|89950881|gb|ABD80896.1| thymidylate kinase [Saccharophagus degradans 2-40]
          Length = 208

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 125/212 (58%), Gaps = 6/212 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +++G FI+ EG EG GK+T+I L+K  LQ+   ++ VTREPGGTP AE  R+VLL+   +
Sbjct: 2   ISTGKFITVEGTEGVGKSTNIELIKTLLQQAGIELVVTREPGGTPLAEELRNVLLANRDE 61

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            F   AE +V  AAR  H+  VI+PAL  GK +L DRF D+++AYQG+        +  L
Sbjct: 62  NFDPLAELLVVFAARAQHINQVIKPALAAGKWVLSDRFTDATFAYQGKGRGLPIQAILQL 121

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +++  Q + PD T +LD+ V +GL+R       RE   LD FE + +   EK R  + + 
Sbjct: 122 EQMVQQGLQPDATFLLDIDVQVGLERA------RERGELDRFENEHITFFEKVRAGYHER 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
               P+R  ++++  S ++V  ++   V +L+
Sbjct: 176 VAATPERFMVINAGQSLEAVQQDVTLAVEKLL 207


>gi|254417944|ref|ZP_05031668.1| thymidylate kinase [Brevundimonas sp. BAL3]
 gi|196184121|gb|EDX79097.1| thymidylate kinase [Brevundimonas sp. BAL3]
          Length = 210

 Score =  147 bits (372), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 121/218 (55%), Gaps = 11/218 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSCG 58
           M  G FISFEG EG+GK+T +  L   LQ       V  TREPGG+  AE  R+++++  
Sbjct: 1   MTRGKFISFEGGEGSGKSTQVGRLVERLQPVLGERTVVRTREPGGSKGAEVIRNLVVATE 60

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
            + + A  E ++  A+R DH+E  IRPAL  G  ++CDRF DSS AYQG        F++
Sbjct: 61  AEPWSAMTETLLMYASRSDHLERTIRPALAAGDWVVCDRFADSSRAYQGAGGGVAQSFIE 120

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            +    V +  PD T++ DLPV++GL+R   R  L E+     FE K +  H++ R+ FL
Sbjct: 121 QIDAGVVGDDQPDLTLVFDLPVEVGLERAFGR-GLFET----RFESKGLAFHKRLREGFL 175

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            I    P+RC ++D+  S   V       VW+ VQ R+
Sbjct: 176 RIVEAHPERCVLIDAVGSLDEVEAR----VWQAVQDRL 209


>gi|258513464|ref|YP_003189686.1| thymidylate kinase [Desulfotomaculum acetoxidans DSM 771]
 gi|257777169|gb|ACV61063.1| thymidylate kinase [Desulfotomaculum acetoxidans DSM 771]
          Length = 233

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 115/187 (61%), Gaps = 11/187 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLL-KRFLQR---KNYD-----VHVTREPGGTPAAEAARHVL 54
           G+FI FEGI+G+GKTT I++L K  LQ    KN       V +TREPGGT  +E  R++L
Sbjct: 3   GVFIVFEGIDGSGKTTQINILYKNLLQHNRIKNQPAGSEYVLLTREPGGTATSELIRNIL 62

Query: 55  LSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQH 114
           L+   D+  A  EA+++AAAR  HVE  IRPAL  GKI++CDRF+DSS AYQG       
Sbjct: 63  LNPANDKLCARTEALLYAAARAQHVEERIRPALSSGKIVICDRFIDSSLAYQGYGRGQDL 122

Query: 115 LFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRR 174
            FL +L +++   + PD TI+LDLPV   LKR+ NR         D  E + V  +E+ R
Sbjct: 123 SFLHNLNQLAAGGLKPDLTILLDLPVGAALKRLNNRQV--SGIEKDRLESEAVSFYERVR 180

Query: 175 QIFLDIA 181
           + +L IA
Sbjct: 181 EGYLKIA 187


>gi|254434496|ref|ZP_05048004.1| thymidylate kinase [Nitrosococcus oceani AFC27]
 gi|207090829|gb|EDZ68100.1| thymidylate kinase [Nitrosococcus oceani AFC27]
          Length = 213

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 122/214 (57%), Gaps = 5/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI  EGIEGAGK+T +  +++ LQ    +V VTREPGGT   E  R +LLS  ++
Sbjct: 1   MGRGRFIVLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E ++  AAR++HV+ VI PAL  GK +LCDRF  +SYAYQG         +  L
Sbjct: 61  GMSADTELLLMFAARVEHVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +  ++  + PD  ++ D+PV +GL+R   R        LD FE++ +   ++ R I+L +
Sbjct: 121 ESWALNCLRPDLILLFDVPVRLGLQRATTR-----CQQLDRFEQEKIDFFDRARTIYLSL 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A+  PD+  ++DS+     V   I  ++   +++
Sbjct: 176 AKKYPDQYRLIDSSLPLTRVQEAIQKVIMAFLEE 209


>gi|85859637|ref|YP_461839.1| thymidylate kinase [Syntrophus aciditrophicus SB]
 gi|123516788|sp|Q2LUB1|KTHY_SYNAS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|85722728|gb|ABC77671.1| thymidylate kinase [Syntrophus aciditrophicus SB]
          Length = 219

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 116/196 (59%), Gaps = 1/196 (0%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FISFEGIEG GKTT + L  ++L+     V  T EPGGTP  +  R++LL+ G  E  AE
Sbjct: 4   FISFEGIEGCGKTTQLKLAAQYLRTLKIPVGTTEEPGGTPLGKKIRNILLNRGPFEICAE 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++F AAR  HV  VI P+L  G+ +LCDRF D++  YQG        ++  L   + 
Sbjct: 64  AETLLFVAARAQHVREVILPSLARGQWILCDRFSDATAVYQGCVRGIDEAWIRQLDSFAT 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYS-LRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
             + P+ T++ DLP + GL R   R + + E++  D FE++ +  HEK R+ +L +AR +
Sbjct: 124 SFLKPNLTLLFDLPAETGLHRAMQRMTGIPENSREDRFEQEGLNFHEKIREGYLALARQE 183

Query: 185 PDRCHIVDSAHSFQSV 200
            +R  I+++A    S+
Sbjct: 184 SERFRIINAAADIPSI 199


>gi|118580087|ref|YP_901337.1| dTMP kinase [Pelobacter propionicus DSM 2379]
 gi|166223097|sp|A1APK9|KTHY_PELPD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|118502797|gb|ABK99279.1| thymidylate kinase [Pelobacter propionicus DSM 2379]
          Length = 219

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 122/217 (56%), Gaps = 3/217 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG+GKTT I LL   L+   Y V +TREPGG   ++  R +LL        
Sbjct: 2   GYFITFEGIEGSGKTTQIGLLGEQLESLGYSVVMTREPGGCAISDKIRSILLDADNSSIS 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++AAAR  HV  VI PAL +G I+LCDRF D++ AYQG         +D+L ++
Sbjct: 62  PMTELLLYAAARAQHVSEVIIPALKQGNIVLCDRFSDATLAYQGSGRGIAREKVDTLNQL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + Q + PD T+++D  V +GL+R + R         + FE + +  H   R+ +L++A  
Sbjct: 122 ACQSLRPDLTVLIDCDVSVGLERARRRIETASGPREERFELEALEFHRSVREAYLELAHA 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLS 220
           +P R   VD +   + ++     IV +++Q R++  S
Sbjct: 182 EPQRFITVDGSGGVEEISE---AIVAQVLQNRLNNTS 215


>gi|307826061|ref|ZP_07656274.1| thymidylate kinase [Methylobacter tundripaludum SV96]
 gi|307732900|gb|EFO03764.1| thymidylate kinase [Methylobacter tundripaludum SV96]
          Length = 223

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 122/212 (57%), Gaps = 6/212 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG GKTT+++ +K +L++ N  V VTREPGGT  AE  R +LL    +
Sbjct: 1   MIRGKFITLEGCEGVGKTTNMAFIKDYLEQHNISVVVTREPGGTKLAEKIRQLLLDNKSE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               +AE ++  AAR  H+++VI PAL +GK +LCDRF D++YAYQG   + +   +  L
Sbjct: 61  TISEQAELLMMFAARAQHIKHVIEPALAQGKWVLCDRFTDATYAYQGGGRNMKISTIKWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +    + PD T++LD P++IG+ RV      RE   LD FE + +   E  R+ +L  
Sbjct: 121 ENLVQGTLRPDLTLLLDAPIEIGIARV------RERGALDRFELEKISFFENVRRAYLLQ 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A   P+R  ++ +      V   I +++  L+
Sbjct: 175 AELYPERIKLIKANQPLIDVQRAITDVIRTLL 206


>gi|229823580|ref|ZP_04449649.1| hypothetical protein GCWU000282_00878 [Catonella morbi ATCC 51271]
 gi|229787024|gb|EEP23138.1| hypothetical protein GCWU000282_00878 [Catonella morbi ATCC 51271]
          Length = 210

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 123/209 (58%), Gaps = 5/209 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG +GAGK++ I+ L  +L+ + + V  TREPGG P AE  R V+L     
Sbjct: 1   MFPGKFITLEGPDGAGKSSVIAELTAYLEGQGHQVLTTREPGGVPIAEEIRRVILDVDHI 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDS 119
                 EA++FAAAR  H+  VI PAL +GKI+LCDRF+DSS AYQG  RD    L   S
Sbjct: 61  AMDPRTEALLFAAARRQHLVEVILPALRQGKIVLCDRFVDSSLAYQGMARDIPVDLIW-S 119

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + +V++ +P  T+++D+P ++GL R+      R+    D  +++ +  H + RQ FLD
Sbjct: 120 INQFAVEDQLPALTLLIDVPAEVGLARIHQARGQRQ---YDRLDQESLDFHNRVRQAFLD 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +A+  P+R  ++D       V    ++++
Sbjct: 177 LAQASPERIKVIDGQAPLDQVVAACIDVL 205


>gi|99078562|ref|YP_611820.1| thymidylate kinase [Ruegeria sp. TM1040]
 gi|99035700|gb|ABF62558.1| thymidylate kinase [Ruegeria sp. TM1040]
          Length = 214

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 120/215 (55%), Gaps = 6/215 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            SGLF++FEGI+G+GK++   LL   L+    +V +TREPGG+  AE  R ++L    D 
Sbjct: 6   GSGLFLTFEGIDGSGKSSQCRLLAEHLRGLGREVVLTREPGGSEGAEEIRRLVLEGDPDR 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L 
Sbjct: 66  WSAETEILLFTAARRDHLERTILPALSAGKVVICDRFADSTRMYQGLSRGDLRATVDELH 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD TI++D+  + GL R + R    E      FE   + + EK R  FL +A
Sbjct: 126 ALMIGR-EPDVTILIDMDPETGLARAKGRQGTEE-----RFEDFGLALQEKMRAGFLALA 179

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
               DR  IVD A    +VA ++  IV   +++RV
Sbjct: 180 DEFADRFRIVDGARDMDAVAADVARIVEAELEQRV 214


>gi|331012636|gb|EGH92692.1| thymidylate kinase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 210

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 120/213 (56%), Gaps = 6/213 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF + EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFFTLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG         +  L+E
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
             P R  +VD+A     V  ++  ++ +L++ R
Sbjct: 176 ADPARYRLVDAAQPLADVQASLDTLLPQLLELR 208


>gi|182415140|ref|YP_001820206.1| dTMP kinase [Opitutus terrae PB90-1]
 gi|177842354|gb|ACB76606.1| dTMP kinase [Opitutus terrae PB90-1]
          Length = 216

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 13/213 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL--SCGVD 60
           +G  ISFEG EG+GK+T +S+L   LQ+   DV  TREPGGT   E  R++++  S G D
Sbjct: 9   TGKLISFEGSEGSGKSTQMSMLAARLQKDGRDVVTTREPGGTEIGEQVRNIIVHNSRG-D 67

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E  AE E ++FAAAR   V  VI PA+ +G I+L DR+LDSS  YQG     ++L  D +
Sbjct: 68  EMCAETELLLFAAARAQLVREVIAPAMQKGSIVLSDRYLDSSTVYQG---IGRNLAADPV 124

Query: 121 QEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            +I   +V  VMPD TI++D+P ++GL R++     R S   D  ER+++  ++K R  +
Sbjct: 125 AQINRFAVGNVMPDLTIVIDVPAEVGLARIRQ----RASDLPDRMERENIDFYKKVRDGY 180

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           L +A+   DR  ++D   +   V+  I   V E
Sbjct: 181 LVLAKGMADRFVVIDGTQTQDVVSKKIFAAVKE 213


>gi|70729185|ref|YP_258921.1| thymidylate kinase [Pseudomonas fluorescens Pf-5]
 gi|123656957|sp|Q4KFR2|KTHY_PSEF5 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|68343484|gb|AAY91090.1| thymidylate kinase [Pseudomonas fluorescens Pf-5]
          Length = 210

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 123/212 (58%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+    +V +TREPGGTP AE  R VLL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAERLRAAGIEVLLTREPGGTPLAERIRDVLLTPVEEVM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G ++LCDRF DS+YAYQG         + +L++
Sbjct: 62  NADTELLLVFAARAQHLATVIRPALERGAVVLCDRFTDSTYAYQGAGRGLSLARIAALED 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               E+ PD T++ DLPVD+GL R   R        LD FE++     +K R+ FL  A 
Sbjct: 122 FVQGELRPDLTLVFDLPVDVGLARASAR------GRLDRFEQEGQAFFQKVREAFLARAA 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P R  +VD+A     V  ++ +++ +L+++
Sbjct: 176 AAPQRYVLVDAAQPLAQVQQSLDSLLPQLLER 207


>gi|146306664|ref|YP_001187129.1| thymidylate kinase [Pseudomonas mendocina ymp]
 gi|166223105|sp|A4XST1|KTHY_PSEMY RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|145574865|gb|ABP84397.1| thymidylate kinase [Pseudomonas mendocina ymp]
          Length = 210

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 119/211 (56%), Gaps = 6/211 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +  DV +TREPGGTP AE  R +LL    +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAERLREQGVDVVLTREPGGTPLAERIRELLLDPSDEPM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H++ VIRPAL +G ++LCDRF D++YAYQG         +  L++
Sbjct: 62  AADTELLLVFAARAQHLQQVIRPALAKGCVVLCDRFTDATYAYQGGGRGLSIERIAQLEQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               E+ PD T+I DLPV++GL R   R        LD FE++     E  RQ +L  A 
Sbjct: 122 FVQGELRPDLTLIFDLPVEVGLARAAAR------GRLDRFEQEGRGFFEAVRQAYLQRAV 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
             P    ++D+  +   V  +I  ++  L++
Sbjct: 176 QAPQHYRVLDAGQTLAQVQADIDALLPSLLE 206


>gi|302390839|ref|YP_003826659.1| thymidylate kinase [Acetohalobium arabaticum DSM 5501]
 gi|302202916|gb|ADL11594.1| thymidylate kinase [Acetohalobium arabaticum DSM 5501]
          Length = 210

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 124/211 (58%), Gaps = 10/211 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+ EG EGAGK+T I LL ++   + Y+V  TREPGGT      R++LL   +D   
Sbjct: 3   GLFITLEGPEGAGKSTQIELLNKYFSEQGYEVVQTREPGGTEIGSRIRNILLDSNLDNLE 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQE 122
            + E +++AA+R  HV  VI+PAL EGK+++CDRF D++ AYQG  R   + L L  L +
Sbjct: 63  PKTELLLYAASRAQHVNEVIKPALKEGKVIICDRFSDATLAYQGYGRRLDKDLIL-KLNQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           ++   + PD T +LD+  + GL R +N          D  ER+D+  H++ R  +L +A 
Sbjct: 122 MATGGLEPDLTFLLDIEPEEGLLRTKNE-------VRDRIEREDLSFHQQVRDGYLKLAE 174

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +  R  ++D + S +++  N++  + E ++
Sbjct: 175 KKS-RFEVIDGSQSIENIFDNLIETLEERLE 204


>gi|297572230|ref|YP_003698004.1| thymidylate kinase [Arcanobacterium haemolyticum DSM 20595]
 gi|296932577|gb|ADH93385.1| thymidylate kinase [Arcanobacterium haemolyticum DSM 20595]
          Length = 219

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 121/214 (56%), Gaps = 10/214 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FISFEG +GAGK+T +  L  +L+   Y V VTREPGGT      RH+LL  G  +  
Sbjct: 2   GMFISFEGGDGAGKSTQVEKLATWLREAGYGVVVTREPGGTELGAHIRHLLLHGG--DVS 59

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA+++AA R  H++  IRPAL  G+I++ DRF+DSS AYQG   S     +  L   
Sbjct: 60  PRAEALLYAADRAHHMDTKIRPALERGEIVITDRFMDSSIAYQGAARSLGKNEIRDLSLW 119

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V+  MPD T +LD+PV+ G  RV +     E+A  ++        H + R  FL +A +
Sbjct: 120 AVEGTMPDVTFLLDIPVETGQARVGSEQDRLEAAGAEF--------HARVRNEFLALAED 171

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
             DR  ++D   +  S+A +I + V E + K  S
Sbjct: 172 HMDRWRVLDGTQTIDSIAQSIRHHVAEALAKNDS 205


>gi|117929178|ref|YP_873729.1| thymidylate kinase [Acidothermus cellulolyticus 11B]
 gi|117649641|gb|ABK53743.1| thymidylate kinase [Acidothermus cellulolyticus 11B]
          Length = 688

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 83/218 (38%), Positives = 120/218 (55%), Gaps = 15/218 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G F++FEG EGAGK+T + LL R+L  + Y+V V+REPGGTP     R +LL       
Sbjct: 464 TGFFVAFEGGEGAGKSTQVELLARYLADRGYEVVVSREPGGTPLGHRLREILLDPREPAP 523

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQ 121
              AEA+++AA R +HV  VIRPAL  G I++ DR++DSS AYQ G RD S    ++ L 
Sbjct: 524 SPRAEALLYAADRAEHVAKVIRPALARGAIVISDRYVDSSLAYQGGGRDLSPR-DVEQLS 582

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +   + PD T++LD+P D GL R       R     D  + +D   HE+ R +F   A
Sbjct: 583 RFATSGLRPDLTVLLDVPPDEGLARTG-----RRDRAPDRLQAEDAAFHERVRNVFRQRA 637

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
              P+R  ++D+  S   +          LV +R+ P+
Sbjct: 638 EADPERYLVIDARLSAADIH--------RLVVQRILPV 667


>gi|254464514|ref|ZP_05077925.1| thymidylate kinase [Rhodobacterales bacterium Y4I]
 gi|206685422|gb|EDZ45904.1| thymidylate kinase [Rhodobacterales bacterium Y4I]
          Length = 215

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 117/212 (55%), Gaps = 6/212 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLFI+FEGI+G+GK+T   LL   L+    DV +TREPGG+P AE  R ++L    D 
Sbjct: 6   TRGLFITFEGIDGSGKSTQCRLLAEALRAAGRDVVLTREPGGSPGAEEIRRLVLEGDPDR 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D + 
Sbjct: 66  WSAETELLLFMAARRDHLERTIEPALAAGKVVICDRFADSTRMYQGLSRGDLRAAVDQMH 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD T+++D+    GL R + R    E      FE   V + EK R  FL +A
Sbjct: 126 RLMIGR-EPDLTLLIDMDPAEGLARAKGRQGKEE-----RFEDFGVELQEKMRAGFLALA 179

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +   DR  +VD A   + VA ++  +  + ++
Sbjct: 180 QEFADRFRVVDGARPVEEVAADVRRLAEDALE 211


>gi|291614001|ref|YP_003524158.1| thymidylate kinase [Sideroxydans lithotrophicus ES-1]
 gi|291584113|gb|ADE11771.1| thymidylate kinase [Sideroxydans lithotrophicus ES-1]
          Length = 202

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 121/208 (58%), Gaps = 9/208 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M++  FI+FEG++GAGK+TH+      L+++  D+ VTREPGGT   E  R +LL+  + 
Sbjct: 1   MSTAKFITFEGVDGAGKSTHLDWFANVLRQRGIDLLVTREPGGTQLGERLREILLNQPMH 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              AE EA++  AAR +HVE VIRPAL  G  ++ DRF D+S+AYQG         L+ L
Sbjct: 61  ---AETEALLMFAARREHVEQVIRPALQRGTWVISDRFSDASFAYQGGGRGVPVAKLEQL 117

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++    ++ PD T++ D+P++I  +R+ N      +A LD FE++     E+ RQ +L  
Sbjct: 118 EQWVHGDIQPDLTLLFDIPIEIARQRLSN------NASLDRFEQEQGEFFERVRQAYLSR 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P R  ++ +  S   V  ++  IV
Sbjct: 172 AAKTPHRFAVIHAEKSMDEVKQDLAKIV 199


>gi|94986082|ref|YP_605446.1| thymidylate kinase [Deinococcus geothermalis DSM 11300]
 gi|94556363|gb|ABF46277.1| Thymidylate kinase [Deinococcus geothermalis DSM 11300]
          Length = 210

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 119/218 (54%), Gaps = 15/218 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL--SCG 58
           M  GLF++FEG EGAGK+T ++ L + L         TREPGGTP     R VLL  +  
Sbjct: 1   MRPGLFVTFEGPEGAGKSTQLARLAQRLAETGRPPVTTREPGGTPLGMRVREVLLDPALT 60

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
           +D      E ++++A+R   V +VIRPAL  G+++LCDR+ DSS AYQG        FL 
Sbjct: 61  IDPL---PEFLLYSASRAQLVRDVIRPALAAGQVVLCDRYADSSLAYQGSGRGLDPAFLA 117

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +L       + PD TI+LDL   +GL R  +R         D  ER D+  H + R  FL
Sbjct: 118 ALTGEVTGGLQPDLTILLDLDPALGLARAASR------GQPDRLERADLTFHRRVRHGFL 171

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           D+A   P+R  ++D+A    S+A +I    W  VQ+R+
Sbjct: 172 DLAAQAPERFLVLDAARDPDSLAADI----WRAVQERL 205


>gi|323701668|ref|ZP_08113340.1| thymidylate kinase [Desulfotomaculum nigrificans DSM 574]
 gi|323533441|gb|EGB23308.1| thymidylate kinase [Desulfotomaculum nigrificans DSM 574]
          Length = 215

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 6/209 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI FEG++G+GKTT +SLL ++L   +   + TREPGGTP  E  R +LL+    +  
Sbjct: 11  GIFIVFEGVDGSGKTTQLSLLNKYLCANHIATYATREPGGTPLGEKIRELLLNPDFIDMQ 70

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           +  EA+++AAAR   V   IRP L +G ++LCDR++DSS AYQG        FL  + ++
Sbjct: 71  SRTEALLYAAARAQLVAQEIRPRLQQGTVVLCDRYIDSSLAYQGYGRGMDIDFLIKINQL 130

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               + P   I+LDLP + GL R       R+    D  E + +  H + R  +L++AR 
Sbjct: 131 GTGGLNPQLVILLDLPPEEGLIRS------RKVGPADRLENEALDFHRRVRAGYLELARK 184

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            PDR  ++D+  S Q++   I  +V  +V
Sbjct: 185 NPDRYLVLDARESIQTLHQEICRVVGGMV 213


>gi|312962561|ref|ZP_07777051.1| Thymidylate kinase [Pseudomonas fluorescens WH6]
 gi|311283141|gb|EFQ61732.1| Thymidylate kinase [Pseudomonas fluorescens WH6]
          Length = 210

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 121/212 (57%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +  +V +TREPGGTP AE  R VLL+ G ++ 
Sbjct: 2   TGLFITLEGPEGAGKSTNRDYLAERLRSEGIEVVLTREPGGTPLAERIREVLLAPGEEQM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + E ++  AAR  H+  VIRPAL  G +++CDRF DS+YAYQG         + +L+ 
Sbjct: 62  NPDTELLLVFAARAQHLSEVIRPALARGAVVICDRFTDSTYAYQGGGRGLCLARIATLES 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV++G+ R   R        LD FE +     +  R  FL  A+
Sbjct: 122 FVQGDLRPDLTLLFDLPVEVGMARASAR------GRLDRFELEGQAFFDLVRSAFLARAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            +P R H++D++     V   I  ++  L+++
Sbjct: 176 AEPARYHLLDASQPLAQVQQAIDALLPLLLER 207


>gi|297616259|ref|YP_003701418.1| thymidylate kinase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144096|gb|ADI00853.1| thymidylate kinase [Syntrophothermus lipocalidus DSM 12680]
          Length = 223

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (56%), Gaps = 7/214 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+   FISFEGI+GAGKTT + LL R L    + V   REPG TP +E  R +LL     
Sbjct: 1   MHRKCFISFEGIDGAGKTTQVELLYRKLMDVGFSVVAVREPGSTPLSEKIRELLLDVRNQ 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +  + AE+ ++AAAR   V  +I+PAL  GK+++ DR++DS+ AYQG        FL  L
Sbjct: 61  DISSSAESFLYAAARSQLVAEIIKPALDAGKVVIADRYVDSTIAYQGYGRGMDIEFLKRL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             ++   +MP  TI+LDLP + G+ R       R    LD  ER+ +  H   R+ +L +
Sbjct: 121 NLLATGGLMPCLTILLDLPPEEGIAR-------RGELPLDRLEREGIGFHRAVREGYLTL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +R++PDR  +VD+    + V   IL  V E +++
Sbjct: 174 SRSEPDRIMVVDARLQVEDVHEQILKRVLERLRR 207


>gi|260426355|ref|ZP_05780334.1| thymidylate kinase [Citreicella sp. SE45]
 gi|260420847|gb|EEX14098.1| thymidylate kinase [Citreicella sp. SE45]
          Length = 208

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/203 (39%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLFISFEGI+G+GK+T   LL   L+   ++V +TREPGG+P AE  R ++L    D 
Sbjct: 4   GTGLFISFEGIDGSGKSTQARLLAEQLRGDGHEVVLTREPGGSPGAEEIRALVLQGDPDR 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  I+PAL  G  ++CDRF DS+  YQG         +D+L 
Sbjct: 64  WSAETELLLFTAARRDHLERTIQPALARGATVICDRFADSTRMYQGLSRGDLRAAVDALH 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E  +  V PD TI++D+     L R + R +  E      FE   + + EK R  FL +A
Sbjct: 124 ERMIG-VEPDLTILIDMDPAAALPRAKARATAEE-----RFEDFGLPLQEKMRAGFLALA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
              PDR  I+D   + ++VA ++
Sbjct: 178 AEFPDRFRIIDGNRAPEAVARDV 200


>gi|56551986|ref|YP_162825.1| dTMP kinase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543560|gb|AAV89714.1| dTMP kinase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 216

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 116/201 (57%), Gaps = 5/201 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           +  G FIS EG EG GK+T I LL   L+ K    V  TREPGG    +A RH+LL   +
Sbjct: 7   VTHGYFISLEGGEGVGKSTQIRLLAAALEEKLQKSVIATREPGGCSGGDAIRHLLLEGDL 66

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
             +    EA++FAAAR +HV  VI+PAL EGK ++CDRF+DSS AYQG+        +  
Sbjct: 67  HRWTNATEALLFAAARAEHVARVIKPALKEGKWVVCDRFIDSSLAYQGDTGGLTQGDIRC 126

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L  I  Q ++PD T +L LP   G++R Q     R+    + FE++ +  H+K    FL 
Sbjct: 127 LHRIGSQGILPDRTFLLTLPEGEGIRRAQE----RDKNKGNRFEQRTIDYHKKVNDSFLQ 182

Query: 180 IARNQPDRCHIVDSAHSFQSV 200
           +A  +P+R  ++D++ + + V
Sbjct: 183 LAAKEPERFRVIDASGNPEEV 203


>gi|83311549|ref|YP_421813.1| thymidylate kinase [Magnetospirillum magneticum AMB-1]
 gi|82946390|dbj|BAE51254.1| Thymidylate kinase [Magnetospirillum magneticum AMB-1]
          Length = 212

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 115/205 (56%), Gaps = 5/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T + LL   L+ +   V  TREPGG+  AEA R +L+    + + 
Sbjct: 6   GRFITFEGGEGAGKSTQVRLLAESLRDEGLMVVTTREPGGSAGAEAIRALLVEGEPERWD 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA++  AAR DH+   + PAL  G  ++CDRF DS+ AYQG         + SL  +
Sbjct: 66  GVTEALLHFAARRDHLVKTVWPALDRGAWVICDRFADSTLAYQGFGHGLDPDVIASLYRV 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V    PD T++LDLPV+ GL+R   R         D +ER  +  H++ RQ FL IA  
Sbjct: 126 AVGHFAPDLTLVLDLPVEKGLERAGLR-----GGAEDRYERMGLGFHQRLRQGFLGIAAA 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P RC ++D+  S   V  +I++ V
Sbjct: 181 NPMRCAVIDATRSPDEVHGDIMSTV 205


>gi|212703732|ref|ZP_03311860.1| hypothetical protein DESPIG_01780 [Desulfovibrio piger ATCC 29098]
 gi|212672884|gb|EEB33367.1| hypothetical protein DESPIG_01780 [Desulfovibrio piger ATCC 29098]
          Length = 217

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 123/217 (56%), Gaps = 3/217 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG+GKTT   LL   L+++ +DV +TREPGG     A R +LL         
Sbjct: 1   MFITFEGIEGSGKTTAQQLLALELEKRGHDVLLTREPGGCGLGRALRPILLDARNAGLCN 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE  +F A R  HV  ++RPAL  G+I++CDR+ DS+ AYQG         L    +++
Sbjct: 61  RAELYLFLADRAQHVAEIVRPALEAGQIVICDRYTDSTLAYQGYGRGRDPDRLRRANDLA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLDIAR 182
              + PD T++ DLPV +GL+R   R + RE   L    F+ + +  HE+ RQ +L IA 
Sbjct: 121 TGGLQPDLTLLCDLPVSVGLERAGLR-NRREGTVLSEGRFDSESLNFHERVRQGYLTIAE 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
            +PDR  I+D++   + V    L+ V   +++R S L
Sbjct: 180 EEPDRIAIIDASQQPEDVVLQCLSAVERHLKRRGSGL 216


>gi|114799318|ref|YP_760517.1| thymidylate kinase [Hyphomonas neptunium ATCC 15444]
 gi|114739492|gb|ABI77617.1| thymidylate kinase [Hyphomonas neptunium ATCC 15444]
          Length = 219

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 117/211 (55%), Gaps = 10/211 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE- 61
           +G FI+ EG EG GK+T    L R L+     V VTREPGGTP AEAAR +LL     E 
Sbjct: 6   AGHFITLEGGEGTGKSTLAKALARKLEAHGIGVVVTREPGGTPLAEAARQLLLHPPEGEA 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +   +EA++  AAR DH+E +IRPAL  G  ++CDRF DS+  YQ          L S++
Sbjct: 66  WSPLSEALLVNAARRDHLEKLIRPALARGDWVICDRFADSTRVYQSIEGGVDVSALLSIE 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
              + + +P  T+ILD+ +D+  KR   R     +  LD FER+    HE  R  F DIA
Sbjct: 126 REVLGDTVPSMTLILDVSLDVASKRRTAR-----AGALDTFERRPKAFHEAVRAAFQDIA 180

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           R++P RC ++D+          +L+  W+ V
Sbjct: 181 RSEPARCRLIDT----DVTPDQVLDAAWKQV 207


>gi|192362258|ref|YP_001982459.1| thymidylate kinase [Cellvibrio japonicus Ueda107]
 gi|190688423|gb|ACE86101.1| thymidylate kinase [Cellvibrio japonicus Ueda107]
          Length = 213

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 123/213 (57%), Gaps = 6/213 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M SG F++ EG EG GK+T+++ ++ +L+ +  ++ VTREPGGTP AE  R++LL+   +
Sbjct: 6   MQSGKFLTMEGTEGVGKSTNLAFVRAWLEARGIELIVTREPGGTPLAEEIRNLLLAKRTE 65

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AE ++  AAR  H+  VI+PAL  G  +L DRF D++YAYQG         ++ L
Sbjct: 66  PVDETAELLLVFAARAQHLAQVIKPALARGAWVLSDRFTDATYAYQGGGRGLSLAIIEQL 125

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +  Q++ PD T++LD+ V  GL+R   R      A LD FE + +   E+ R  +   
Sbjct: 126 ENLVQQQLRPDLTLVLDIDVQKGLERASQR------AELDRFESESLAFFERVRAAYHSR 179

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A   P+R  ++D+  S + V  +I   + +L+Q
Sbjct: 180 AAMAPERYTLIDAGQSLERVQQDIAARLEQLIQ 212


>gi|189425005|ref|YP_001952182.1| dTMP kinase [Geobacter lovleyi SZ]
 gi|254808293|sp|B3E2K5|KTHY_GEOLS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|189421264|gb|ACD95662.1| dTMP kinase [Geobacter lovleyi SZ]
          Length = 212

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 115/205 (56%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T I+LL   LQ+    V +TREPGG P A+  R VLL         
Sbjct: 1   MFITFEGIEGCGKSTQIALLAASLQQAGQRVLLTREPGGCPIADQIRSVLLDAANTALVP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE +++AA+R  H+  V+ PAL EG I+LCDRF D++ AYQ          +++L  ++
Sbjct: 61  MAELMLYAASRAQHLAEVVSPALAEGVIVLCDRFSDATRAYQSFGRGIDRQVIETLNSLA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + PD T++LD PV+ GL R + R         + FE + +  H++ R  +L +A  +
Sbjct: 121 CDGISPDLTVLLDCPVETGLGRARQRIDSTSGPREERFELESLAFHQRVRDGYLQLAAEE 180

Query: 185 PDRCHIVDSAHSFQSVATNILNIVW 209
           P R  IVD+      VA+ I + V 
Sbjct: 181 PGRFVIVDATVQPAQVASAISDAVL 205


>gi|329850687|ref|ZP_08265532.1| thymidylate kinase [Asticcacaulis biprosthecum C19]
 gi|328841002|gb|EGF90573.1| thymidylate kinase [Asticcacaulis biprosthecum C19]
          Length = 218

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 117/213 (54%), Gaps = 9/213 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           ++G FI FEG EGAGK+T +  L + L+    +V  TREPGG+P AE  R++L+      
Sbjct: 7   STGRFIVFEGGEGAGKSTQVQALVKRLRDFGLEVVQTREPGGSPGAEVLRNLLVQGDAGR 66

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +   +E ++  AAR DH+E VIRPAL  G  ++CDRF DSS AYQG        F++ + 
Sbjct: 67  WSPMSETLMMYAARSDHLETVIRPALERGAWVVCDRFADSSRAYQGAGGGVAPEFIEQID 126

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
              V +  PD  ++LD+PV+ GL R   R         + FE K +  HE+ RQ FL+ A
Sbjct: 127 AAVVGDTQPDLVLVLDMPVEAGLARASARGDKE-----NRFESKGLAFHERLRQGFLNRA 181

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
              P+R  + ++    +     + N +W ++ +
Sbjct: 182 AKVPERYRVFNADQPIEP----LFNDIWRVMAR 210


>gi|241761931|ref|ZP_04760016.1| dTMP kinase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373611|gb|EER63183.1| dTMP kinase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 216

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 116/201 (57%), Gaps = 5/201 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           +  G FIS EG EG GK+T I LL   L+ K    V  TREPGG    +A RH+LL   +
Sbjct: 7   VTHGYFISLEGGEGVGKSTQIRLLVAALEEKLQKSVIATREPGGCSGGDAIRHLLLEGDL 66

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
             +    EA++FAAAR +HV  VI+PAL EGK ++CDRF+DSS AYQG+        +  
Sbjct: 67  HRWTNATEALLFAAARAEHVARVIKPALKEGKWVVCDRFIDSSLAYQGDTGGLTQEDIRC 126

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L  I  Q ++PD T +L LP   G++R Q     R+    + FE++ +  H+K    FL 
Sbjct: 127 LHRIGSQGILPDRTFLLTLPEGEGIRRAQE----RDKNKGNRFEQRTIDYHKKVNDSFLQ 182

Query: 180 IARNQPDRCHIVDSAHSFQSV 200
           +A  +P+R  ++D++ + + V
Sbjct: 183 LAAKEPERFRVIDASGNPEEV 203


>gi|134297938|ref|YP_001111434.1| dTMP kinase [Desulfotomaculum reducens MI-1]
 gi|172044205|sp|A4J0K6|KTHY_DESRM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|134050638|gb|ABO48609.1| thymidylate kinase [Desulfotomaculum reducens MI-1]
          Length = 207

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 117/200 (58%), Gaps = 6/200 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI FEG++G+GK+T ++LL ++L +K      TREPGGTP  E  R +LL     E   
Sbjct: 4   IFIVFEGVDGSGKSTQLNLLNKYLSQKEIKTICTREPGGTPVGEKIRELLLDPNFAEIQD 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++++AAR   V  VIRP L +G ++LCDR++DS+ AYQG        FL  + E++
Sbjct: 64  RTEALLYSAARAQLVAQVIRPQLEQGTVVLCDRYIDSTLAYQGYGRGMDISFLAQINELA 123

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              +MP+ TI+LDLP + GL+R       R+    D  E + +  + K R  +L++A+ +
Sbjct: 124 SGGLMPNITILLDLPPEEGLQRS------RKDRPADRLENESLTFYHKVRSGYLEMAKRK 177

Query: 185 PDRCHIVDSAHSFQSVATNI 204
           PD   ++D+  + + +   I
Sbjct: 178 PDTYLVLDARQTMEQLHRQI 197


>gi|299536748|ref|ZP_07050058.1| thymidylate kinase [Lysinibacillus fusiformis ZC1]
 gi|298727862|gb|EFI68427.1| thymidylate kinase [Lysinibacillus fusiformis ZC1]
          Length = 209

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 124/213 (58%), Gaps = 4/213 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MNS LFI+FEG EGAGKTT I ++ + L  KN +V  TREPGG   AE  R ++L+    
Sbjct: 1   MNSNLFITFEGPEGAGKTTVIQMIAKRLTEKNIEVLATREPGGIEIAEKIRTIILNPAHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AAAR  H    +RPAL  GK+++CDRF+DSS AYQG         + S+
Sbjct: 61  AMDERTEALLYAAARSQHYFEKVRPALDAGKLVICDRFIDSSLAYQGYARGIGVNEVLSI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E ++ + +PD TI+ DL  ++GL R+    + RE   LD    + +  H+K R+ +L +
Sbjct: 121 NEFAIGKKLPDVTILFDLAPEVGLARIHATGN-REVNRLDV---ESLPFHQKVREGYLQL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
               P+R  +V++    ++V  ++  ++ E +Q
Sbjct: 177 VEQYPERIRVVNADQDIENVVEDVWLLLLEAMQ 209


>gi|254293993|ref|YP_003060016.1| thymidylate kinase [Hirschia baltica ATCC 49814]
 gi|254042524|gb|ACT59319.1| thymidylate kinase [Hirschia baltica ATCC 49814]
          Length = 211

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 126/218 (57%), Gaps = 10/218 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV- 59
           MN G F++ EG EG GK+T  S L++ L   +    +TREPGG+   EA R+++L+    
Sbjct: 1   MNLGRFVTLEGGEGVGKSTLASNLQKKLLELDIKCLLTREPGGSLGGEAIRNIVLNPPHH 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            ++    + ++F AAR DH+ENVI+PAL+ G+ ++CDRF DS+ AYQ          + +
Sbjct: 61  QDWSPLTQTLLFFAARCDHLENVIKPALLRGEWVICDRFTDSTRAYQAVAGGVDDHVVST 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L ++ V E  PD T++LD+P+++  KR      +  +   D FE+     HE  RQ FL+
Sbjct: 121 LDQLVVNEQQPDLTLLLDMPLEVSAKR-----RIERNGPQDAFEKLPQSFHENVRQAFLE 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           IA    DRC+++D+++S   V    L    EL+ KR S
Sbjct: 176 IADRYKDRCYVLDASNSVDQVTAEAL----ELICKRFS 209


>gi|330718537|ref|ZP_08313137.1| thymidylate kinase [Leuconostoc fallax KCTC 3537]
          Length = 217

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 126/220 (57%), Gaps = 13/220 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M+   FISFEG EGAGKT+ + +L+         D+  TREPGG P AEA R +L     
Sbjct: 1   MSEAKFISFEGPEGAGKTSVLQALIGELGPMLGDDLVTTREPGGNPIAEAIRAILQPEED 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD- 118
           +      EA+++AAAR  H+   I+PAL  GK+++ DR++DSS AYQG     + L +D 
Sbjct: 61  NGMDKRTEALLYAAARRQHLVETIQPALAAGKVVISDRYIDSSLAYQG---GGRDLGVDR 117

Query: 119 --SLQEISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQ 175
             +L + + + ++PD TI LD+P DIGLKRV Q+R        +D  +++D+  H K R 
Sbjct: 118 IWTLNQFATEGLLPDLTIYLDVPADIGLKRVMQHR-----QGKIDRLDKEDLSFHIKVRN 172

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +L +    PDR  ++D+    + V T    ++W+ ++ R
Sbjct: 173 TYLALRDQFPDRIQVIDATQPLEMVITATRALIWQQLKNR 212


>gi|86136161|ref|ZP_01054740.1| thymidylate kinase [Roseobacter sp. MED193]
 gi|85827035|gb|EAQ47231.1| thymidylate kinase [Roseobacter sp. MED193]
          Length = 218

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 113/204 (55%), Gaps = 6/204 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++FEGI+G+GK+T    L   L+   YDV +TREPGG+  AE  R ++L    D++
Sbjct: 6   TGLFLTFEGIDGSGKSTQCKRLAETLRLAGYDVVLTREPGGSEGAEEIRRMVLEGDPDKW 65

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L  
Sbjct: 66  SAETEILLFTAARRDHLERTILPALAAGKVVICDRFADSTRMYQGLSRGDLRTTVDQLHT 125

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +    PD T+++D+    GL R + R    E      FE   + + EK R  FL +A 
Sbjct: 126 LMIGR-EPDLTLLIDMDPATGLSRAKGRQGTEE-----RFEDFGLGLQEKMRAGFLSLAE 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILN 206
               R  +VD A    +VA ++L 
Sbjct: 180 EFSTRFRVVDGAQDIDTVAADVLR 203


>gi|297242601|ref|ZP_06926540.1| thymidylate kinase [Gardnerella vaginalis AMD]
 gi|296889410|gb|EFH28143.1| thymidylate kinase [Gardnerella vaginalis AMD]
          Length = 239

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 121/216 (56%), Gaps = 16/216 (7%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N GLFISFEGI+G GKTT +  LK +LQ    +V VTREPGGT   +  R +LL      
Sbjct: 33  NKGLFISFEGIDGVGKTTQVEALKDYLQSSGREVVVTREPGGTQLGKTLREILLHGT--S 90

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD--- 118
             A  EA++FAA R  HV  VIRPAL  G +++ DR++DSS AYQ      + L +D   
Sbjct: 91  VSARTEALLFAADRAQHVAQVIRPALNRGAVVITDRYIDSSLAYQA---GGRELTMDDVR 147

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +L E +   + P+ T +LD+  +   KR+       ESA +D+  R         R+ FL
Sbjct: 148 TLSEWATDSLWPNRTYLLDMQPEDAFKRLHREQDRMESAGIDFARRT--------REAFL 199

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           D+A+   DR  ++D+  S +S++  I+  V  L+++
Sbjct: 200 DLAQESADRYRVLDATFSAKSLSELIVQDVHNLIEE 235


>gi|330891466|gb|EGH24127.1| thymidylate kinase [Pseudomonas syringae pv. mori str. 301020]
          Length = 189

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 111/193 (57%), Gaps = 6/193 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   L+ +   V +TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPSDEAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ E ++  AAR  H+  VIRPAL  G+++LCDRF D++YAYQG         +  L+E
Sbjct: 62  SADTELLLVFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE++     +  R  +L  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLSRAAAR------GRLDRFEQEGRAFFDAVRSTYLQRAK 175

Query: 183 NQPDRCHIVDSAH 195
             P R  +VD+A 
Sbjct: 176 ADPARYRLVDAAQ 188


>gi|259415239|ref|ZP_05739161.1| thymidylate kinase [Silicibacter sp. TrichCH4B]
 gi|259349149|gb|EEW60903.1| thymidylate kinase [Silicibacter sp. TrichCH4B]
          Length = 214

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 117/214 (54%), Gaps = 6/214 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLF++FEGI+G+GK++   LL   L+    +V  TREPGG+  AE  R ++L    D 
Sbjct: 6   GPGLFLTFEGIDGSGKSSQCRLLADHLRGLGREVVQTREPGGSAGAEEIRSLVLEGDPDR 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +DSL 
Sbjct: 66  WSAETEILLFTAARRDHLERTILPALAAGKVVICDRFADSTRMYQGLSRGDLRATVDSLH 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++ +    PD TI++D+  + GL R + R    E      FE   + + EK R  FL +A
Sbjct: 126 KLMIGR-EPDVTILIDMDPETGLARAKGRQGTEER-----FEDFGLALQEKMRAGFLSLA 179

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
               DR  IVD A    +VA +I  I    + +R
Sbjct: 180 DEFADRFRIVDGAQDMNAVAADIARIAEAELDQR 213


>gi|163732222|ref|ZP_02139668.1| thymidylate kinase [Roseobacter litoralis Och 149]
 gi|161394520|gb|EDQ18843.1| thymidylate kinase [Roseobacter litoralis Och 149]
          Length = 212

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 120/207 (57%), Gaps = 6/207 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           ++GLFISFEGI+G+GK+T    L   L+ + ++V  TREPGG+P AE  R ++L    D 
Sbjct: 7   DNGLFISFEGIDGSGKSTQSKRLAEHLRVRGHEVVETREPGGSPGAEEIRALVLQGDPDR 66

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E +I PAL +GKI++CDRF DS+  YQG         +D+L 
Sbjct: 67  WSAETEILLFTAARRDHMERLILPALADGKIVICDRFADSTRMYQGLSRGDLRQVVDTLH 126

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++ +    PD T+++D+   IGL R  +R +  E      FE     +  K R  FL +A
Sbjct: 127 DLMIGR-EPDLTVLIDMDPAIGLSRALSRQTADE-----RFEAFGEDLQAKMRAGFLALA 180

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    R  +VD      SV  +++N+V
Sbjct: 181 QEFKARFRLVDGGRDADSVTQDVINVV 207


>gi|254455158|ref|ZP_05068593.1| thymidylate kinase [Octadecabacter antarcticus 238]
 gi|198263568|gb|EDY87840.1| thymidylate kinase [Octadecabacter antarcticus 238]
          Length = 215

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 112/201 (55%), Gaps = 10/201 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFISFEGI+G+GK+T   LLK  L     D  +TREPGG+  AE  R +LL+   D + 
Sbjct: 14  GLFISFEGIDGSGKSTQTKLLKDRLP----DAVLTREPGGSAGAEEIRALLLTGDPDRWS 69

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE E ++F AAR DH+E  IRPAL  GK ++CDRF DS+  YQG    +    +D+L ++
Sbjct: 70  AETEILLFTAARRDHLEKTIRPALAAGKTVICDRFADSTRVYQGATRGALRGAVDTLHDV 129

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +    PD T I+D+   + L R      L   +  D FE   +   E  R  FL +A+ 
Sbjct: 130 MIGR-EPDLTFIIDMDPAVALSR-----GLARGSGEDRFEDMGLAFQETLRHGFLALAKA 183

Query: 184 QPDRCHIVDSAHSFQSVATNI 204
            PDRC ++D      +VA  I
Sbjct: 184 NPDRCVLIDGNRDPVAVAAEI 204


>gi|307292799|ref|ZP_07572645.1| thymidylate kinase [Sphingobium chlorophenolicum L-1]
 gi|306880865|gb|EFN12081.1| thymidylate kinase [Sphingobium chlorophenolicum L-1]
          Length = 208

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 109/200 (54%), Gaps = 5/200 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FIS EG EGAGK+T I  L   L+++  +V  TREPGG+  AEA R +LL+ G D
Sbjct: 1   MTQGRFISLEGGEGAGKSTQIRALAAALRQRGLEVVETREPGGSEGAEAIRALLLTGGAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +   AEA++FAAAR DHVE  IRPAL  G  +L DRFLDSS AYQG  D S    L +L
Sbjct: 61  RWSPRAEALLFAAARADHVERTIRPALDRGAWVLSDRFLDSSRAYQGMGDLSDADIL-AL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             I     +PD T+ L LP      R ++    R+    D    +D   H+   + F   
Sbjct: 120 HRIGSGGFLPDRTLFLTLPEAEATARARS----RDGDASDRIGGRDPAFHQAVARAFTRF 175

Query: 181 ARNQPDRCHIVDSAHSFQSV 200
           A  +P R   VD+A    +V
Sbjct: 176 AEQEPGRFLTVDAAGDSAAV 195


>gi|114770996|ref|ZP_01448436.1| thymidylate kinase [alpha proteobacterium HTCC2255]
 gi|114548278|gb|EAU51164.1| thymidylate kinase [alpha proteobacterium HTCC2255]
          Length = 209

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEGI+G+GK+T   LL   L      V  TREPGG+  AE  R +L+S   D + 
Sbjct: 6   GLFITFEGIDGSGKSTQSQLLYDALNDLGISVIQTREPGGSIGAEIIRSLLVSGDTDRWS 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE E ++F AAR DH+E  I+PAL + +I++CDRF+DS+  YQG   +     +D L  I
Sbjct: 66  AETEILLFTAARRDHLEKTIQPALTKNQIVICDRFVDSTRVYQGVARADLRQTVDELHSI 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +++  PD T I+D   +  L R      L  ++  D FE   +   +K R  F ++++ 
Sbjct: 126 IIKK-EPDITFIIDTDPEKSLTR-----GLARNSGEDRFEEFGLEFQKKLRNGFSELSKT 179

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +  RCH+++   S + V+ +ILNIV
Sbjct: 180 EKSRCHLINGMRSKEEVSNDILNIV 204


>gi|189485350|ref|YP_001956291.1| thymidylate kinase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|170287309|dbj|BAG13830.1| thymidylate kinase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 211

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 114/208 (54%), Gaps = 1/208 (0%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M   LFI+FEG EG+GKTTH  LLK++L+++ Y+V +TREPGGT  AEA R +LL+   +
Sbjct: 1   MKKNLFITFEGGEGSGKTTHSLLLKKYLEKRGYEVLLTREPGGTILAEAVRRILLNPDSN 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                +E  ++ AAR  HVE  + PAL  GK ++CDRF D++ AYQG         +DSL
Sbjct: 61  -IVPLSELFLYEAARAQHVEEFVFPALNAGKAVICDRFTDATVAYQGYGRKLNLQLIDSL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +   + P  TI LD+    GL R +    L      D  ER+ +  HE  R+ +L  
Sbjct: 120 NSTTSFGLTPVLTIYLDILPSEGLSRAKRAKKLNRKIYSDKIERESLQFHESVREGYLSQ 179

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P+R  +V +  + +     I  I+
Sbjct: 180 AEKYPERIKVVKTQETVEKTEVCIREII 207


>gi|254489864|ref|ZP_05103059.1| thymidylate kinase [Methylophaga thiooxidans DMS010]
 gi|224464949|gb|EEF81203.1| thymidylate kinase [Methylophaga thiooxydans DMS010]
          Length = 206

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 125/210 (59%), Gaps = 5/210 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FIS EGIEGAGK+T +  ++ FL+ +   V VTREPGGT   E  R +LL+   +  
Sbjct: 2   NGKFISIEGIEGAGKSTQMRFIQSFLEHQGKTVVVTREPGGTVLGEQIRELLLTPRDEGM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             +AE ++  AAR +H+E VI+PAL  G  +L DRF+D+++AYQG         ++S+ +
Sbjct: 62  SHDAELLLMFAARAEHLEQVIKPALSRGDWVLSDRFVDATFAYQGGGRGIDIKRIESISD 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++Q +  D T++ DLPV +G +RV     ++ S   D FE++  +  EK RQ +L  A 
Sbjct: 122 WTLQAIHTDLTLLFDLPVAVGQERV-----IKRSQDKDRFEQEKGVFFEKIRQCYLQRAD 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           ++PDR   +D+  + +++   +   +  L+
Sbjct: 177 HEPDRIKKIDAGQTIENIQHQVTTALMALL 206


>gi|126739768|ref|ZP_01755459.1| thymidylate kinase [Roseobacter sp. SK209-2-6]
 gi|126719000|gb|EBA15711.1| thymidylate kinase [Roseobacter sp. SK209-2-6]
          Length = 221

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++FEGI+G+GK+T   LL   L+    +V +TREPGG+P AE  R ++L    D++ 
Sbjct: 11  GLFLTFEGIDGSGKSTQCKLLAEALRFAGKEVVLTREPGGSPGAEEIRRIVLEGDPDKWS 70

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L ++
Sbjct: 71  AETEILLFTAARRDHLERTILPALKAGKVVICDRFADSTRMYQGLSRGDLRQTVDQLHDL 130

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +Q   PD T+++D+  + GL R + R    E      FE   + + ++ R  FL +A+ 
Sbjct: 131 MIQR-EPDLTLLIDMDPETGLSRAKGRQGREE-----RFEDFGLGLQQQMRAGFLSLAQE 184

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
              R  ++D       VA  +L + 
Sbjct: 185 FNKRFRVIDGTQPIDKVAAKVLAVA 209


>gi|330810988|ref|YP_004355450.1| dTMP kinase (thymidylate kinase) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379096|gb|AEA70446.1| dTMP kinase (thymidylate kinase) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 210

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 116/212 (54%), Gaps = 6/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+ EG EGAGK+T+   L   LQ    +V +TREPGGTP AE  R VLL+   +  
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAERLQAAGIEVVLTREPGGTPLAERIREVLLAPIEEVM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + E ++  AAR  H+  VIRPAL  G ++LCDRF DS+YAYQG         + +L+ 
Sbjct: 62  NPDTELLLVFAARAQHLAEVIRPALARGAVVLCDRFTDSTYAYQGGGRGLSVERIAALEA 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
               ++ PD T++ DLPV+IGL R   R        LD FE +        R  FL  A+
Sbjct: 122 FVQGDLRPDLTLVFDLPVEIGLARASAR------GRLDRFELEGQAFFNAVRNAFLSRAK 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             P R  ++D+A     V  ++  ++  L+++
Sbjct: 176 ADPARYLLIDAAQPLTQVQQSLDGLLPRLLER 207


>gi|87199958|ref|YP_497215.1| thymidylate kinase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135639|gb|ABD26381.1| thymidylate kinase [Novosphingobium aromaticivorans DSM 12444]
          Length = 209

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 115/208 (55%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ G F++FEG EG GK+T   LL   L+ +  +V  TREPGGT  AEA R +LLS   +
Sbjct: 1   MSRGRFVAFEGGEGVGKSTQGRLLAESLRARGLEVVTTREPGGTAGAEAIRTMLLSTEGE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +GA AEA++FAAAR DHVE +IRP++  G  ++CDRF+DSS AYQG         +  L
Sbjct: 61  GWGARAEALLFAAARADHVEKLIRPSVARGAWVVCDRFVDSSRAYQGGGSGLSDADVMQL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             I    ++PD TI+L +  +I   R+    ++R+    D    +    H +    F   
Sbjct: 121 HRIGSAGLLPDVTILLTVRPEISAARL----AMRDGNAADRIGGRGEEYHGRVAAAFRRF 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A  +PDR  +VD+  S + V   +   +
Sbjct: 177 AEQEPDRFAVVDAEGSPEEVHARVTAAI 204


>gi|71907819|ref|YP_285406.1| thymidylate kinase [Dechloromonas aromatica RCB]
 gi|123627287|sp|Q47DZ5|KTHY_DECAR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|71847440|gb|AAZ46936.1| thymidylate kinase [Dechloromonas aromatica RCB]
          Length = 204

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 123/207 (59%), Gaps = 10/207 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G FI+FEGI+GAGK++H+  L   L+++   VHVTREPGGT   E  R +LL+   +  
Sbjct: 2   KGKFITFEGIDGAGKSSHVEWLAGLLRQRGIVVHVTREPGGTELGEKLRELLLN---EPM 58

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQ 121
             E E ++  AAR +H+  +I PAL  G+ ++CDRF D++YAYQ G R   +  FL +L+
Sbjct: 59  HLETETLLMFAARREHLARLIEPALARGEWVVCDRFSDATYAYQGGGRGLDRAKFL-ALE 117

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
                 + PD T++ DLP+D+  +R+     +  +  LD FE++ V  HE+ RQ +L+ A
Sbjct: 118 HWVHGHLQPDLTLLFDLPLDVARERI-----VLANRVLDKFEQERVDFHERVRQAYLERA 172

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
              P R  ++D+  S +++   +  IV
Sbjct: 173 HTSPSRIRVIDANQSIENIRKQLEQIV 199


>gi|260752471|ref|YP_003225364.1| thymidylate kinase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258551834|gb|ACV74780.1| thymidylate kinase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 216

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 116/201 (57%), Gaps = 5/201 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           +  G FIS EG EG GK+T I LL   L+ K    V  TREPGG    +A RH+LL   +
Sbjct: 7   VTHGYFISLEGGEGVGKSTQIRLLAAALEEKLQKSVIATREPGGCSGGDAIRHLLLEGDL 66

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
             +    EA++FAAAR +HV  VI+PAL +GK ++CDRF+DSS AYQG+        +  
Sbjct: 67  HRWTNATEALLFAAARAEHVARVIKPALEKGKWVVCDRFIDSSLAYQGDAGGLTQEDIRC 126

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L  I  Q ++PD T +L LP   G++R Q     R+    + FE++ +  H+K    FL 
Sbjct: 127 LHRIGSQGILPDRTFLLTLPEGEGIRRAQE----RDKNKGNRFEQRTIDYHKKVNDSFLQ 182

Query: 180 IARNQPDRCHIVDSAHSFQSV 200
           +A  +P+R  ++D++ + + V
Sbjct: 183 LAAKEPERFRVIDASGNPEEV 203


>gi|154684547|ref|YP_001419708.1| thymidylate kinase [Bacillus amyloliquefaciens FZB42]
 gi|166221718|sp|A7Z0F1|KTHY_BACA2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|154350398|gb|ABS72477.1| Tmk [Bacillus amyloliquefaciens FZB42]
          Length = 212

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 127/215 (59%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEMKEILSAEGLPVTATREPGGIDIAEQIREVILNKNNTLM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
            A+ EA+++AAAR  H+   ++PAL EG+I+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DAKTEALLYAAARRQHLAEKVQPALKEGRIVLCDRFIDSSLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + ++ + MPD TI   +  + GLKR+ +  S RE   LD    + +  H K R+ +  
Sbjct: 119 INQFAIGDTMPDVTIYFSIEPEEGLKRITSNDS-REKNRLDL---EALHFHTKVREGYQK 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R H +D++   + V  + L ++ E ++K
Sbjct: 175 VMQRFPERFHTIDASKKKELVIQDALQVINEALKK 209


>gi|254486634|ref|ZP_05099839.1| thymidylate kinase [Roseobacter sp. GAI101]
 gi|214043503|gb|EEB84141.1| thymidylate kinase [Roseobacter sp. GAI101]
          Length = 210

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + G FISFEGI+G+GK+T   +LK  L+   YDV +TREPGG+P AE  R ++L    D 
Sbjct: 3   SQGFFISFEGIDGSGKSTQTKILKESLEALGYDVILTREPGGSPGAEEIRALVLQGDPDR 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + A+ E ++F AAR DH+E  I+PAL  GK+++CDRF DS+  YQG         +D L 
Sbjct: 63  WSAQTEILLFTAARRDHLERTIQPALDAGKVVICDRFADSTRMYQGLSRGDLRDAVDQLH 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +  + PD T+++D+    GL R  +R ++ E      FE     +    R+ FL +A
Sbjct: 123 ALMIG-IEPDLTVLIDMDPAEGLSRALSRNTVEER-----FEDFGESLQVAMRKGFLALA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNIL 205
               DR  ++D A     VA ++L
Sbjct: 177 EEFDDRFVVIDGARQIDQVAADVL 200


>gi|315499862|ref|YP_004088665.1| thymidylate kinase [Asticcacaulis excentricus CB 48]
 gi|315417874|gb|ADU14514.1| thymidylate kinase [Asticcacaulis excentricus CB 48]
          Length = 212

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 119/217 (54%), Gaps = 9/217 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+FEG EGAGK+T +  L   L+    +V  TREPGG+  AEA R +L++     +
Sbjct: 2   TGRFITFEGGEGAGKSTQVKALVAHLRELALEVVQTREPGGSSGAEALRDLLVTGEAGRW 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  AAR +H+E VIRPAL  G  ++CDRF DS+ AYQG         ++S+  
Sbjct: 62  SPMSETLMMYAARANHLEQVIRPALERGAWIVCDRFSDSTRAYQGAGGGVTPELIESIDA 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
             V +  PD  I++D+P + GLKR     +L      + FE K +  HE+ R+ F   A 
Sbjct: 122 AVVADTQPDLVIVMDMPPEAGLKR-----ALARGDAENRFESKGLAFHERLREGFRRRAA 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
             P+R  ++D+  S + +  +    VW +V  R + L
Sbjct: 177 AHPERYRLIDADRSIEDIKAD----VWRVVSGRFAEL 209


>gi|254512028|ref|ZP_05124095.1| thymidylate kinase [Rhodobacteraceae bacterium KLH11]
 gi|221535739|gb|EEE38727.1| thymidylate kinase [Rhodobacteraceae bacterium KLH11]
          Length = 203

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +F++FEGI+G+GK+T   LL   L+R+ ++V +TREPGG+  AE  R+++L    D + A
Sbjct: 1   MFLTFEGIDGSGKSTQARLLAEHLRREGHEVILTREPGGSDGAEEIRNLVLQGDPDRWSA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L  + 
Sbjct: 61  ETEILLFTAARRDHLERTIEPALAAGKVVICDRFADSTRMYQGLSRGDLRGLVDQLHNLM 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +    PD T+++D+    GL R + R    E      FE   + + ++ R  FL +A+  
Sbjct: 121 IGRE-PDLTLLIDMDPGTGLSRAKGRQGAEER-----FEDFGLDLQQQMRAGFLALAQEF 174

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
            DR  +VD   +  SVA ++  +V
Sbjct: 175 SDRFRVVDGNRNMDSVAQDVTKVV 198


>gi|46446707|ref|YP_008072.1| putative thymidylate kinase, tmk [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|59798299|sp|Q6MCA2|KTHY_PARUW RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|46400348|emb|CAF23797.1| putative thymidylate kinase, tmk [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 225

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 2/209 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-EF 62
           G FI+ EG EG+GK+T ++ L  + + K ++V  TREPGGT   E+ RH+LL+       
Sbjct: 8   GYFITIEGGEGSGKSTLLNQLGDYFRNKGFEVIQTREPGGTKLGESIRHLLLNHEDSISI 67

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           G +AE ++F AAR  H+E +I+PAL  GKI+LCDRF DS+ AYQG         +    +
Sbjct: 68  GHQAELLLFLAARAQHIEELIQPALKAGKIVLCDRFNDSTIAYQGAARGLNAKKIQEFCQ 127

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR-ESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   E++P+ T+ LD+  +IGL R Q    +  +   LD  E + +  HE+ RQ FL + 
Sbjct: 128 LVCAEILPNWTLFLDVSPEIGLARTQKIQKVHAQMGQLDRIESEKIEFHERVRQAFLSLV 187

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           + +P R + +D+  S   V    L  + E
Sbjct: 188 QQEPQRIYRIDANESQSKVLQKALEFLEE 216


>gi|120554780|ref|YP_959131.1| dTMP kinase [Marinobacter aquaeolei VT8]
 gi|120324629|gb|ABM18944.1| thymidylate kinase [Marinobacter aquaeolei VT8]
          Length = 214

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 120/217 (55%), Gaps = 6/217 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +  G FI+FEG EG GK+T +    + L+R   D  VTREPGGTP AE+ R +LL+   +
Sbjct: 3   LARGRFITFEGTEGVGKSTQLDNAAKTLERLGIDYIVTREPGGTPMAESIRELLLAPREE 62

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 E ++  AAR  H+ N I PAL  GK +LCDRF D+++AYQG         +  L
Sbjct: 63  SVHETTELLLMFAARAQHLHNRILPALSAGKWVLCDRFTDATFAYQGGGRGVSRERIALL 122

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +   E+ PD  I+LD PV+ G+ R + R        LD FER+     ++ R+ +L+ 
Sbjct: 123 EALVQGEMRPDHVILLDAPVETGMARARKR------GELDRFEREAQAFFQRIRETYLER 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           A   P R H+V++A   + V+ ++  ++  L +  VS
Sbjct: 177 ATEMPGRYHVVNAALPLEQVSESVSALLTALAKLPVS 213


>gi|213691095|ref|YP_002321681.1| dTMP kinase [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|254808279|sp|B7GT80|KTHY_BIFLI RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|213522556|gb|ACJ51303.1| dTMP kinase [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|320457150|dbj|BAJ67771.1| thymidylate kinase [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 233

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 129/220 (58%), Gaps = 15/220 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-- 60
           SGLF+SFEG++G GKTT +  L+ +L+ +   V VTREPGGT   +A R +LL  GVD  
Sbjct: 2   SGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTVLGKAIRQLLLH-GVDGG 60

Query: 61  --EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFL 117
             +    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +    +
Sbjct: 61  AVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPE-EI 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            SL   +   ++PD T +LD+   +   R+++     ESA  D+  R         RQ F
Sbjct: 120 RSLSMWATNNLLPDRTYLLDMDPALSHNRLEHAEDRMESAGSDFQSRT--------RQAF 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           LD+A  +P+R H++D++ S + V + I   +  L++  V+
Sbjct: 172 LDLAAAEPNRFHVIDASQSIEQVWSAIEADIQTLLRDNVA 211


>gi|83954240|ref|ZP_00962960.1| thymidylate kinase [Sulfitobacter sp. NAS-14.1]
 gi|83841277|gb|EAP80447.1| thymidylate kinase [Sulfitobacter sp. NAS-14.1]
          Length = 212

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFISFEGI+G+GK+T   LLK  L+   + V +TREPGG+P AE  R ++L    D + 
Sbjct: 7   GLFISFEGIDGSGKSTQTKLLKDRLEADGHQVVLTREPGGSPGAEEIRALVLQGDPDRWS 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  E ++F AAR DH+E  I PAL  GKI++CDRF DS+  YQG         +D L  +
Sbjct: 67  ARTEILLFTAARRDHLERTILPALEAGKIVICDRFADSTRMYQGLSRGDLRGAVDQLHSL 126

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  V PD T+++D+    GL R  +R ++ E      FE     +    R  FL +A  
Sbjct: 127 MIG-VEPDVTVLIDMDPGEGLSRALSRNTVEE-----RFEDFGESLQVAMRAGFLSLAAE 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            PDR   ++ A S  +VA +++  V
Sbjct: 181 FPDRFVTINGAQSIDAVAADVIAQV 205


>gi|94496389|ref|ZP_01302966.1| Thymidylate kinase [Sphingomonas sp. SKA58]
 gi|94424135|gb|EAT09159.1| Thymidylate kinase [Sphingomonas sp. SKA58]
          Length = 208

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 120/212 (56%), Gaps = 5/212 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FIS EG EGAGK+T +  L R L+ +  DV  TREPGG+  AEA R +LL+ G D
Sbjct: 1   MTTGRFISLEGGEGAGKSTQLRALARTLRERGLDVLETREPGGSDGAEAIRTLLLTGGAD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +   AEA++FAAAR DH+E  IRPAL  G  +L DRFLDSS AYQG+ + S    + +L
Sbjct: 61  RWSPRAEALLFAAARADHIEKTIRPALARGAWVLSDRFLDSSRAYQGQGELSDSDIV-AL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             I   + +PD T++L LP         +R   R+   +D    +D   H      F   
Sbjct: 120 HRIGSADFLPDRTLVLTLPD----AVAADRARARDGDHVDRIGGRDSRFHHAVADAFARF 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A  + +R   +D++ + ++V   +++ + +L+
Sbjct: 176 AAQESERVRAIDASGTTEAVTQRLVDALADLL 207


>gi|118594886|ref|ZP_01552233.1| thymidylate kinase [Methylophilales bacterium HTCC2181]
 gi|118440664|gb|EAV47291.1| thymidylate kinase [Methylophilales bacterium HTCC2181]
          Length = 204

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 124/204 (60%), Gaps = 9/204 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN  LFIS EG++GAGKTTHI  ++ + + K    ++TREPGGT   E  R +LL    +
Sbjct: 1   MNKPLFISLEGVDGAGKTTHIHFIEDYFRTKGLPFYMTREPGGTDLGEKLRLLLLH---E 57

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E  A  E ++  AAR +H++ +I+P L +G  ++ DRF D++YAYQ          +D L
Sbjct: 58  EMDALTETMLMFAARCEHIQTIIKPKLDQGITVVSDRFTDATYAYQAGGKGVDARSIDVL 117

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +  +++ PD T + D+PV+I ++R      L+++  +D FER++ + H+  R  +LD+
Sbjct: 118 KSLVQKDLDPDLTFLFDVPVEISIER------LKDTRTMDKFEREEPIFHQSIRNAYLDL 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A++ P R H+++  H+ +++   I
Sbjct: 172 AQSFPQRFHVLNGTHAIEAIQDEI 195


>gi|328950279|ref|YP_004367614.1| Thymidylate kinase [Marinithermus hydrothermalis DSM 14884]
 gi|328450603|gb|AEB11504.1| Thymidylate kinase [Marinithermus hydrothermalis DSM 14884]
          Length = 202

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 118/204 (57%), Gaps = 12/204 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EG+GK+T  + L  +L+++   V VTREPGGTP   A R  LLS  +D
Sbjct: 1   MKPGFFITFEGPEGSGKSTQAAHLAAWLRQQGVSVVVTREPGGTPLGRAVRQWLLSESMD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 E +++ A R +HV +VIRPAL  G++++ DRF+DSSYAYQG        +L ++
Sbjct: 61  PV---TEFLLYTADRAEHVRHVIRPALAAGQVVISDRFVDSSYAYQGFGRGLDLEWLRAV 117

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +  ++ ++PD T +LDLP ++GL R   R         D  E++ +  H + R+ +  +
Sbjct: 118 SQPVLEGLVPDVTFLLDLPPEVGLARKAER---------DRLEQESLAFHRRVREGYRVL 168

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           AR +P R  ++D+    + +   +
Sbjct: 169 ARAEPQRFVVLDATQPPEVIVEQV 192


>gi|283783708|ref|YP_003374462.1| dTMP kinase [Gardnerella vaginalis 409-05]
 gi|283441867|gb|ADB14333.1| dTMP kinase [Gardnerella vaginalis 409-05]
          Length = 234

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 121/220 (55%), Gaps = 20/220 (9%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N GLFISFEGI+G GKTT +  LK +LQ    +V VTREPGGT   +  R +LL      
Sbjct: 28  NKGLFISFEGIDGVGKTTQVEALKDYLQSLGREVVVTREPGGTQLGKTLREILLHG--TS 85

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD--- 118
             A  EA++FAA R  HV  VIRPAL  G +++ DR++DSS AYQ      + L +D   
Sbjct: 86  VSARTEALLFAADRAQHVAQVIRPALSRGAVVITDRYIDSSLAYQA---GGRELTMDDVR 142

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +L E +   + P+ T +LD+  +   KR+       ESA +D+  R         R+ FL
Sbjct: 143 TLSEWATDSLWPNRTYLLDMQPEDAFKRLHREQDRMESAGIDFARRT--------REAFL 194

Query: 179 DIARNQPDRCHIVDSAHS----FQSVATNILNIVWELVQK 214
           D+A+   DR  ++D+  S    F+ +  ++ N++ E+  K
Sbjct: 195 DLAQESADRYRVLDATFSAKSLFELIVQDVHNLIKEIETK 234


>gi|148553408|ref|YP_001260990.1| thymidylate kinase [Sphingomonas wittichii RW1]
 gi|166987709|sp|A5V3I6|KTHY_SPHWW RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|148498598|gb|ABQ66852.1| thymidylate kinase [Sphingomonas wittichii RW1]
          Length = 208

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 117/210 (55%), Gaps = 6/210 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GK+T    L   L+ +  DV  TREPGG+  AEA R +LL    D + 
Sbjct: 3   GRFITLEGGEGVGKSTQAKALAAALRARGLDVVETREPGGSDGAEAIRRLLLEGAADRWN 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A AEA++FAAAR DHV   IRPA+  G+ ++CDRFLDSS AYQG  D      + +L  I
Sbjct: 63  ARAEALLFAAARADHVARTIRPAIEAGRWVVCDRFLDSSIAYQGGADGLGDEAIRTLHAI 122

Query: 124 SVQEVMPDCTIILDLPV-DIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
                +PD T++LD+PV D   ++ +        A  D FE++D   H++    F  IA 
Sbjct: 123 GSAGYLPDRTLLLDMPVFDAAFRQAEAGI-----ANSDRFEKRDEAFHDRVADSFRRIAA 177

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +P R   +++  S Q V   ++  + +L+
Sbjct: 178 QEPARIRTINAQGSPQEVTARLIEALADLL 207


>gi|323136277|ref|ZP_08071359.1| thymidylate kinase [Methylocystis sp. ATCC 49242]
 gi|322398351|gb|EFY00871.1| thymidylate kinase [Methylocystis sp. ATCC 49242]
          Length = 226

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 94/205 (45%), Positives = 125/205 (60%), Gaps = 2/205 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T ++ L   L+ +  +V  TREPGGTP AE  R VLLS  +   G
Sbjct: 10  GRFITFEGGEGAGKSTQLARLSEHLRGRGIEVVATREPGGTPKAEKLREVLLSGRIAPLG 69

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA +FAAAR+DHVE++I PAL  G  +L DRF DS+ AYQG R       +  L+  
Sbjct: 70  PLAEAALFAAARIDHVESLIAPALARGAWVLSDRFADSTRAYQGARGGVDDASISLLERA 129

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++  V PD TIILDLP   GL R  +R +       D FE ++ + HE+ R+ FLDIA  
Sbjct: 130 AIGNVRPDLTIILDLPPQEGLARAASRRAA--GVAPDRFEAEEELFHEELRRAFLDIAEQ 187

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +P+RC +V+ A +   VA  I  +V
Sbjct: 188 EPERCCVVNGALAADEVAQAIRQLV 212


>gi|160893397|ref|ZP_02074183.1| hypothetical protein CLOL250_00947 [Clostridium sp. L2-50]
 gi|156864972|gb|EDO58403.1| hypothetical protein CLOL250_00947 [Clostridium sp. L2-50]
          Length = 211

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 126/211 (59%), Gaps = 14/211 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+ EG +GAGKTT I LLK +L +K YDV +TR+PGG   +EA R V+L+    E G
Sbjct: 6   GIFITMEGPDGAGKTTQIELLKDYLNKKGYDVLITRDPGGNAVSEAIREVILNKDFTEMG 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS---L 120
              E +++AAAR   V+  I+PAL  GK ++ DRF+DSS  YQG     + L +D+   +
Sbjct: 66  YMTELLLYAAARAQLVKENIKPALSAGKAVIADRFVDSSAVYQG---IGRGLGIDTVYKV 122

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E ++Q ++PD T ++DL  + G+ R +N+      A LD  E++ +  H+K  + +  +
Sbjct: 123 NEFALQGILPDMTFLMDLDAEAGIARKKNQ------AELDRMEQESLEFHKKVVEGYRCL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV--W 209
           A   PDR   VD+A   +++   I++ V  W
Sbjct: 177 AEMNPDRIVKVDAALPKEAIHDIIISYVEKW 207


>gi|158521178|ref|YP_001529048.1| dTMP kinase [Desulfococcus oleovorans Hxd3]
 gi|229500940|sp|A8ZXL3|KTHY_DESOH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|158510004|gb|ABW66971.1| dTMP kinase [Desulfococcus oleovorans Hxd3]
          Length = 214

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 110/202 (54%), Gaps = 1/202 (0%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EGIEGAGKTT +  L  FL++  +   VTREPGGT   +  R +LL     +   
Sbjct: 1   MFITLEGIEGAGKTTQLPRLVDFLEQHGHTCVVTREPGGTGMGQKIRSLLLDPDNSDMSP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E E  ++AA R  HV  +I PAL EGK ++CDRF D++  YQG         +  L  ++
Sbjct: 61  ETELFLYAADRAQHVRRLIEPALAEGKTVVCDRFADATEVYQGWARGLDMELVQVLNRVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD-YFERKDVMIHEKRRQIFLDIARN 183
                PD T++ DLP + GLKR   R +       D  FE + +  HE+ R  +LD+AR 
Sbjct: 121 TGGRKPDITLLFDLPPEAGLKRAWQRIARNGKEAADCRFENEKMAFHERVRHGYLDLARR 180

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
           +P+R  ++D+      VA  ++
Sbjct: 181 EPERFVVIDALGPAAEVAGRMI 202


>gi|89053768|ref|YP_509219.1| thymidylate kinase [Jannaschia sp. CCS1]
 gi|122499181|sp|Q28SW8|KTHY_JANSC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|88863317|gb|ABD54194.1| thymidylate kinase [Jannaschia sp. CCS1]
          Length = 208

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFIS EGI+G+GK+T  + L  +L+ +  D   TREPGG+  AE  R +L+    D + A
Sbjct: 4   LFISLEGIDGSGKSTQTARLVDWLRVRGRDPLQTREPGGSEGAEEIRRLLVEGDPDRWSA 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E E ++F AAR DH+E  IRPAL  G+ ++ DRF DS+  YQG    +    +D +   +
Sbjct: 64  ETEILLFTAARRDHLERTIRPALASGRDVVTDRFADSTRVYQGATRGALRGLVDRIHAEA 123

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           + E  PD T+ILD+  ++ L R      L   +  D FE   +   +K R  F  +AR  
Sbjct: 124 I-EAEPDLTLILDMDPELALSR-----GLARDSGEDRFEDFGLPFQQKLRAGFQALAREY 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
           PDRCHIVD++    ++A  I  IV
Sbjct: 178 PDRCHIVDASADPDAIAHTIQTIV 201


>gi|169830255|ref|YP_001716237.1| dTMP kinase [Candidatus Desulforudis audaxviator MP104C]
 gi|226732654|sp|B1I165|KTHY_DESAP RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|169637099|gb|ACA58605.1| dTMP kinase [Candidatus Desulforudis audaxviator MP104C]
          Length = 221

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 119/214 (55%), Gaps = 8/214 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLL-KRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           SG+FI FEGI+GAGKTT ++ L +  L  +N+ V VTREPGGT   EA R VLL  G  E
Sbjct: 2   SGVFIVFEGIDGAGKTTQLAYLHEALLSMRNHRVLVTREPGGTRIGEAVRRVLLDTGNSE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              E EA+++AAAR      V+RPAL  G+I+L DRFLDSS AYQG     +   L  + 
Sbjct: 62  MTGETEALLYAAARSQFTAEVVRPALARGEIVLSDRFLDSSLAYQGFGRGLELHRLRQVN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            ++   + PD T++LDLPV   + R+            D  ER+ V   E+ R+ +L++A
Sbjct: 122 FLATGGLRPDLTVLLDLPVAAAVARMDPDRR-------DRLEREGVDFFERVRRGYLELA 174

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
              P    IV++       A+ I   V  L+Q R
Sbjct: 175 SADPGHYLIVNAEREAGVCASAIWARVRALLQDR 208


>gi|303248931|ref|ZP_07335178.1| thymidylate kinase [Desulfovibrio fructosovorans JJ]
 gi|302489654|gb|EFL49590.1| thymidylate kinase [Desulfovibrio fructosovorans JJ]
          Length = 211

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 113/215 (52%), Gaps = 7/215 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG+GK+T I+LLK  L+     V  TR+PGG P  E  R +LLS        
Sbjct: 1   MFITFEGIEGSGKSTQITLLKSALEATGKSVVTTRQPGGCPLGETLRSILLSTQTKNLDH 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE  ++ A R  H+  VIRPA   G I+LCDRF DS+  YQG         L  L +I+
Sbjct: 61  RAELFLYLADRAQHIAEVIRPAQNAGHIVLCDRFADSTVVYQGYGRGLDVAMLHELNDIA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACL--DYFERKDVMIHEKRRQIFLDIAR 182
           V    P  TI+LDL  + GL+R   R +L+   C     FE +D+  H + R  +L +A 
Sbjct: 121 VAGAWPQRTILLDLDPEQGLRRALAR-NLKTGNCATEGRFEAEDIDFHTRIRDGYLALAS 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
             P R  ++D+     +VA      VW  V  R+S
Sbjct: 180 LHPRRYAVIDATPDVATVA----KAVWAAVSSRMS 210


>gi|152996289|ref|YP_001341124.1| dTMP kinase [Marinomonas sp. MWYL1]
 gi|189028836|sp|A6VXL0|KTHY_MARMS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|150837213|gb|ABR71189.1| dTMP kinase [Marinomonas sp. MWYL1]
          Length = 212

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 115/212 (54%), Gaps = 12/212 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FIS EG EG+GKTT I  ++++L        +TREPGGTP AE  R ++L+   +   
Sbjct: 3   GKFISLEGGEGSGKTTAIHFIRQWLDDHKIPYIMTREPGGTPLAEEIRQLVLTPRDESVN 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR  H+   I+PAL +G  ++ DRFLDSSY YQG+        LD L   
Sbjct: 63  DVTELLLVFAARAQHLAEKIQPALEKGTWVISDRFLDSSYVYQGKARGGDIAMLDQLANW 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            V +  PD T++LD+PV++G +RV  R         D  +++    H+K R  FL+ A  
Sbjct: 123 VVGDNKPDATLVLDVPVELGQERVVQRQH------QDRLDKESFAFHQKVRDGFLERAEA 176

Query: 184 QPDRCHIVDSAHSFQSVATNI------LNIVW 209
            P R  IVD++ S +SV + I      LN  W
Sbjct: 177 DPKRVKIVDASQSLESVKSQIEEQLAKLNEAW 208


>gi|254439317|ref|ZP_05052811.1| thymidylate kinase [Octadecabacter antarcticus 307]
 gi|198254763|gb|EDY79077.1| thymidylate kinase [Octadecabacter antarcticus 307]
          Length = 223

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 112/202 (55%), Gaps = 12/202 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLK-RFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           GLFISFEGI+G+GK+T   LLK RF      D  +TREPGG+  AE  R +LL+   D +
Sbjct: 22  GLFISFEGIDGSGKSTQTKLLKDRF-----PDAVLTREPGGSAGAEEIRALLLTGDPDRW 76

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE E ++F AAR DH+E  I PAL  GK ++CDRF DS+  YQG    +    +D+L +
Sbjct: 77  SAETEILLFTAARRDHLEKTILPALAAGKTVICDRFADSTRVYQGATRGALRGAVDTLHD 136

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +    PD T I+D+   I L R      L   +  D FE   +   E  R  FL +A+
Sbjct: 137 VMIGR-EPDLTFIIDMDPGIALSR-----GLARGSGEDRFEDMGLAFQETLRHGFLALAK 190

Query: 183 NQPDRCHIVDSAHSFQSVATNI 204
             PDRC ++D      +VA  I
Sbjct: 191 ANPDRCVLIDGNRDPVAVAAEI 212


>gi|78485063|ref|YP_390988.1| thymidylate kinase [Thiomicrospira crunogena XCL-2]
 gi|78363349|gb|ABB41314.1| thymidylate kinase [Thiomicrospira crunogena XCL-2]
          Length = 219

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 114/201 (56%), Gaps = 7/201 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG F++ EG EG GK+T++  ++++L   N DV VTREPGGT  +EA R +LL     E 
Sbjct: 11  SGKFLTLEGTEGGGKSTNLVFIQQWLADHNIDVVVTREPGGTAVSEAVREILLDKQYSEM 70

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             E E ++  AAR  H++  I PAL  GK ++ DRF D+SYAYQG    ++ +  D + E
Sbjct: 71  TPETELLLMFAARNQHLQEKILPALAAGKWVVSDRFTDASYAYQG---GARGIAYDRIAE 127

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I     Q   PD T + DLP++ G+KRV  R  L   A +D FE++ +   EK R  +L 
Sbjct: 128 IENWVQQGCYPDMTFVFDLPIEEGMKRVAARSKLSGQA-IDRFEQEKMEFFEKVRAAYLY 186

Query: 180 IARNQPDRCHIVDSAHSFQSV 200
            A   P R  ++++A     V
Sbjct: 187 RAEQAPQRYCVLNAARPLNEV 207


>gi|331000633|ref|ZP_08324288.1| dTMP kinase [Parasutterella excrementihominis YIT 11859]
 gi|329570905|gb|EGG52613.1| dTMP kinase [Parasutterella excrementihominis YIT 11859]
          Length = 202

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 11/205 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+T   ++   L+ +  D  +TREPGG  +AE  R +LL+   +   
Sbjct: 5   GKFITVEGVDGAGKSTQFEVIANALKERGIDFVMTREPGGPQSAEKIRELLLN---EPMT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+ E +V  AAR +++  +IRPAL  GK +LCDRF D+S AYQG         ++ L   
Sbjct: 62  AKCELLVMFAARQENLTKIIRPALEAGKWVLCDRFTDASVAYQGYGRGRSLEEIEMLANF 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T+I DLP ++   R+  +        LD FE++D   H + RQ +L+IA+ 
Sbjct: 122 VHPDIKPDKTVIFDLPTEVAAARLSRK--------LDRFEQEDADFHRRVRQGYLEIAKR 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +P+RC ++D+  + + V+  +L  V
Sbjct: 174 EPERCVVIDAQGTPEEVSARVLKEV 198


>gi|118586633|ref|ZP_01544073.1| thymidylate kinase [Oenococcus oeni ATCC BAA-1163]
 gi|118432948|gb|EAV39674.1| thymidylate kinase [Oenococcus oeni ATCC BAA-1163]
          Length = 213

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 126/214 (58%), Gaps = 11/214 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-TREPGGTPAAEAARHVLLSCGV 59
           M  G FI+ EG +GAGKT+ +  L   L+    D  + TREPGG   +EA R ++L    
Sbjct: 1   MKKGFFITIEGPDGAGKTSLLDNLMPALRDIFGDNLIETREPGGVRISEAIRKIVLGLKY 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            E     EA++FAAAR  H+   I PAL +GKI+L DRF+DSS AYQG     + L +++
Sbjct: 61  PEMNRRTEALLFAAARAQHMVEKIEPALADGKIVLSDRFVDSSIAYQG---GGRELGIEA 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           + EI   +   + P+ T++LDLP ++G+ R+        S  ++  ++  ++ H+K RQ 
Sbjct: 118 VSEINNFATNGLQPNLTLLLDLPSEVGIARIMK----HRSDEVNRLDKDRLVFHKKVRQT 173

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +L +A++QP+R  ++D+  S + +A N L ++ E
Sbjct: 174 YLQLAKDQPNRIKVLDATQSPEKIAINALQLIQE 207


>gi|94499607|ref|ZP_01306144.1| thymidylate kinase [Oceanobacter sp. RED65]
 gi|94428361|gb|EAT13334.1| thymidylate kinase [Oceanobacter sp. RED65]
          Length = 206

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 121/211 (57%), Gaps = 9/211 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +GLFI+ EG+EG GKTT+I  +K +LQ +  D  VTREPGGT   E+ R++LL    D
Sbjct: 1   MQAGLFITVEGVEGVGKTTNIEYIKNWLQHQGIDYVVTREPGGTDLGESLRNLLLHG--D 58

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +   +AE ++  AAR  H+E VI+PAL  G+ +LCDRF DS++AYQG        ++  L
Sbjct: 59  DVSDKAELLMMFAARSQHIEKVIKPALAAGRWVLCDRFTDSTFAYQGGGRQLNPEWIRQL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +  +E+ PD T +LD PV+IG             +  D  E +D++   + R  FL  
Sbjct: 119 ETLVQEELQPDVTFLLDCPVEIGRA------RAAARSASDRIESQDLVFFNRVRDAFLHR 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
           A +  DR  ++D++     V   I +++ EL
Sbjct: 173 A-SLYDRFRVIDASQDLLQVQQQIESVLVEL 202


>gi|308171919|ref|YP_003918624.1| thymidylate kinase [Bacillus amyloliquefaciens DSM 7]
 gi|307604783|emb|CBI41154.1| thymidylate kinase [Bacillus amyloliquefaciens DSM 7]
 gi|328551729|gb|AEB22221.1| thymidylate kinase [Bacillus amyloliquefaciens TA208]
 gi|328909989|gb|AEB61585.1| thymidylate kinase [Bacillus amyloliquefaciens LL3]
          Length = 212

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 127/215 (59%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  + + V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKDILSAEGHPVTATREPGGIDIAEQIREVILNKNNTLM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
            A+ EA+++AAAR  H+   ++PAL EG+I+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DAKTEALLYAAARRQHLVEKVQPALKEGRIVLCDRFIDSSLAYQG---YARGLGIDEVFS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +   ++ + MPD TI   +  + GLKR+ +  S RE   LD    + +  H K R+ +  
Sbjct: 119 INRFAIGDTMPDVTIYFSIDPEEGLKRITSNDS-REKNRLDL---EALHFHTKVREGYQK 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R H +D++   + V  + L ++ E ++K
Sbjct: 175 VMQRFPERFHTIDASRKKEFVIQDALQVINEALKK 209


>gi|110680630|ref|YP_683637.1| thymidylate kinase [Roseobacter denitrificans OCh 114]
 gi|109456746|gb|ABG32951.1| thymidylate kinase [Roseobacter denitrificans OCh 114]
          Length = 212

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 117/207 (56%), Gaps = 6/207 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           ++G FI+FEGI+G+GK+T    L   L+   ++V  TREPGG+P AE  R ++L    D 
Sbjct: 7   DTGFFITFEGIDGSGKSTQSKRLAAHLRASGHEVVETREPGGSPGAEEIRALVLQGDPDR 66

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E +I PAL +GKI++CDRF DS+  YQG         +D+L 
Sbjct: 67  WSAETEILLFTAARRDHMERLILPALADGKIVICDRFADSTRMYQGLSRGDLRQVVDTLH 126

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E+ +    PD T+++D+   IGL R  +R +  E      FE     +  + R  FL +A
Sbjct: 127 ELMIGR-EPDLTVLIDMDPAIGLSRALSRQTADE-----RFEAFGEDLQTRMRAGFLALA 180

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    R  +VD      SVA  ++ IV
Sbjct: 181 QEFKARFRLVDGGRDADSVAAEVIKIV 207


>gi|77165137|ref|YP_343662.1| thymidylate kinase [Nitrosococcus oceani ATCC 19707]
 gi|76883451|gb|ABA58132.1| thymidylate kinase [Nitrosococcus oceani ATCC 19707]
          Length = 206

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 118/206 (57%), Gaps = 5/206 (2%)

Query: 9   FEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEA 68
            EGIEGAGK+T +  +++ LQ    +V VTREPGGT   E  R +LLS  ++   A+ E 
Sbjct: 2   LEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTEL 61

Query: 69  IVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEV 128
           ++  AAR++HV+ VI PAL  GK +LCDRF  +SYAYQG         +  L+  ++  +
Sbjct: 62  LLMFAARVEHVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCL 121

Query: 129 MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRC 188
            PD  ++ D+PV +GL+R   R        LD FE++ +   ++ R I+L +A+  PD+ 
Sbjct: 122 RPDLILLFDVPVRLGLQRATTR-----CQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQY 176

Query: 189 HIVDSAHSFQSVATNILNIVWELVQK 214
            ++DS+     V   I  ++   +++
Sbjct: 177 RLIDSSLPLTRVQEAIQKVIMAFLEE 202


>gi|46580545|ref|YP_011353.1| thymidylate kinase [Desulfovibrio vulgaris str. Hildenborough]
 gi|59798319|sp|Q72A57|KTHY_DESVH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|46449964|gb|AAS96613.1| thymidylate kinase [Desulfovibrio vulgaris str. Hildenborough]
 gi|311234283|gb|ADP87137.1| thymidylate kinase [Desulfovibrio vulgaris RCH1]
          Length = 224

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 116/206 (56%), Gaps = 3/206 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG+GK+T +  L  +LQ++ + V VTREPGG+      R +LL  G  +   
Sbjct: 1   MFITFEGIEGSGKSTALQGLAAWLQQRGHGVAVTREPGGSRLGRTLRSILLDLGNTDITP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           EAE  ++ A R  HV  V+RPAL EG ++L DR+ DS+  YQG       + L    +++
Sbjct: 61  EAELFLYLADRAQHVAQVVRPALDEGMVVLSDRYADSTVVYQGYGRGLDPMMLRQFNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRES--ACLDYFERKDVMIHEKRRQIFLDIAR 182
           V  + PD TI+LDL  + GL R   R ++RE   A    FE + +  H + R+ +L  A 
Sbjct: 121 VGGLWPDLTILLDLEPEAGLNRALAR-NIREGMHAAEGRFEAESLAFHTRVREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
               R  +VD+  S + V  +++ IV
Sbjct: 180 LHGGRYRVVDATQSPEDVVRDVVGIV 205


>gi|145589149|ref|YP_001155746.1| dTMP kinase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047555|gb|ABP34182.1| thymidylate kinase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 214

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 126/221 (57%), Gaps = 24/221 (10%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYD--VHVTREPGGTPAAEAARHVLLSCG 58
           +  G FISFEGI+GAGK+THI   K+ +Q +  D  V +TREPGGTP  E  R++LL   
Sbjct: 6   LYPGFFISFEGIDGAGKSTHIESFKKLMQERYPDREVVMTREPGGTPLGEQLRNLLLDAP 65

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
           ++    E EA++  AAR +H+  +I PAL+ GKI++ DRF D+S+AYQG     + L L 
Sbjct: 66  MN---LETEALLMFAARREHIAQIIEPALLAGKIVISDRFTDASFAYQG---GGRGLSLA 119

Query: 119 SLQEIS--VQE------VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIH 170
            L ++   VQ       + P+ TI+ DLP +I   R   R  +R     D FE+ D++  
Sbjct: 120 KLNDLEQWVQGRADGKLLQPNLTILFDLPGEIAQAR---RSKVRTP---DKFEKLDLVFF 173

Query: 171 EKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNI--LNIVW 209
           EK RQ +L  A   P R H VD+  + +++   +  L I W
Sbjct: 174 EKVRQEYLRRALEDPSRFHKVDATQTPEAIWNGLQALEINW 214


>gi|298252464|ref|ZP_06976259.1| thymidylate kinase [Gardnerella vaginalis 5-1]
 gi|297533354|gb|EFH72237.1| thymidylate kinase [Gardnerella vaginalis 5-1]
          Length = 234

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 123/218 (56%), Gaps = 16/218 (7%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N GLFISFEGI+G GKTT +  LK +LQ    +V VTREPGGT   +  R +LL      
Sbjct: 28  NKGLFISFEGIDGVGKTTQVEALKDYLQSLGREVVVTREPGGTQLGKTLREILLHG--TS 85

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSL 120
             A  EA++FAA R  HV  VIRPAL  G +++ DR++DSS AYQ G R+ ++   + +L
Sbjct: 86  VSARTEALLFAADRAQHVAQVIRPALSRGAVVITDRYIDSSLAYQAGGRELTKD-DVRTL 144

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E +   + P+ T +LD+  +   KR+       ESA +D+  R         R+ FLD+
Sbjct: 145 SEWATDSLWPNRTYLLDMQPEDAFKRLHREQDRMESAGIDFARRT--------REAFLDL 196

Query: 181 ARNQPDRCHIVDSAHS----FQSVATNILNIVWELVQK 214
           A+   DR  ++D+  S    F+ +  ++ N++ E+  K
Sbjct: 197 AQESADRYRVLDATFSAKSLFELIVQDVHNLIKEIETK 234


>gi|291455870|ref|ZP_06595260.1| dTMP kinase [Bifidobacterium breve DSM 20213]
 gi|291382279|gb|EFE89797.1| dTMP kinase [Bifidobacterium breve DSM 20213]
          Length = 206

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/215 (39%), Positives = 126/215 (58%), Gaps = 15/215 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLF+SFEG++G GKTT +  L+ +L+ +   V VTREPGGT   +A R +LL  GV+E 
Sbjct: 2   SGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAVRQLLLH-GVNEG 60

Query: 63  GAE----AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFL 117
            A+    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +    +
Sbjct: 61  AADIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTSE-EI 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            SL   +   ++PD T +LD+   +   R+++     ESA  D+  R         RQ F
Sbjct: 120 RSLSMWATNNLLPDRTYLLDMDPTLSHNRLEHAEDRMESAGDDFQSRT--------RQAF 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD+A  +P+R  ++D++ S + V   I   + EL 
Sbjct: 172 LDLAAVEPNRFRVIDASQSIEQVWAAIEADIKELA 206


>gi|300114110|ref|YP_003760685.1| thymidylate kinase [Nitrosococcus watsonii C-113]
 gi|299540047|gb|ADJ28364.1| thymidylate kinase [Nitrosococcus watsonii C-113]
          Length = 210

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 117/203 (57%), Gaps = 5/203 (2%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ EGIEGAGK+T ++ +++ LQ    +V VTREPGGT   E  R +LLS  ++   A+
Sbjct: 3   FIALEGIEGAGKSTQLTFIQQLLQSAGKNVVVTREPGGTLLGEQIRELLLSPRLESMSAD 62

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR++HV+ VI PAL  GK +LCDRF  +SYAYQG         + +L+  ++
Sbjct: 63  TELLLMFAARVEHVQQVILPALAAGKWILCDRFTSASYAYQGGGRKLPLSRIATLESWAL 122

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD  ++ D+P  +GL+R   R        LD FE++ +   ++ R  +L +A+  P
Sbjct: 123 NGLRPDLILLFDVPARLGLQRAATR-----CQQLDRFEQEKIDFFDRVRMTYLSLAKRYP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
            +  ++DS+     V   I  ++
Sbjct: 178 AQYCLIDSSLPLLKVQEAIQKVM 200


>gi|116491390|ref|YP_810934.1| thymidylate kinase [Oenococcus oeni PSU-1]
 gi|290890956|ref|ZP_06554020.1| hypothetical protein AWRIB429_1410 [Oenococcus oeni AWRIB429]
 gi|122276428|sp|Q04E53|KTHY_OENOB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|116092115|gb|ABJ57269.1| thymidylate kinase [Oenococcus oeni PSU-1]
 gi|290479355|gb|EFD88015.1| hypothetical protein AWRIB429_1410 [Oenococcus oeni AWRIB429]
          Length = 213

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 126/214 (58%), Gaps = 11/214 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-TREPGGTPAAEAARHVLLSCGV 59
           M  G FI+ EG +GAGKT+ +  L   L+    D  + TREPGG   +EA R ++L    
Sbjct: 1   MKKGFFITIEGPDGAGKTSLLDNLMPALRDIFGDNLIETREPGGVRISEAIRKIVLGLKY 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            E     EA++FAAAR  H+   I PAL +GKI+L DRF+DSS AYQG     + L +++
Sbjct: 61  PEMNRRTEALLFAAARAQHMVEKIEPALADGKIVLSDRFVDSSIAYQG---GGRELGIEA 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           + EI   +   + P+ T++LDLP ++G+ R+        S  ++  ++  ++ H+K RQ 
Sbjct: 118 VGEINNFATNGLQPNLTLLLDLPSEVGIARIMK----HRSDEVNRLDKDRLVFHKKVRQT 173

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +L +A++QP+R  ++D+  S + +A N L ++ E
Sbjct: 174 YLQLAKDQPNRIKVLDATQSPEKIAINALQLIQE 207


>gi|258405528|ref|YP_003198270.1| thymidylate kinase [Desulfohalobium retbaense DSM 5692]
 gi|257797755|gb|ACV68692.1| thymidylate kinase [Desulfohalobium retbaense DSM 5692]
          Length = 215

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 117/205 (57%), Gaps = 1/205 (0%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T  +LL ++L+   ++V  TREPGG+   +  R +LLS    +   
Sbjct: 1   MFITFEGIEGCGKSTQSTLLAQWLKNHGWEVQTTREPGGSRLGQNLRSILLSMESRDLTG 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E+E  ++ A R  HV   I+PAL +G ++L DRF DS+  YQG         L +L +++
Sbjct: 61  ESELFLYLADRAQHVHQTIKPALDKGAVVLSDRFADSTVVYQGYGRGLDPNLLHTLNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNR-YSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           VQ V PD T++ DLPV++GLKR   R +   ++     FE + +  H + R+ +L  A  
Sbjct: 121 VQGVWPDLTLLFDLPVELGLKRAMARNFQDNKTEQEGRFEAESLAFHSRVREGYLTWAAL 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
             +R  +VD+    +++   +  I+
Sbjct: 181 NKNRFQVVDAEPDPETIFNEVQRIL 205


>gi|23336149|ref|ZP_00121376.1| COG0125: Thymidylate kinase [Bifidobacterium longum DJO10A]
 gi|189440137|ref|YP_001955218.1| thymidylate kinase [Bifidobacterium longum DJO10A]
 gi|238692075|sp|B3DUA1|KTHY_BIFLD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|189428572|gb|ACD98720.1| Thymidylate kinase [Bifidobacterium longum DJO10A]
          Length = 206

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 126/215 (58%), Gaps = 15/215 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-- 60
           SGLF+SFEG++G GKTT +  L+ +L+ +   V VTREPGGT   +A R +LL  GVD  
Sbjct: 2   SGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAIRQLLLH-GVDGG 60

Query: 61  --EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFL 117
             +    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +    +
Sbjct: 61  AVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPE-EI 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            SL   +   ++PD T +LD+   +   R+++     ESA  D+  R         RQ F
Sbjct: 120 RSLSMWATNNLLPDRTYLLDMDPALSHNRLEHAEDRMESAGSDFQSRT--------RQAF 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD+A  +P+R  ++D++ S ++V   I + + EL 
Sbjct: 172 LDLAAAEPNRFRVIDASQSIEAVWAAIESDIKELA 206


>gi|82702516|ref|YP_412082.1| thymidylate kinase [Nitrosospira multiformis ATCC 25196]
 gi|123544544|sp|Q2Y981|KTHY_NITMU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|82410581|gb|ABB74690.1| thymidylate kinase [Nitrosospira multiformis ATCC 25196]
          Length = 205

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 122/204 (59%), Gaps = 13/204 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EGI+GAGKTTH+  L+ FL+ +  +V VTREPGGTP  EA R +LL        
Sbjct: 3   GKFITLEGIDGAGKTTHLRWLEYFLKERGKNVMVTREPGGTPLGEALRDILLDS-RQTMH 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE EA++  AAR +H++ VI PAL  G+ ++ DRF D+S+AYQG     + L L  L E+
Sbjct: 62  AETEALLMFAARREHLDKVILPALSRGEWVISDRFTDASFAYQG---GGRGLSLQKLNEL 118

Query: 124 S--VQ-EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              VQ E  PD T+ LD+ +  G +R  N   +R++   D FE++      + R+ +L+ 
Sbjct: 119 ECWVQGEFQPDVTLYLDVSIASGRQRTSN---IRQA---DRFEKEQDEFFRRVREAYLER 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A+  P+R  ++D+  S + V  ++
Sbjct: 173 AKEFPERIRVIDANQSLEDVRRSV 196


>gi|27262450|gb|AAN87506.1| Thymidylate kinase [Heliobacillus mobilis]
          Length = 241

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 117/216 (54%), Gaps = 13/216 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+ EG +GAGKTT  +LL +  +   Y V  TREPGGTP  EAAR VLL   +    
Sbjct: 31  GLFITLEGADGAGKTTQGALLAQAFRALQYPVLETREPGGTPVGEAARRVLLDPSLTGMA 90

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE  ++AAAR   +  VI PAL  G +++CDRF DS+ AYQG     + L +D LQ I
Sbjct: 91  PMAEVFLYAAARAQLIREVILPALAAGTVVICDRFTDSTLAYQG---YGRGLDMDRLQSI 147

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              + + + PD T++LD+  D GL R + + +       D  E +    H+K R  FL++
Sbjct: 148 NHWATEGLAPDLTLLLDIDSDEGLSRARRKGA-------DRMEMETAAFHQKVRHGFLEL 200

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           A  +  R  ++ +      V   ++N V E V + V
Sbjct: 201 AAKETSRIRVIPAGRDIFEVHRQVINAVREKVPELV 236


>gi|295402004|ref|ZP_06811966.1| thymidylate kinase [Geobacillus thermoglucosidasius C56-YS93]
 gi|294976006|gb|EFG51622.1| thymidylate kinase [Geobacillus thermoglucosidasius C56-YS93]
          Length = 210

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 123/215 (57%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F SFEG EGAGKTT I++L+ FL+ K +DV  TREPGG   AE  R ++L+    E  
Sbjct: 3   GRFFSFEGPEGAGKTTMIAMLESFLREKGFDVLATREPGGVRIAEEIRSIILNPAHTEMD 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA+++AAAR  H+   I PA+  GKI+LCDRF+DSS AYQG    ++ L +D + +I
Sbjct: 63  GRTEALLYAAARRQHLLEKIIPAVKSGKIVLCDRFIDSSLAYQG---FARELGMDEILQI 119

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              ++    P  TI  D+   IGL+R+Q     RE   LD    +++  H K R+ +L +
Sbjct: 120 NQFAIDGYFPTLTIYFDIDPKIGLERIQKNKQ-REMNRLDM---ENLSFHYKVREGYLKL 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A+   DR   +D++ S   V    +  + + + +R
Sbjct: 176 AKRFSDRIITIDASKSVDEVFAMTVAAIMDRIGER 210


>gi|330994629|ref|ZP_08318552.1| Thymidylate kinase [Gluconacetobacter sp. SXCC-1]
 gi|329758270|gb|EGG74791.1| Thymidylate kinase [Gluconacetobacter sp. SXCC-1]
          Length = 213

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 119/214 (55%), Gaps = 7/214 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEG EGAGK+T   LL   L+   +DV +TREPGGT AAEA R  LL  G D   
Sbjct: 3   GLFITFEGGEGAGKSTQARLLADHLRAHGHDVDLTREPGGTEAAEALRDFLLFGGHD-LS 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDS-SQHLFLDSLQE 122
           A AE +   AAR DHV+  I PAL +G+I++CDRF DS+ AYQG   S +    LD + +
Sbjct: 62  ARAEVLTHFAARADHVDRRILPALAQGRIVVCDRFADSTEAYQGYGVSHADTGLLDMIGQ 121

Query: 123 I-SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + ++  V PD T +L +P D+   R++ R   R     D +E +D   H +    F  IA
Sbjct: 122 LRAMLPVQPDLTFVLQVPPDVARDRLRQRADGRA----DRYEAEDAAFHARVAAGFDAIA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           R    RCH +D++     V   I  ++   +  R
Sbjct: 178 RRDAARCHRIDASGDAGGVQQAIRAVLAPRLAGR 211


>gi|308271741|emb|CBX28349.1| Thymidylate kinase [uncultured Desulfobacterium sp.]
          Length = 216

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 117/202 (57%), Gaps = 1/202 (0%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG+GKTT I     FL++K  D  +TREPGGT   +  R +LL    +    
Sbjct: 11  MFITFEGIEGSGKTTQIRHAMEFLKQKGKDCLMTREPGGTITGQKIRSILLDPESNGMDP 70

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E +++ A R +HV  +I PAL  GK +LCDR+ D++ AYQG         LD L ++ 
Sbjct: 71  STELLLYFADRAEHVNKIINPALSAGKTVLCDRYYDATKAYQGFARGLNMDLLDRLHKLI 130

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDY-FERKDVMIHEKRRQIFLDIARN 183
           + ++ PD TI+LDL    GL R   + +  + A ++  FE++ +  H+K R  +L++AR 
Sbjct: 131 IHDLKPDITILLDLDPKTGLSRAWKQINEGQRAGVETRFEKETLDFHDKVRNGYLELARI 190

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
           +  R  I+D+++    V  +I+
Sbjct: 191 EAKRFKIIDASNDENQVKKDII 212


>gi|149201816|ref|ZP_01878790.1| thymidylate kinase [Roseovarius sp. TM1035]
 gi|149144864|gb|EDM32893.1| thymidylate kinase [Roseovarius sp. TM1035]
          Length = 208

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 116/207 (56%), Gaps = 6/207 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLF+SFEGI+G+GK+T    L   L+ K  DV +TREPGG+P AE  R ++L    D 
Sbjct: 3   GQGLFLSFEGIDGSGKSTQARRLAETLRAKGRDVVLTREPGGSPGAEEIRRLVLEGDKDR 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E VI PAL  G +++CDRF DS+  YQG   +     +D L 
Sbjct: 63  WSAETEILLFTAARRDHLERVIAPALARGAVVICDRFADSTRMYQGLGRADLRGIVDQLH 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD T+++D+   +GL R  +R    + A  + F      +  + R  FL ++
Sbjct: 123 ALMIGR-EPDLTVLIDIDPGVGLGRALSRGG--DEARFESFGEG---MQARMRTGFLALS 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           +  P R  ++D A    +VA ++  +V
Sbjct: 177 QEFPARFTVIDGARDMDAVAEDVARVV 203


>gi|159043474|ref|YP_001532268.1| dTMP kinase [Dinoroseobacter shibae DFL 12]
 gi|254808289|sp|A8LRW0|KTHY_DINSH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|157911234|gb|ABV92667.1| dTMP kinase [Dinoroseobacter shibae DFL 12]
          Length = 207

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 110/204 (53%), Gaps = 6/204 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             G  ISFEGI+G+GK+T    L   L+    D  +TREPGG+P AE  R +L+    D 
Sbjct: 3   QPGRLISFEGIDGSGKSTQARRLAEHLRDTGRDPLLTREPGGSPGAEDIRRLLVEGDPDR 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +  E E ++F AAR DH+E +I+PAL EG+ ++ DRF DS+  YQG         +D L 
Sbjct: 63  WSPETELLLFTAARRDHLERLIQPALAEGRDVITDRFADSTRVYQGATRGDLRALVDQLH 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD T ++D+P ++ L R      L  ++  D FE   +      R  FLD+A
Sbjct: 123 SLMIGR-EPDLTFVIDMPPELALTR-----GLARASGEDRFEEFGLPFQTALRAGFLDLA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNIL 205
           R  PDRC ++D       VA +++
Sbjct: 177 RANPDRCVVIDGNRPEAEVAADVI 200


>gi|294083926|ref|YP_003550683.1| thymidylate kinase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663498|gb|ADE38599.1| thymidylate kinase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 214

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 121/215 (56%), Gaps = 7/215 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           SG+ I+FEG EG+GKTT I  L ++L+ +  N ++ VTREPGGT  AE  R +L+    D
Sbjct: 2   SGILITFEGGEGSGKTTQIQSLVKWLESEFSNTELVVTREPGGTEGAELIRDLLVRGASD 61

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +    EA++ +A+R +H++NVI PAL + KI++ DRF DS+  YQG         + +L
Sbjct: 62  RWQPITEALLMSASRHEHIKNVIEPALAQNKIVISDRFFDSTTIYQGIVGGVDAQAVATL 121

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +++   V+PD T ++D+   +GL R  NR           FE K +  H+K R  FL +
Sbjct: 122 TKLACGNVIPDLTFLMDMDAKVGLARAGNRDDDET-----RFEEKGLSFHQKVRDAFLKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A    +R  IVD+  +   +A  I N V  LV  +
Sbjct: 177 AHMNENRFVIVDATKTTSEIADIIRNKVATLVAMK 211


>gi|254283811|ref|ZP_04958779.1| thymidylate kinase [gamma proteobacterium NOR51-B]
 gi|219680014|gb|EED36363.1| thymidylate kinase [gamma proteobacterium NOR51-B]
          Length = 208

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 121/211 (57%), Gaps = 6/211 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G F++ EG EG GK+T++  + + L+ +  D+ VTREPGGTP AEA R +L+S   D
Sbjct: 1   MKPGQFLTVEGGEGVGKSTNLDFIAKTLRAQGIDLVVTREPGGTPLAEALRALLISDSED 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AE ++  AAR  H+  VI PAL  G+ +LCDRF D+++AYQG     +   +++L
Sbjct: 61  PPCPNAELLMIFAARAQHLSTVIEPALKAGRWVLCDRFTDATFAYQGAGRGIEWSSIETL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +   +  PD T++LD+   IG+ R  +R        LD FER+ +   ++ R+ +   
Sbjct: 121 ENLIQGDRRPDLTLLLDMEPAIGMDRAGSR------GALDRFEREALPFFDRVRRGYKTR 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
           A   P R  ++D++ S  +V  +I  ++ EL
Sbjct: 175 AAQAPHRYRVIDASQSIDAVQRDIARVLAEL 205


>gi|297566850|ref|YP_003685822.1| thymidylate kinase [Meiothermus silvanus DSM 9946]
 gi|296851299|gb|ADH64314.1| thymidylate kinase [Meiothermus silvanus DSM 9946]
          Length = 202

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 122/207 (58%), Gaps = 20/207 (9%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG--GTPAAEAARHVLLSCGVD 60
           SG FI+FEG EGAGK+T + LL  +L+ +  +V +TREPG  G    E  R VLLS   +
Sbjct: 2   SGWFITFEGPEGAGKSTQVKLLAPWLEAQGREVVLTREPGNGGWLGVEVRRLVLLS---E 58

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               EAE ++++A R +HV  VI PAL  GK++LCDR+LDSS AYQG     + L L  L
Sbjct: 59  PMSPEAEYLLYSADRAEHVRRVIAPALAAGKVVLCDRYLDSSLAYQG---YGRGLDLGWL 115

Query: 121 QEISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           + ++V   Q + P  T +LDLP ++GL R   R         D  ER+ +  H++ R  +
Sbjct: 116 RAVAVGVTQGLKPHRTFLLDLPPEVGLARFAGR---------DRLEREPLEFHQRVRAGY 166

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNI 204
           L++A+ +P R  ++D+  S +++   +
Sbjct: 167 LELAKAEPQRFVVLDATQSPEAIQAEL 193


>gi|229917431|ref|YP_002886077.1| thymidylate kinase [Exiguobacterium sp. AT1b]
 gi|259494270|sp|C4KZW9|KTHY_EXISA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229468860|gb|ACQ70632.1| thymidylate kinase [Exiguobacterium sp. AT1b]
          Length = 212

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 120/215 (55%), Gaps = 12/215 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG+FI+ EG +G+GK+T + LL   L++K YD+ VTREPGGT      R VLLS    E 
Sbjct: 2   SGMFITVEGPDGSGKSTQLQLLVENLKQKGYDIVVTREPGGTTVGNQIREVLLSPDHHEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG---ERDSSQHLFLDS 119
               E +++AA+R  +VE VIRPAL  G I+LCDRF+D+S AYQG   + D  Q   + S
Sbjct: 62  TPRVEMMLYAASRAQNVEQVIRPALERGAIVLCDRFIDASIAYQGYGLQYDLDQ---IRS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L E +   + PD T + DL  +    R+++R        LD  E +D   HE+    F  
Sbjct: 119 LNEWATNGLTPDLTFLFDLNPERASARMKDR------GQLDRIESRDQAFHERVYAGFQT 172

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R   +D+  S + +   +L+   E +Q+
Sbjct: 173 LLKQYPERIVRIDADQSIECIQDEVLDYTIERLQQ 207


>gi|218781657|ref|YP_002432975.1| dTMP kinase [Desulfatibacillum alkenivorans AK-01]
 gi|218763041|gb|ACL05507.1| dTMP kinase [Desulfatibacillum alkenivorans AK-01]
          Length = 220

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 124/223 (55%), Gaps = 9/223 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+ EGIEGAGKTT +  +  F++ + Y+   TREPGGT      R +LL+       
Sbjct: 5   GVFITLEGIEGAGKTTQVGRILEFMESQGYECISTREPGGTGIGAKIRAILLNSEHVTLA 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++ A R  H+  +I+PAL  GK ++CDRF D++ AYQG        F++ L   
Sbjct: 65  PLAELLLYEADRAQHLARLIKPALEAGKCVVCDRFCDATTAYQGYARELSLDFINELHAR 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD-YFERKDVMIHEKRRQIFLDIAR 182
            +  + PD T++ DLP +IGL R + R   + +   +  FE +D+  H K RQ +L +A+
Sbjct: 125 ILDGLTPDLTLLFDLPAEIGLSRAKTRLHEQNNTSQEGRFEAEDLAFHRKVRQGYLTLAK 184

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225
            +P R  IV+        A    + VWE  ++ ++  ++K+++
Sbjct: 185 AEPGRFAIVN--------ADAAPDRVWEETKELLAEFTAKRNL 219


>gi|126729338|ref|ZP_01745152.1| thymidylate kinase [Sagittula stellata E-37]
 gi|126710328|gb|EBA09380.1| thymidylate kinase [Sagittula stellata E-37]
          Length = 212

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (54%), Gaps = 14/217 (6%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +SGLF+SFEGI+G+GK+T   +L   L        +TREPGG+P AE  R ++L    D 
Sbjct: 6   HSGLFLSFEGIDGSGKSTQARMLAERLSADGMTALLTREPGGSPGAEEIRALVLQGDPDR 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE---RDSSQHLFLD 118
           +  E E ++F AAR DH+E  IRPAL  G++++CDRF DS+  YQG    RD+     +D
Sbjct: 66  WSPETELLLFTAARRDHMERTIRPALTRGEVVICDRFADSTRLYQGRQGLRDT-----VD 120

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            L  + +  + PD TIILD+  + GL R + R +  E      FE   + +  + R  FL
Sbjct: 121 KLHNLMIG-MEPDLTIILDMDPEAGLSRAKARATAEER-----FEDFGIALQLQMRAGFL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            ++   P R  ++D     + VA +I   V E +  R
Sbjct: 175 ALSEEFPARIRVIDGNRRPEYVAADIHATVMEALDAR 211


>gi|84686498|ref|ZP_01014391.1| thymidylate kinase [Maritimibacter alkaliphilus HTCC2654]
 gi|84665411|gb|EAQ11888.1| thymidylate kinase [Rhodobacterales bacterium HTCC2654]
          Length = 207

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 108/191 (56%), Gaps = 6/191 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+FEGI+G+GK+T   LL   L+ +  DV  TREPGG+P AE  R ++L    D +
Sbjct: 2   TGHFITFEGIDGSGKSTQARLLAEALKAEGRDVVATREPGGSPGAEEIRRLVLEGDPDRW 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE E ++F AAR DH+E +I P+L  GKI++CDRF DS+  YQG R       +D L  
Sbjct: 62  SAETEILLFTAARRDHLERLIDPSLAAGKIVICDRFADSTRMYQGLRGPGLRKVVDDLHR 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +    PD T I+D+    G  R + R    E      FE     +  + R+ FL +A+
Sbjct: 122 LMIGR-EPDLTFIIDMDPTTGHARAKGRNGTEE-----RFEDFGADLQVQMREGFLALAK 175

Query: 183 NQPDRCHIVDS 193
            +P RC ++D 
Sbjct: 176 AEPGRCVVIDG 186


>gi|303257416|ref|ZP_07343429.1| dTMP kinase [Burkholderiales bacterium 1_1_47]
 gi|302859773|gb|EFL82851.1| dTMP kinase [Burkholderiales bacterium 1_1_47]
          Length = 202

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 118/205 (57%), Gaps = 11/205 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+T   ++   L+ +  D   TREPGG  +AE  R +LL+   +   
Sbjct: 5   GKFITVEGVDGAGKSTQFEVIANALKERGIDFVRTREPGGPQSAEKIRELLLN---EPMT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+ E +V  AAR +++  +IRPAL  GK +LCDRF D+S AYQG         ++ L   
Sbjct: 62  AKCELLVMFAARQENLTKIIRPALEAGKWVLCDRFTDASVAYQGYGRGRSLEEIEMLANF 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T+I DLP ++   R+  +        LD FE++D   H + RQ +L+IA+ 
Sbjct: 122 VHPDIKPDKTVIFDLPTEVAAARLSRK--------LDRFEQEDADFHRRVRQGYLEIAKR 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +P+RC ++D+  + + V+  +L  V
Sbjct: 174 EPERCVVIDAQGTPEEVSARVLKEV 198


>gi|296453337|ref|YP_003660480.1| dTMP kinase [Bifidobacterium longum subsp. longum JDM301]
 gi|296182768|gb|ADG99649.1| dTMP kinase [Bifidobacterium longum subsp. longum JDM301]
          Length = 233

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 128/220 (58%), Gaps = 15/220 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-- 60
           SGLF+SFEG++G GKTT +  L+ +L+ +   V VTREPGGT   +A R +LL  GVD  
Sbjct: 2   SGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAIRQLLLH-GVDGG 60

Query: 61  --EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFL 117
             +    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +    +
Sbjct: 61  AVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPE-EI 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            SL   +   ++PD T +LD+   +   R+++     ESA   +  R         RQ F
Sbjct: 120 RSLSMWATNNLLPDRTYLLDMDPVLSHNRLEHAEDRMESAGSGFQSRT--------RQAF 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           LD+A  +P+R H++D++ S + V + I   +  L++  V+
Sbjct: 172 LDLAAAEPNRFHVIDASQSIEQVWSAIEADIQTLLRDNVA 211


>gi|171463583|ref|YP_001797696.1| dTMP kinase [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193121|gb|ACB44082.1| dTMP kinase [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 211

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 125/213 (58%), Gaps = 22/213 (10%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           ++G FISFEGI+GAGK+THI   +  +Q +  N +V +TREPGGT   E  R++LL   +
Sbjct: 4   HTGYFISFEGIDGAGKSTHIDAFRNLIQERYPNIEVVMTREPGGTVLGEQLRNLLLDTPM 63

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +    E EA++  AAR +H+  VI+PAL  GKI++ DRF D+S+AYQG     + L L  
Sbjct: 64  N---LETEALLMFAARREHLSQVIKPALTAGKIIISDRFTDASFAYQG---GGRGLSLAK 117

Query: 120 LQEIS--VQE------VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHE 171
           L ++   VQ       + P+ TI+ DLP DI   R    ++       D FE+ D+   E
Sbjct: 118 LNDLERWVQGQPDGSILQPNLTILFDLPGDIAEARRSKVHT------PDKFEKMDLSFFE 171

Query: 172 KRRQIFLDIARNQPDRCHIVDSAHSFQSVATNI 204
           + RQ +L  A++ PDR H+VD+  + +++   +
Sbjct: 172 RVRQEYLRRAKDDPDRFHLVDATQTPEAIWNGL 204


>gi|331005272|ref|ZP_08328664.1| Thymidylate kinase [gamma proteobacterium IMCC1989]
 gi|330420949|gb|EGG95223.1| Thymidylate kinase [gamma proteobacterium IMCC1989]
          Length = 211

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F++ EG EG GK+T+I+ ++ +L  +  +V  TREPGGTP AE  R +LL    ++  
Sbjct: 8   GKFLTIEGTEGVGKSTNIAYIQSYLTSQGIEVLTTREPGGTPLAEDIRELLLQNRDEKMD 67

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE ++  AAR  H++ VI PAL  G+ +LCDRF D++YAYQG         ++ L++ 
Sbjct: 68  ETAELLLVFAARAQHLQTVILPALERGQWVLCDRFTDATYAYQGGGRGLDLALIEMLEQR 127

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T++LD+ V IGL+R   R        LD FE + V   EK R  +L  A  
Sbjct: 128 IQGDIRPDLTLLLDIDVTIGLERAGRR------GELDRFEHEHVAFFEKVRHAYLARAAT 181

Query: 184 QPDRCHIVDSAHSFQSVATNI 204
            P+R  +VD++ S + V   +
Sbjct: 182 FPERYGVVDASQSLEQVQLQV 202


>gi|120602139|ref|YP_966539.1| dTMP kinase [Desulfovibrio vulgaris DP4]
 gi|166221739|sp|A1VCE6|KTHY_DESVV RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|120562368|gb|ABM28112.1| thymidylate kinase [Desulfovibrio vulgaris DP4]
          Length = 224

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG+GK+T +  L  +LQ+  + V VTREPGG+      R +LL  G  +   
Sbjct: 1   MFITFEGIEGSGKSTALQGLAAWLQQHGHGVAVTREPGGSRLGRTLRSILLDLGNTDITP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           EAE  ++ A R  HV  V+RPAL EG ++L DR+ DS+  YQG       + L    +++
Sbjct: 61  EAELFLYLADRAQHVAQVVRPALDEGMVVLSDRYADSTVVYQGYGRGLDPMMLRQFNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRES--ACLDYFERKDVMIHEKRRQIFLDIAR 182
           V  + PD TI+LDL  + GL R   R ++RE   A    FE + +  H + R+ +L  A 
Sbjct: 121 VGGLWPDLTILLDLEPEAGLNRALAR-NIREGMHAAEGRFEAESLAFHTRVREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
               R  +VD+  S + V  +++ IV
Sbjct: 180 LHGGRYRVVDATQSPEDVVRDVVGIV 205


>gi|312109177|ref|YP_003987493.1| thymidylate kinase [Geobacillus sp. Y4.1MC1]
 gi|311214278|gb|ADP72882.1| thymidylate kinase [Geobacillus sp. Y4.1MC1]
          Length = 210

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 123/215 (57%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F SFEG EGAGKTT I++L+ FL+ K +DV  TREPGG   AE  R ++L+    E  
Sbjct: 3   GRFFSFEGPEGAGKTTMIAMLESFLREKGFDVLATREPGGVRIAEEIRSIILNPAHTEMD 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA+++AAAR  H+   I PA+  GKI+LCDRF+DSS AYQG    ++ L +D + +I
Sbjct: 63  GRTEALLYAAARRQHLLEKIIPAVKSGKIVLCDRFIDSSLAYQG---FARELGMDEILQI 119

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              ++    P  TI  D+   +GL+R+Q     RE   LD    +++  H K R+ +L +
Sbjct: 120 NQFAIDGYFPTLTIYFDIDPKMGLERIQKNKQ-REMNRLDM---ENLSFHYKVREGYLKL 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A+   DR   +D++ S   V    +  + + + +R
Sbjct: 176 AKRFSDRIITIDASKSVDEVFAMTVAAIMDRIGER 210


>gi|16801901|ref|NP_472169.1| thymidylate kinase [Listeria innocua Clip11262]
 gi|23821794|sp|Q927E8|KTHY_LISIN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|16415376|emb|CAC98067.1| lin2841 [Listeria innocua Clip11262]
          Length = 208

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + ++    D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMEEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD +    L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  I + 
Sbjct: 123 AIEDTIPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQNGYEKIIQM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            PDR   VD+  + + + T IL
Sbjct: 179 FPDRFMRVDATKTPEEITTIIL 200


>gi|291517602|emb|CBK71218.1| thymidylate kinase [Bifidobacterium longum subsp. longum F8]
          Length = 206

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 126/215 (58%), Gaps = 15/215 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-- 60
           SGLF+SFEG++G GKTT +  L+ +L+ +   V VTREPGGT   +A R +LL  GVD  
Sbjct: 2   SGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAIRQLLLH-GVDGG 60

Query: 61  --EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFL 117
             +    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +    +
Sbjct: 61  AVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPE-EI 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            SL   +   ++PD T +LD+   +   R+++     ESA  D+  R         RQ F
Sbjct: 120 RSLSMWATNNLLPDRTYLLDMDPALSHHRLEHAEDRMESAGDDFQSRT--------RQAF 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD+A  +P+R  ++D++ S ++V   I + + EL 
Sbjct: 172 LDLAAAEPNRFRVIDASQSIEAVWAAIESDIKELA 206


>gi|77460373|ref|YP_349880.1| thymidylate kinase [Pseudomonas fluorescens Pf0-1]
 gi|123603687|sp|Q3K8L5|KTHY_PSEPF RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|77384376|gb|ABA75889.1| thymidylate kinase [Pseudomonas fluorescens Pf0-1]
          Length = 210

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 116/212 (54%), Gaps = 8/212 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE- 61
           +GLFI+ EG EGAGK+T+   L   L+    +V +TREPGGTP AE  R VLL+  VDE 
Sbjct: 2   TGLFITLEGPEGAGKSTNREYLAERLRAAGIEVVLTREPGGTPLAERIREVLLAP-VDEV 60

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              + E ++  AAR  H+  VIRPAL  G ++LCDRF DS+YAYQG         + +L+
Sbjct: 61  MNPDTELLLVFAARAQHLAEVIRPALARGAVVLCDRFTDSTYAYQGGGRGLSLERIAALE 120

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
                ++ PD T+I DLPV+IGL R   R        LD FE +     E  R  FL  A
Sbjct: 121 TFVQGDLRPDLTLIFDLPVEIGLARASAR------GRLDRFELEGREFFEAVRNAFLKRA 174

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            + P R   +D+      V  ++  ++  L++
Sbjct: 175 EDDPARYVRIDAGQPLVKVQQSLDTLIPNLLE 206


>gi|114320572|ref|YP_742255.1| thymidylate kinase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311744|sp|Q0A8S2|KTHY_ALHEH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|114226966|gb|ABI56765.1| thymidylate kinase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 217

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG+EGAGK+T ++ ++ +LQR+  D  +TREPGGTP  E  R +LL     
Sbjct: 1   MTRGRFITLEGLEGAGKSTALTRVREYLQRQGIDAVMTREPGGTPLGERIRALLLGQSEP 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA++  AAR +H++  I PAL  G+ ++CDRF D+SYAYQG         + +L
Sbjct: 61  PMAPATEALLMFAARSEHLDKRIWPALERGQWVVCDRFTDASYAYQGWGRGLGAERIAAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++ +   + PD T+ LD+PV+ GL R   R         D FE++     E+  + +  +
Sbjct: 121 EDWTQGALRPDLTLWLDVPVETGLARAAGR-----GEAPDRFEQERDGFFERVHEGYAAL 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A   P+R   VD+    ++V T +
Sbjct: 176 AERFPERIRRVDAGQPLEAVLTAL 199


>gi|308176312|ref|YP_003915718.1| dTMP kinase [Arthrobacter arilaitensis Re117]
 gi|307743775|emb|CBT74747.1| dTMP kinase [Arthrobacter arilaitensis Re117]
          Length = 217

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 119/204 (58%), Gaps = 4/204 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI FEG +GAGKTT +++ +++L+ +   V  TREPGGT  +E  R ++L  G  E  
Sbjct: 11  GLFIVFEGGDGAGKTTQVAMAQQWLESRGATVRTTREPGGTQISEELRSLVLEHGHGEID 70

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA++++AAR  HV+ VIRP+L  G  ++CDRF+DSS AYQG         + S+ + 
Sbjct: 71  ARTEALIYSAARAAHVQQVIRPSLEAGTHIICDRFVDSSLAYQGMGRELGFAAVASINDF 130

Query: 124 SVQEVMPDCTIILDLPVDIG-LKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +   + PD TIILD+  + G  +R+     + +S   D  E +    HE+ R  FL++A 
Sbjct: 131 ATGGLKPDVTIILDISAEHGRARRIAASGGVEDS---DRLEAEPDDFHERIRNAFLELAA 187

Query: 183 NQPDRCHIVDSAHSFQSVATNILN 206
             P R  ++D+  S + +  +I+ 
Sbjct: 188 QDPQRYLVLDATASVEQLHQSIVE 211


>gi|114330554|ref|YP_746776.1| dTMP kinase [Nitrosomonas eutropha C91]
 gi|122314450|sp|Q0AIL5|KTHY_NITEC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|114307568|gb|ABI58811.1| thymidylate kinase [Nitrosomonas eutropha C91]
          Length = 215

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 117/208 (56%), Gaps = 7/208 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEGI+GAGK+TH++ L  FL+ K  +V VTREPG T   E  R +LL     
Sbjct: 1   MQRGKFITFEGIDGAGKSTHLAWLASFLRDKGLEVIVTREPGSTALGEQLRQLLLDH-RQ 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              AE E ++  AAR +H++ VI PAL  G  ++ DRF D+S+AYQG         L+ L
Sbjct: 60  AMHAETETLLMFAARREHLDKVILPALERGAWVISDRFTDASFAYQGGGRGVPSARLEIL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++   +   PD T+  D+PV I  +RVQ+      +   D FE +  +  E+ RQ +L  
Sbjct: 120 EQWVQKGFSPDLTVYFDVPVTISRQRVQS------ARTADRFELEPDLFFERVRQAYLQR 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A+   +R  +VD + S + V T ++ +V
Sbjct: 174 AKQFSERIRVVDGSLSLEEVRTAMVEVV 201


>gi|206891148|ref|YP_002248232.1| thymidylate kinase [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206743086|gb|ACI22143.1| thymidylate kinase [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 209

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN G+FI+FEGIEG+GKTT   LL   L+++   V  T EPG T A    R +LL+  + 
Sbjct: 1   MNKGIFITFEGIEGSGKTTQGKLLAEKLKKEGLKVLYTYEPGDTEAGRHIRKILLNSEI- 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E +++ A R+ H+E  I+P +  G I++CDRF DS+  YQG         +  L
Sbjct: 60  KINPLCELLLYFADRVQHIEEKIKPCIESGFIVICDRFTDSTLVYQGYARGISIDLIKQL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +I + E MPD T++LD P +IGLKR Q           D FE +++  HEK RQ +L +
Sbjct: 120 NKIVLDEFMPDLTVLLDCPANIGLKRNQKINK------KDRFEMENLAFHEKVRQGYLKL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A     R  ++D+  S   +A +I
Sbjct: 174 AELYKKRFFVLDATESIDKIAEDI 197


>gi|225166283|ref|ZP_03727978.1| dTMP kinase [Opitutaceae bacterium TAV2]
 gi|224799474|gb|EEG18008.1| dTMP kinase [Opitutaceae bacterium TAV2]
          Length = 234

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 128/216 (59%), Gaps = 11/216 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-SCGVDE 61
           +G  IS EG EG GK+T I+ L + +Q    DV  TREPGGT   E  R++++ +   DE
Sbjct: 9   TGKLISLEGPEGCGKSTQIARLAKHIQLLGRDVFCTREPGGTEIGEQVRNIIVHNSKGDE 68

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS-- 119
             AE E ++FAA+R   V  VI P L+ G+I+L DRFLDSS  YQG    +++L +D   
Sbjct: 69  MCAETELLLFAASRAQLVREVIAPRLLRGEIVLSDRFLDSSTVYQG---VARNLAMDPVN 125

Query: 120 -LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            + + +V  VMPD TIILD+P ++ L R+ NR   R S   D  ER+++  + K R+ +L
Sbjct: 126 LINQFAVGNVMPDLTIILDVPPEVSLARI-NR---RASDLPDRMERENIDFYHKVREGYL 181

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            +A++ P    ++D   +   VA +I + V +L+ K
Sbjct: 182 FLAKSLPRAFLVLDGTQTEDEVAKHIWDEVLKLITK 217


>gi|78357381|ref|YP_388830.1| thymidylate kinase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123552103|sp|Q30YW1|KTHY_DESDG RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|78219786|gb|ABB39135.1| thymidylate kinase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 212

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG+GK+T ++ LK +LQ   +   +TREPGG+      R +LL  G D+   
Sbjct: 1   MFITFEGIEGSGKSTALARLKDWLQEHGHGATLTREPGGSRLGGILRSILLDIGNDDLTG 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E E  ++ A R  HV  VIRPAL EG  ++ DR+ DS+  YQG         L  L +++
Sbjct: 61  ETELFLYLADRSQHVHQVIRPALAEGVAVISDRYADSTVVYQGYGRGLDPALLHRLNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRE--SACLDYFERKDVMIHEKRRQIFLDIAR 182
           V+ + PD T++ DL  +IGLKR   R +LRE   A    FE + +  H + R+ +L  A 
Sbjct: 121 VRGLWPDLTLLFDLEPEIGLKRATTR-NLREGTGATEGRFEAESLAFHTRVREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHS----FQSVATNILNI 207
              +R  I+D+A S    F+ V + + ++
Sbjct: 180 LNKERFRIIDAAASPDEVFEQVRSAVADV 208


>gi|197119572|ref|YP_002139999.1| thymidylate kinase [Geobacter bemidjiensis Bem]
 gi|229621737|sp|B5E9M9|KTHY_GEOBB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|197088932|gb|ACH40203.1| thymidylate kinase [Geobacter bemidjiensis Bem]
          Length = 225

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/217 (38%), Positives = 122/217 (56%), Gaps = 4/217 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG GKTT + LLK  L+     V VTREPGG P A+  R +LL        
Sbjct: 2   GFFITFEGIEGCGKTTQLRLLKERLEAAGEKVTVTREPGGCPVADQMRAILLDAKNSAIT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++AAAR  HV+ VI PAL  G+ +LCDRF D++ AYQG         ++ L  +
Sbjct: 62  PLAELLLYAAARAQHVQEVIVPALERGETVLCDRFTDATVAYQGHGRGLDLTVIEELNTL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   V P  T+++D PV++GL R   R      A  + FER+ ++ H+K R  +L +A  
Sbjct: 122 ATGRVQPALTVLIDCPVEVGLSRALARIEATSGAKEERFERESLLFHQKVRNGYLTLAAA 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLS 220
            P+R  +VD +   +   T +L  V E +++R+  L 
Sbjct: 182 FPERFVVVDGSGDVRQ--TGLL--VAEALRQRMQSLG 214


>gi|219849803|ref|YP_002464236.1| dTMP kinase [Chloroflexus aggregans DSM 9485]
 gi|219544062|gb|ACL25800.1| dTMP kinase [Chloroflexus aggregans DSM 9485]
          Length = 225

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 123/226 (54%), Gaps = 5/226 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ GLFI+FEG EGAGK+T    L   LQ   Y V +TREPGGT   E  R +L+     
Sbjct: 1   MHRGLFITFEGPEGAGKSTQARRLYERLQAAGYPVILTREPGGTRIGELIRRILIDLRHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     E ++F+AAR   V  +IRP L  G I++CDR+ DS++AYQG         L  +
Sbjct: 61  EMAPTTEILLFSAARAQLVSELIRPYLATGGIVVCDRYADSTFAYQGYGLGRDLEELRVI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRE----SACLDYFERKDVMIHEKRRQI 176
            E++   + PD T  L + V+IGL+R Q+     E     A  +  + +D+  H +    
Sbjct: 121 TEVATGGLKPDLTFYLQIDVEIGLQRKQHARERSERGGQPAEWNRLDARDLAYHRRVMHG 180

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSK 222
           F+++ + +P+R H +D+      +A  I + V  L+  R++PL+++
Sbjct: 181 FVELMKQEPERWHALDADQPVDELAEQIWHAVMPLL-DRITPLATR 225


>gi|126668139|ref|ZP_01739101.1| thymidylate kinase [Marinobacter sp. ELB17]
 gi|126627409|gb|EAZ98044.1| thymidylate kinase [Marinobacter sp. ELB17]
          Length = 209

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 115/209 (55%), Gaps = 6/209 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG GK+T ++     L+    +V VTREPGGTP AEA R +LL+   +   
Sbjct: 5   GRFITFEGTEGMGKSTQLATAAASLRAVGINVLVTREPGGTPMAEAIRELLLAPRDEPVH 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR  H+   I PAL  G+ +LCDRF D+++AYQG    +    +  L+ +
Sbjct: 65  ELTELLLMFAARAQHLHTRILPALTAGQWVLCDRFTDATFAYQGGGRGTPAERIGLLETL 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              E+ PD  ++LD PV+ G+ R + R        LD FE++ V    + R  +L  AR+
Sbjct: 125 VQGELRPDHIVLLDAPVETGMARARKRGE------LDRFEQETVEFFARIRATYLQRARH 178

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            P R HIVD+      V+ ++  +  E+V
Sbjct: 179 DPQRYHIVDAGQPLARVSADVKRLFQEIV 207


>gi|323342269|ref|ZP_08082501.1| thymidylate kinase [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463381|gb|EFY08575.1| thymidylate kinase [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 207

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 123/207 (59%), Gaps = 12/207 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LF+SFEG +G+GKTT   ++  + ++KN  V  TREPGG   +E  R ++L    +E   
Sbjct: 3   LFVSFEGPDGSGKTTITKIVSEYFEKKNQPVLCTREPGGIRISEKIRELILDPEHEEMDD 62

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI- 123
             EA+++AA+R  H+   I+PAL  G++++CDRF+DSS AYQG    ++ + +D + +I 
Sbjct: 63  RTEALLYAASRRQHLIEKIKPALGRGELVICDRFVDSSLAYQG---YARGIGIDDVWDIN 119

Query: 124 --SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             ++   +PD TI LDL  + GLKR+  R         D  E +  + HEK  Q + ++ 
Sbjct: 120 MFAIDGFLPDLTIFLDLKPEEGLKRIGVR------GYKDRLELEGDVFHEKVYQGYQEVI 173

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           R  P+R  IVD+A S + VA +++ I+
Sbjct: 174 RRFPNRIKIVDAAQSIEDVAADVIKII 200


>gi|158319119|ref|YP_001511626.1| dTMP kinase [Alkaliphilus oremlandii OhILAs]
 gi|158139318|gb|ABW17630.1| dTMP kinase [Alkaliphilus oremlandii OhILAs]
          Length = 210

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 123/212 (58%), Gaps = 6/212 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ GLFI+ EG +G+GK+T I  +KRFL+ K Y V +TREPGGT   E  R ++L     
Sbjct: 1   MHKGLFITIEGPDGSGKSTQIHFIKRFLEEKGYKVVLTREPGGTVIGEKIRELVLDKNHK 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++AA+R  HV   I PA+ EG I+LCDRF+DSS  YQG+        +  +
Sbjct: 61  EMANVTEALLYAASRAQHVAQRIIPAIEEGSIVLCDRFVDSSIVYQGKGRGLGVENIRDI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD TI+LD+  +IG++R +   S +E+   D  E++ +  H      + ++
Sbjct: 121 NDFATMGLKPDLTILLDIDPEIGIERAK---SAKEA---DRLEQEKIDFHRIVYDGYKEL 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +  P+R  +VD+  S + V+  I  I+ +++
Sbjct: 175 VQMYPERIKVVDANQSIEEVSKGIEYILNKIL 206


>gi|254483666|ref|ZP_05096886.1| thymidylate kinase [marine gamma proteobacterium HTCC2148]
 gi|214036077|gb|EEB76764.1| thymidylate kinase [marine gamma proteobacterium HTCC2148]
          Length = 215

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 114/210 (54%), Gaps = 6/210 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + GLFI+ EG EG GK+T+++ +++ L     D+ VTREPGGT   E  R +LL    + 
Sbjct: 3   SRGLFITVEGGEGVGKSTNMAYMQQHLTDLGIDLLVTREPGGTALGEDIRELLLRPRQES 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             + AE ++  AAR  H+E V+ PAL  G+ +LCDRF D++YAYQG         +  L+
Sbjct: 63  MASGAELLLIFAARAQHLEQVVEPALANGRWVLCDRFTDATYAYQGGGRGLAVTMIRELE 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++   E+ PD T++LD PV +G+ R       RE   LD FE +     E+ R  +L +A
Sbjct: 123 QLVQGELRPDYTLLLDAPVAVGMSRA------RERGELDRFELEQTAFFERVRASYLQLA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
                R  +VD++     V   +  I  EL
Sbjct: 177 SESSGRYRVVDASKELVEVEQQLQEICSEL 206


>gi|294056288|ref|YP_003549946.1| thymidylate kinase [Coraliomargarita akajimensis DSM 45221]
 gi|293615621|gb|ADE55776.1| thymidylate kinase [Coraliomargarita akajimensis DSM 45221]
          Length = 209

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 124/218 (56%), Gaps = 15/218 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFISFEG EG GK+T I  L   L+ +  DV  TREPGGTP +EA R++L     DE G
Sbjct: 3   GLFISFEGSEGCGKSTQIRALASRLEAEGIDVVRTREPGGTPLSEAIRNLLQH---DEAG 59

Query: 64  ----AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               AEAE ++FAAAR      VI PA   GK +L DRF+DS+  YQG   +  H  + +
Sbjct: 60  EGMCAEAELLLFAAARAQLTREVIAPARRAGKAVLSDRFMDSTTVYQGVARALAHDDVAA 119

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + +V    PD TI++DL  ++GL+RV+     R    LD  ER+ +   +  RQ +L 
Sbjct: 120 INQFAVGTHKPDLTILIDLDPEVGLQRVKA----RSGGQLDRMEREALDFFQAVRQGYLA 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           +A  +  R  ++D  H+ +++   I    W  V++R++
Sbjct: 176 LAEQESKRFLVLDGNHTIEALEQEI----WNAVRQRLT 209


>gi|160871899|ref|ZP_02062031.1| thymidylate kinase [Rickettsiella grylli]
 gi|159120698|gb|EDP46036.1| thymidylate kinase [Rickettsiella grylli]
          Length = 218

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 119/207 (57%), Gaps = 12/207 (5%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV--DEFG 63
           FI+ EGIEG GK+T +  +  +LQ+ +  + +TREPGGTP AEA R +LL      +   
Sbjct: 8   FITLEGIEGVGKSTQLKFVADYLQQAHIPLTITREPGGTPIAEAIRSLLLQSDFSPEMLI 67

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E E ++F AAR  H+  VI+PAL  G  +LCDRF ++SYAYQG        F+ SL   
Sbjct: 68  PETELLLFFAARAQHIHYVIKPALQRGDWVLCDRFTETSYAYQGGGRGIDVAFIRSLHLW 127

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLR--ESACLDYFERKDVMIHEKRRQIFLDIA 181
             Q++  +  ++LD PVDI L+R+++R +    E+   D+F R         R  +L+ A
Sbjct: 128 VQQDLNVNVVLLLDAPVDIALRRMRHRKTADRIEAEKHDFFTRA--------RASYLERA 179

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +PD   ++D++ S + V   I N++
Sbjct: 180 QQRPDVYQVIDASRSLKDVQKQIKNVL 206


>gi|53803739|ref|YP_114428.1| thymidylate kinase [Methylococcus capsulatus str. Bath]
 gi|59798160|sp|Q606M0|KTHY_METCA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|53757500|gb|AAU91791.1| thymidylate kinase [Methylococcus capsulatus str. Bath]
          Length = 208

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 113/216 (52%), Gaps = 8/216 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG GK+T++  +   L+ +   V  TREPGGT   EA R + L    D
Sbjct: 1   MTPGKFITLEGGEGVGKSTNVDFVVSRLRARGLKVVATREPGGTAFGEAVREIFLRQ--D 58

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               EAE ++  AAR+ H+  VI PAL  G  ++CDRF D+SYAYQG         +D L
Sbjct: 59  TVRPEAELLLLFAARVHHLREVIEPALRRGDWVVCDRFTDASYAYQGAGRGIAPGVIDFL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++     + PD T++LD PVD GLKR   R      +  D  ER+D     + R+ +L +
Sbjct: 119 RDWIQAGLRPDLTLLLDAPVDTGLKRAHQR------SGPDRLEREDSAFFARVREGYLAL 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           AR +P R  ++D+      V T I   V  L+   V
Sbjct: 173 ARAEPGRIRVIDADRPLALVQTAIATQVDSLLAGHV 208


>gi|260575561|ref|ZP_05843559.1| thymidylate kinase [Rhodobacter sp. SW2]
 gi|259022204|gb|EEW25502.1| thymidylate kinase [Rhodobacter sp. SW2]
          Length = 209

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 115/206 (55%), Gaps = 6/206 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FISFEGI+G+GK+T   LL   L++  + V  TREPGG+P AE  R ++L    D
Sbjct: 1   MALGRFISFEGIDGSGKSTQSRLLAESLRKLGHSVCQTREPGGSPGAEEIRRLVLEGDPD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + AE E ++F AAR DH+E  IRPAL  G++++ DRF DS+  YQG         ++ L
Sbjct: 61  RWSAETEILLFTAARRDHLEKTIRPALARGEVVITDRFADSTRMYQGISRGDLGPLVNRL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            ++ +  V PD T+++DL   +GL R   R    +      FE   + +  K R  FL +
Sbjct: 121 HDLMIG-VEPDLTLLIDLDPALGLNRAVARAGAEQ-----RFEDMGLALQIKMRAGFLAL 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILN 206
           A   P+R  ++D     ++VA ++L 
Sbjct: 175 AAAHPERFRVIDGNRPPEAVAADVLG 200


>gi|194018013|ref|ZP_03056620.1| thymidylate kinase [Bacillus pumilus ATCC 7061]
 gi|194010350|gb|EDW19925.1| thymidylate kinase [Bacillus pumilus ATCC 7061]
          Length = 212

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 123/215 (57%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG+FI+FEG EGAGKTT I  +   ++R+ Y V  TREPGG   AE  R V+L+    + 
Sbjct: 2   SGMFITFEGPEGAGKTTVIRKVYEEMERQGYAVMATREPGGIDIAEQIREVILNEKNTKM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
            A+ EA+++AAAR  H+   + PAL  G+ +LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DAKTEALLYAAARRQHLAEKVEPALQRGETVLCDRFVDSSLAYQG---YARGLGIDQVRS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + ++   MP  TI   +  + GLKR+      RE   LD    + +  H+  R+ +  
Sbjct: 119 INDFAIDGTMPQMTIYFSITPEEGLKRIHANQG-REKNRLDM---ETLNFHQLVREGYEL 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +    P+R H+VD++   Q V   +L ++ + ++K
Sbjct: 175 LIAQSPERFHVVDASQPMQDVYEEVLRVIQDTLKK 209


>gi|163738563|ref|ZP_02145977.1| Thymidylate kinase [Phaeobacter gallaeciensis BS107]
 gi|161387891|gb|EDQ12246.1| Thymidylate kinase [Phaeobacter gallaeciensis BS107]
          Length = 229

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++FEGI+G+GK+T   LL   LQ +  +V +TREPGG+  AE  R ++L    D + 
Sbjct: 18  GLFVTFEGIDGSGKSTQCRLLAEALQAQGIEVVLTREPGGSDGAEEIRRLVLEGDPDRWS 77

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L  +
Sbjct: 78  AETELLLFTAARRDHMERRILPALAAGKVVVCDRFADSTRMYQGLSRGDLRASVDQLHAL 137

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +    PD TI++D+    GL R + R    E      FE   + + ++ R  FL +A  
Sbjct: 138 MIGH-EPDLTILIDMNPSKGLARAKGRQGSEE-----RFEDFGLDLQQRMRAGFLALAEE 191

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
             DR  ++D     + VA ++L +V
Sbjct: 192 FADRFRVIDGDRPIELVAQDVLGVV 216


>gi|87122703|ref|ZP_01078578.1| Thymidylate kinase [Marinomonas sp. MED121]
 gi|86162000|gb|EAQ63290.1| Thymidylate kinase [Marinomonas sp. MED121]
          Length = 208

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 116/200 (58%), Gaps = 7/200 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG+GK+T I  +K +L+ +N +  +TREPGGTP AE  R+++LS   +
Sbjct: 1   MIKGKFITLEGGEGSGKSTCIKYIKAWLESQNIEYIITREPGGTPLAEEIRNMILSHREE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +   E E ++  AAR  H++  I+PA+  GK ++ DRF+DSSY YQG         +D L
Sbjct: 61  KIHDETELLLMFAARTQHIKEKIKPAIDAGKWVISDRFVDSSYVYQGAARGGDLKKIDQL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E  +Q   PD T++ D+PVDIGL RV+ R      A  D  + + V+ H+  R  FL  
Sbjct: 121 AEWVLQGCKPDKTLLFDVPVDIGLSRVEKR------AQSDRLDDEPVVFHQMVRDAFLAR 174

Query: 181 ARNQPDRCHIVDSAHSFQSV 200
            +     C ++D++   ++V
Sbjct: 175 EKTSNHYC-LIDASQPIENV 193


>gi|83943051|ref|ZP_00955511.1| thymidylate kinase [Sulfitobacter sp. EE-36]
 gi|83846059|gb|EAP83936.1| thymidylate kinase [Sulfitobacter sp. EE-36]
          Length = 212

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFISFEGI+G+GK+T   LLK  L+   + V +TREPGG+  AE  R ++L    D + 
Sbjct: 7   GLFISFEGIDGSGKSTQTKLLKDRLEADGHQVVLTREPGGSAGAEEIRALVLQGDPDRWS 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  E ++F AAR DH+E  I PAL  GKI++CDRF DS+  YQG         +D L  +
Sbjct: 67  ARTEILLFTAARRDHLERTILPALEAGKIVICDRFADSTRMYQGLSRGDLRGAVDQLHSL 126

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  V PD T+++D+    GL R  +R ++ E      FE     +    R  FL +A  
Sbjct: 127 MIG-VEPDVTVLIDMDPGEGLSRALSRNTVEE-----RFEDFGESLQVAMRAGFLSLAAE 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            PDR   ++ A S  +VA ++   V
Sbjct: 181 FPDRFVTINGAQSIDAVAADVFAQV 205


>gi|303241047|ref|ZP_07327557.1| thymidylate kinase [Acetivibrio cellulolyticus CD2]
 gi|302591472|gb|EFL61210.1| thymidylate kinase [Acetivibrio cellulolyticus CD2]
          Length = 206

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 118/205 (57%), Gaps = 8/205 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG +G+GKTT I L++ +L+ K ++V VTREPGGT   E  R ++L     
Sbjct: 1   MKRGLFITTEGTDGSGKTTQIKLIESYLKGKGFEVVVTREPGGTSIGEKIRSIILDTENS 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E +++A+AR   V  +I+P+L EGK+++CDRF+DSSY YQG   +     ++ +
Sbjct: 61  DMAYITEMMLYASARAQLVNELIKPSLSEGKVVICDRFIDSSYVYQGFGRNIDIELIERV 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGL-KRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
             I++  +MPD T+  D+  ++ L +R+Q       S   D  ER+ +  H K    +  
Sbjct: 121 NRIALDGIMPDVTLFFDIDPEVALERRIQ-------STGADRIEREAMDFHRKVYNGYKK 173

Query: 180 IARNQPDRCHIVDSAHSFQSVATNI 204
           +A   PDR   ++S  + + + +++
Sbjct: 174 LASMYPDRIKAIESNRNIEEIFSDV 198


>gi|317483375|ref|ZP_07942367.1| thymidylate kinase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322690345|ref|YP_004219915.1| thymidylate kinase [Bifidobacterium longum subsp. longum JCM 1217]
 gi|316915192|gb|EFV36622.1| thymidylate kinase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455201|dbj|BAJ65823.1| thymidylate kinase [Bifidobacterium longum subsp. longum JCM 1217]
          Length = 206

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 125/215 (58%), Gaps = 15/215 (6%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-- 60
           SGLF+SFEG++G GKTT +  L  +L+ +   V VTREPGGT   +A R +LL  GVD  
Sbjct: 2   SGLFVSFEGVDGVGKTTQVERLHAYLEAQGRTVVVTREPGGTALGKAIRQLLLH-GVDGG 60

Query: 61  --EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFL 117
             +    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +    +
Sbjct: 61  AVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPE-EI 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            SL   +   ++PD T +LD+   +   R+++     ESA  D+  R         RQ F
Sbjct: 120 RSLSMWATNNLLPDRTYLLDMDPALSHHRLEHAEDRMESAGDDFQSRT--------RQAF 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD+A  +P+R  ++D++ S ++V   I + + EL 
Sbjct: 172 LDLAAAEPNRFRVIDASQSIEAVWAAIESDIKELA 206


>gi|226356637|ref|YP_002786377.1| dTMP kinase (thymidylate kinase) [Deinococcus deserti VCD115]
 gi|226318627|gb|ACO46623.1| putative dTMP kinase (thymidylate kinase) [Deinococcus deserti
           VCD115]
          Length = 218

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 119/220 (54%), Gaps = 15/220 (6%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS--CGVDEFG 63
           FISFEG EGAGK+T I+ L   L+ ++    VTREPGGTP     R VLL     +D   
Sbjct: 12  FISFEGPEGAGKSTQIARLVARLEERSVPHTVTREPGGTPLGTRVREVLLDPDLSIDPL- 70

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++++A+R   V +VIRPAL +G  ++CDR+ DSS AYQG         L  L   
Sbjct: 71  --PEFLLYSASRAQLVTHVIRPALTQGHTVICDRYFDSSLAYQGAGRGLPVRLLRDLTRE 128

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   + PD T++LDL   +GL+RV +R         D  ER D+  H++ RQ FLD+A  
Sbjct: 129 ATGGLTPDLTVLLDLDPALGLQRVASR------GQADRLERADLGFHQRVRQGFLDLAAA 182

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           +P R  ++D+  S   +A  I    W  V++ +   SS  
Sbjct: 183 EPGRFLVLDATRSVDELAREI----WTAVERWLPCTSSSP 218


>gi|163743050|ref|ZP_02150433.1| thymidylate kinase [Phaeobacter gallaeciensis 2.10]
 gi|161383733|gb|EDQ08119.1| thymidylate kinase [Phaeobacter gallaeciensis 2.10]
          Length = 229

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++FEGI+G+GK+T   LL   LQ +  +V +TREPGG+  AE  R ++L    D + 
Sbjct: 18  GLFVTFEGIDGSGKSTQCRLLAEALQAQGIEVVLTREPGGSDGAEEIRRLVLEGDPDRWS 77

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L  +
Sbjct: 78  AETELLLFTAARRDHMERRILPALAAGKVVVCDRFADSTRMYQGLSRGDLRASVDQLHAL 137

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +    PD TI++D+    GL R + R    E      FE   + + ++ R  FL +A  
Sbjct: 138 MIGH-EPDLTILIDMDPAKGLARAKGRQGSEE-----RFEDFGLDLQQRMRAGFLALAEE 191

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
             DR  ++D     + VA ++L +V
Sbjct: 192 FADRFRVIDGDRPIELVAQDVLGVV 216


>gi|157690810|ref|YP_001485272.1| thymidylate kinase [Bacillus pumilus SAFR-032]
 gi|166987700|sp|A8F8Z5|KTHY_BACP2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|157679568|gb|ABV60712.1| dTMP kinase [Bacillus pumilus SAFR-032]
          Length = 212

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 123/215 (57%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG+FI+FEG EGAGKTT I  +   ++R+ Y V  TREPGG   AE  R V+L+    + 
Sbjct: 2   SGMFITFEGPEGAGKTTVIRKVHEEMERQGYAVMATREPGGIDIAEQIREVILNEKNTKM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
            A+ EA+++AAAR  H+   + PAL  G+ +LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DAKTEALLYAAARRQHLAEKVEPALQRGETVLCDRFVDSSLAYQG---YARGLGIDQVRS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + ++   MP  TI   +  + GLKR+      RE   LD    + +  H+  R+ +  
Sbjct: 119 INDFAIDGTMPQMTIYFSITPEEGLKRIHANQG-REKNRLDM---ETLNFHQLVREGYEL 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +    P+R H+VD++   Q V   +L ++ + ++K
Sbjct: 175 LIAQSPERFHVVDASKPMQDVYEEVLRVIQDTLKK 209


>gi|227545645|ref|ZP_03975694.1| dTMP kinase [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|239622679|ref|ZP_04665710.1| thymidylate kinase [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|312133481|ref|YP_004000820.1| tmk [Bifidobacterium longum subsp. longum BBMN68]
 gi|322688333|ref|YP_004208067.1| thymidylate kinase [Bifidobacterium longum subsp. infantis 157F]
 gi|46576601|sp|Q8G6Z6|KTHY_BIFLO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|227213761|gb|EEI81600.1| dTMP kinase [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|239514676|gb|EEQ54543.1| thymidylate kinase [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|311772719|gb|ADQ02207.1| Tmk [Bifidobacterium longum subsp. longum BBMN68]
 gi|320459669|dbj|BAJ70289.1| thymidylate kinase [Bifidobacterium longum subsp. infantis 157F]
          Length = 206

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 127/217 (58%), Gaps = 16/217 (7%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN GLF+SFEG++G GKTT +  L+ +L+ +   V VTREPGGT   +A R +LL  GVD
Sbjct: 1   MN-GLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAIRQLLLH-GVD 58

Query: 61  ----EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHL 115
               +    AEA++FAA R  HV   IRPAL  G++++ DR+LDSS AYQ G R+ +   
Sbjct: 59  GGAVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPE- 117

Query: 116 FLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ 175
            + SL   +   ++PD T +LD+   +   R+++     ESA  D+  R         RQ
Sbjct: 118 EIRSLSMWATNNLLPDRTYLLDMDPALSHHRLEHAEDRMESAGDDFQSRT--------RQ 169

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            FLD+A  +P+R  ++D++ S ++V   I + + EL 
Sbjct: 170 AFLDLAAAEPNRFRVIDASQSIEAVWAAIESDIKELA 206


>gi|149182688|ref|ZP_01861155.1| thymidylate kinase [Bacillus sp. SG-1]
 gi|148849598|gb|EDL63781.1| thymidylate kinase [Bacillus sp. SG-1]
          Length = 214

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 122/215 (56%), Gaps = 4/215 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG EGAGK+T I  +   L  K ++V +TREPGG   AE  R V+L     
Sbjct: 1   MKQGLFITVEGPEGAGKSTIIKKMADELTEKGHEVILTREPGGITIAEEIREVILDPKNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AAAR  H+   + P+L +G I+LCDRFLDSS AYQG         + S+
Sbjct: 61  AMDERTEALLYAAARRQHLAEKVIPSLDKGSIVLCDRFLDSSLAYQGHARGIGMEEVYSI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + ++ + MPD T+  D+  +IGL+R+ + +  RE   LD    + +  HE+ R+ +L +
Sbjct: 121 NKFAIGDTMPDITLYFDVEPEIGLERI-SAHKGREVNRLDL---ETIDFHERVREGYLML 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
               P+R   +D++ SF  V  N L I+ + + +R
Sbjct: 177 LEKFPERIKKIDASASFGEVYQNALKIIEKYIDER 211


>gi|116493219|ref|YP_804954.1| thymidylate kinase [Pediococcus pentosaceus ATCC 25745]
 gi|122265317|sp|Q03E60|KTHY_PEDPA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|116103369|gb|ABJ68512.1| thymidylate kinase [Pediococcus pentosaceus ATCC 25745]
          Length = 209

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 130/214 (60%), Gaps = 11/214 (5%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FISFEG +GAGKTT + ++++ + QR    + VTREPGG P +EA R ++L     E
Sbjct: 2   NGHFISFEGPDGAGKTTVLQAMVEHYQQRLKDQLTVTREPGGNPISEAIRTIILDKNNTE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   I PAL +  ++ CDRF+DSS AYQG   + + +  D++ 
Sbjct: 62  MDERTEALLYAAARRQHLVETILPALKKNHVVFCDRFVDSSIAYQG---AGRKIGTDAVY 118

Query: 122 EISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           ++++   +  +P+ TI LD+P ++GLKR+        +  +D  + + +  H++ R  +L
Sbjct: 119 QMNLFATEGALPEKTIYLDVPSELGLKRIMT----HRTEDVDRLDLEQLDFHQRVRSAYL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           D+A+  PDR  ++D++     V  +++ ++ +++
Sbjct: 175 DLAKKFPDRIVVIDASQELDDVKRDVIEVLDQIL 208


>gi|169825658|ref|YP_001695816.1| thymidylate kinase [Lysinibacillus sphaericus C3-41]
 gi|168990146|gb|ACA37686.1| Thymidylate kinase [Lysinibacillus sphaericus C3-41]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 124/216 (57%), Gaps = 10/216 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MNS LFI+FEG EGAGKTT I  +   L  KN DV  TREPGG   AE  R ++L+    
Sbjct: 7   MNSNLFITFEGPEGAGKTTVIQKIAERLAEKNIDVLATREPGGIEIAEKIRTIILNPAHT 66

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
                 EA+++AAAR  H    +RPAL  GK+++CDRF+DSS AYQG    ++ + +D  
Sbjct: 67  AMDERTEALLYAAARSQHYFEKVRPALDAGKLVICDRFIDSSLAYQG---YARGIGIDEV 123

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+ E ++ + +PD TI+ D+  ++GL R+    + RE   LD    + +  H+K  + +
Sbjct: 124 LSINEFAIGKKLPDMTILFDIAPEVGLARIYATGN-REVNRLDV---ESLPFHQKVHEGY 179

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           L +    P+R  +V++     SV   + +++ + +Q
Sbjct: 180 LLLVERYPERIRMVNADQDIDSVVEEVWSLLLKAIQ 215


>gi|311695098|gb|ADP97971.1| thymidylate kinase [marine bacterium HP15]
          Length = 213

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG GK+T ++     L     D  VTREPGGTP AEA R +LL+   +   
Sbjct: 5   GQFITFEGTEGVGKSTQLTNAADTLAGLGVDYIVTREPGGTPMAEAVRELLLAPRDEPVN 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR  H+   I PAL +G+ +LCDRF D+++AYQG         +  L+ +
Sbjct: 65  EITELLLMFAARAQHLHTRILPALEQGQWVLCDRFTDATFAYQGGGRGVPEERIALLETL 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD  I+LD PVD G+ R + R        LD FE++D+   ++ R+ +L  A  
Sbjct: 125 VQGDIRPDHVIVLDAPVDTGMARARKR------GDLDRFEQEDLEFFQRIRETYLARAMA 178

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           QP R H++D+A     V+  +  ++
Sbjct: 179 QPSRYHVIDAARPLAEVSGQVSELL 203


>gi|168187948|ref|ZP_02622583.1| thymidylate kinase [Clostridium botulinum C str. Eklund]
 gi|169294219|gb|EDS76352.1| thymidylate kinase [Clostridium botulinum C str. Eklund]
          Length = 212

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 124/211 (58%), Gaps = 10/211 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN G+FI+ EG EG+GKTT + +++ +L+  N D   TREPGG   +E  R+V+L+    
Sbjct: 1   MNKGIFITLEGPEGSGKTTIVKMIEEYLRENNIDYISTREPGGINISEQIRNVILNKDNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++ A+R  H+   + PAL  GK+++CDRF+DSS AYQG    ++ + +D +
Sbjct: 61  EMDPRTEALLYVASRRQHLAERVIPALKSGKVVICDRFVDSSLAYQG---YARGIGIDEV 117

Query: 121 QEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            EI   ++   MPD T+ LD+  +IGL R+ ++ S RE   LD  E+ D   H+K R+ +
Sbjct: 118 MEINEFAIDGYMPDLTLYLDIEPEIGLNRI-SKNSEREVNRLD-LEKLD--FHKKVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
             +    P+R   +++  S   V T + N +
Sbjct: 174 FKLLERYPNRIKQINANQSVDKVFTEVKNFL 204


>gi|254445325|ref|ZP_05058801.1| thymidylate kinase [Verrucomicrobiae bacterium DG1235]
 gi|198259633|gb|EDY83941.1| thymidylate kinase [Verrucomicrobiae bacterium DG1235]
          Length = 214

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL--SCGVD 60
           +G F +FEG EG+GK+T I LL   L    ++V VTREPGGT   E  RH+L+  S G D
Sbjct: 8   TGKFFTFEGSEGSGKSTQIELLAEELAGMGHEVVVTREPGGTSIGEEIRHLLIHSSAGKD 67

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               EAE ++FAAAR   V  +I P L +G I+LCDRFLDS+  YQG   S     +  +
Sbjct: 68  -MTPEAELLLFAAARAQLVRELILPELEKGSIVLCDRFLDSTTVYQGAARSIASDPVSYI 126

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +V  + P  T ILD+P +  ++RV+ R     S   D  E+++   ++K R  +L +
Sbjct: 127 NQFAVGPLSPTLTFILDVPAEESIRRVKRRV----SDLPDRMEQENNDFYKKVRDGYLLL 182

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A++ P+R H+VD   S       IL  V +
Sbjct: 183 AKSMPERFHVVDGTRSLAVNREEILKTVLD 212


>gi|256397499|ref|YP_003119063.1| thymidylate kinase [Catenulispora acidiphila DSM 44928]
 gi|256363725|gb|ACU77222.1| thymidylate kinase [Catenulispora acidiphila DSM 44928]
          Length = 901

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 119/204 (58%), Gaps = 11/204 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSC-GVDE 61
           +G F+SFEG +G+GK+T + LL  +L+   ++V VTREPGGTP     R+++L     D 
Sbjct: 496 TGTFLSFEGGDGSGKSTQLDLLADWLRGSGHEVVVTREPGGTPLGTKLRNIVLDAHNADV 555

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AEA+++AA R DHVE V+RPAL  G +++ DR++DSS AYQG   +     ++ L 
Sbjct: 556 ISPRAEALIYAADRADHVERVVRPALERGAVVITDRYVDSSLAYQGAGRALSAREVELLS 615

Query: 122 EISVQEVMPDCTIILDL-PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + + Q +MPD TI++DL P++   +R             D  E + V  H + R  +L++
Sbjct: 616 QWATQGLMPDVTILMDLDPLEAARRR---------KTPADRLELESVDFHRRVRNRYLEL 666

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A  +P+R  ++++    + +A  I
Sbjct: 667 ATAEPERFIVINAMEPIEQIAGRI 690


>gi|326387758|ref|ZP_08209364.1| thymidylate kinase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207804|gb|EGD58615.1| thymidylate kinase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 207

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/208 (39%), Positives = 120/208 (57%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M++G FI+ EG EG GK+T + LL + LQ   + V  TREPGGTP AEA R ++L+   +
Sbjct: 1   MSAGRFIALEGGEGVGKSTQLRLLAQALQADGHVVVTTREPGGTPGAEAIRAMVLANEGE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +G  AEA++FAAAR DHV+ +IRPAL  G+ +L DR+LDSS AYQG         + +L
Sbjct: 61  GWGPRAEALLFAAARADHVDRLIRPALERGEWVLTDRYLDSSRAYQGGGSGLSDDDILAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             I  + ++PD TI+L L  +        R +LR+    D    +D   H +    F   
Sbjct: 121 HRIGSEGLLPDRTILLTLDPE----ETARRLTLRDEGRADRIGGRDAAYHARVAAAFRRF 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A  +P R  +VD++ + +SV   IL+ V
Sbjct: 177 AEAEPHRFTLVDASGTPESVHARILSAV 204


>gi|88810823|ref|ZP_01126080.1| thymidylate kinase [Nitrococcus mobilis Nb-231]
 gi|88792453|gb|EAR23563.1| thymidylate kinase [Nitrococcus mobilis Nb-231]
          Length = 222

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 120/211 (56%), Gaps = 6/211 (2%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ EGIEGAGKT+ +  L + L+ +  +  +TREPGGT   EA R +LL         +
Sbjct: 15  FITVEGIEGAGKTSCLDYLAKLLRNQAIEAVLTREPGGTSLGEAVRALLLDHRFRGMAGD 74

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR  H+  VIRPAL  G+ ++CDRF D++YAYQG   +     +  L+  + 
Sbjct: 75  AETLLVFAARAQHLAEVIRPALAAGQWVVCDRFTDATYAYQGGGRALGATRVGLLEHWAQ 134

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
            E+ PD T+ LD+PV +GL R+ +R +      LD FE +     E+ R ++L+  R +P
Sbjct: 135 SELRPDRTLYLDVPVTVGLGRIASRGN------LDRFESERQAFFERVRCVYLERCRAEP 188

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            R   +++  S ++V T I   + +L+   V
Sbjct: 189 QRMRRIEADGSREAVHTQIAAALADLLNDGV 219


>gi|311112929|ref|YP_003984151.1| thymidylate kinase [Rothia dentocariosa ATCC 17931]
 gi|310944423|gb|ADP40717.1| thymidylate kinase [Rothia dentocariosa ATCC 17931]
          Length = 263

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 124/216 (57%), Gaps = 13/216 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI FEG +GAGKTT ++ L+  L+ + Y V  TREPGGTP  EA R ++L  G  E  
Sbjct: 34  GLFIVFEGGDGAGKTTQLARLQAALEAQGYTVIATREPGGTPLGEALRELVLKHGSSEVD 93

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A AEA++FAA+R  H    IRPAL  G ++L DR+LDSS AYQG     ++L  D++ ++
Sbjct: 94  ARAEALIFAASRAAHAAQKIRPALAAGAVVLSDRYLDSSAAYQG---IGRNLGKDTITDL 150

Query: 124 S---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           S    ++++P  TI+LD+P+    +R+ +R        +D  E +      +    F DI
Sbjct: 151 SRWATEDLIPHATILLDVPLTDESQRMSDR------GTVDRIEAEGADFKARVHTAFADI 204

Query: 181 ARNQPDRCH-IVDSAHSFQSVATNILNIVWELVQKR 215
           AR   D  H +VD   S  +V   +L +V  L++ R
Sbjct: 205 ARQNADGAHYVVDGCGSVDAVHERVLEVVRPLLESR 240


>gi|81427954|ref|YP_394953.1| thymidylate kinase (dTMP kinase) [Lactobacillus sakei subsp. sakei
           23K]
 gi|123564716|sp|Q38YT6|KTHY_LACSS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|78609595|emb|CAI54641.1| Thymidylate kinase (dTMP kinase) [Lactobacillus sakei subsp. sakei
           23K]
          Length = 214

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 120/212 (56%), Gaps = 13/212 (6%)

Query: 4   GLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKT+ + +++ R  +  + ++ VTREPGG P +E  R ++L       
Sbjct: 3   GKLITFEGPDGAGKTSALEAVVARLQKEVSQEIVVTREPGGNPISEQIRQIILDVKNTAM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I+PAL   K+++CDRF+DSS AYQG         +  +  
Sbjct: 63  DDRTEALLYAAARRQHIVEKIQPALAADKLVICDRFVDSSIAYQGAGRGIGEEAVAQMNL 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRV----QNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            +   + PD T+ LD+P ++GL R+    QN+Y        D  +++ +  H+K RQ +L
Sbjct: 123 FATDGLTPDLTLYLDVPSEVGLARIKQHRQNQY--------DRLDQEKLAFHQKVRQSYL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
            +A+  PDR   +D++   ++V T  L ++ +
Sbjct: 175 KLAQAHPDRIKTIDASQPLEAVVTQCLQVIAQ 206


>gi|220934998|ref|YP_002513897.1| dTMP kinase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996308|gb|ACL72910.1| dTMP kinase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 218

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 115/210 (54%), Gaps = 6/210 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GK+T I  L+ FL+ +   + VTREPGGTP AE  R +LLS       
Sbjct: 9   GRFITLEGAEGVGKSTQIQALQAFLESRGVPLLVTREPGGTPLAERIRELLLSRDHPPMH 68

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR +H+   I PAL  G  +LCDRF D++YAYQG         +  L++ 
Sbjct: 69  PDTELLLMFAARAEHLRTRILPALEAGTWVLCDRFTDATYAYQGGGRGLDPARIAVLEDW 128

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               V PD T++LD+ V  GL R + R         D FE++ +   E+ R+ +L  AR 
Sbjct: 129 VQGPVRPDLTLLLDVDVRTGLARARGR------GEADRFEQEAMDFFERVREAYLARARA 182

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +P R  I+D+  S ++V  ++   +  L+Q
Sbjct: 183 EPSRYRIIDAGQSLEAVTRDLQAALVSLLQ 212


>gi|149914153|ref|ZP_01902684.1| thymidylate kinase [Roseobacter sp. AzwK-3b]
 gi|149811672|gb|EDM71505.1| thymidylate kinase [Roseobacter sp. AzwK-3b]
          Length = 208

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 111/206 (53%), Gaps = 6/206 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G FISFEGI+G+GK+T   LL   L+    DV +TREPGG+P AE  R ++L    D +
Sbjct: 4   GGYFISFEGIDGSGKSTQARLLADHLRGTGRDVVLTREPGGSPGAEEIRALVLEGDGDRW 63

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             E E ++F AAR DH+E  I PAL  G+I++CDRF DS+  YQG   +     +D L  
Sbjct: 64  SPETELLLFTAARRDHLERTIAPALEAGQIVICDRFADSTRLYQGLARADLRGLVDQLHS 123

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +    PD TI++D+    GL R   R +  E      FE     + +K RQ FLD+A+
Sbjct: 124 LMIGR-EPDLTILIDMDPATGLGRALARGTGEER-----FESFGDSMQQKIRQGFLDLAQ 177

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
               R   VD      +VA +I  I 
Sbjct: 178 EFSARFVTVDGNRQLDAVAADIRQIA 203


>gi|302864959|ref|YP_003833596.1| thymidylate kinase [Micromonospora aurantiaca ATCC 27029]
 gi|302567818|gb|ADL44020.1| thymidylate kinase [Micromonospora aurantiaca ATCC 27029]
          Length = 718

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 80/216 (37%), Positives = 123/216 (56%), Gaps = 12/216 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           ++SGLF+ FEG EGAGK+T ++ L   L+ +  DV VTREPG TP  E  R ++L     
Sbjct: 475 VSSGLFVVFEGGEGAGKSTQLAELAERLRAQGRDVVVTREPGATPVGERIRSLVLGTTPG 534

Query: 61  EFGA-EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           E  +  AEA+++AA R  HV  V+RPAL+ G +++ DR++DSS AYQG   + + L +D 
Sbjct: 535 EAPSPRAEALLYAADRAHHVATVVRPALVRGAVVISDRYVDSSLAYQG---AGRTLPVDE 591

Query: 120 LQEIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +  +S      + PD  ++LD+    GL RV++R     +   D  E + +  HE+ R  
Sbjct: 592 VSWLSSWATGGLKPDLVVLLDVEPRTGLSRVEDR-----AEGTDRLEAESLTFHERVRYA 646

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           FLD+A   P R  ++D++      A  +   V EL+
Sbjct: 647 FLDLAAGDPKRYLVLDASRPIDETADAVARRVGELL 682


>gi|301060374|ref|ZP_07201237.1| dTMP kinase [delta proteobacterium NaphS2]
 gi|300445570|gb|EFK09472.1| dTMP kinase [delta proteobacterium NaphS2]
          Length = 212

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 104/192 (54%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T    +   L+R      +TREPGGTP     R +LLS G  +   
Sbjct: 1   MFITFEGIEGCGKSTQAKRIAARLERAGVSCILTREPGGTPVGNDIRQILLSSGNRDLPP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE  ++ A R  H+ +V++PAL   K +LCDRF D++ AYQG            L E++
Sbjct: 61  LAELFLYEADRALHMASVVKPALAAKKWVLCDRFFDATTAYQGYARGQDLHMTARLNEMA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + PD T +LD PV +GLKR   R +    A  D FE++    HE  R  + ++A+  
Sbjct: 121 SFGIKPDKTFLLDCPVSVGLKRALKRNAESRVAGQDRFEQEKTAFHEAVRHGYRELAKQN 180

Query: 185 PDRCHIVDSAHS 196
           P R  +VD+  +
Sbjct: 181 PHRFVVVDATQT 192


>gi|296329529|ref|ZP_06872015.1| thymidylate kinase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305672726|ref|YP_003864397.1| thymidylate kinase [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296153272|gb|EFG94135.1| thymidylate kinase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305410969|gb|ADM36087.1| thymidylate kinase [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 212

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 124/215 (57%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKNILIAEGLQVTATREPGGIDIAEQIREVILNENNTLM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
               EA+++AAAR  H+   ++PAL +G ++LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DPRTEALLYAAARRQHLVEKVKPALEQGHVVLCDRFIDSSLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E ++ ++MP  T+   +  + GLKR+    S RE   LD    + +  H K R+ + +
Sbjct: 119 INEFAIGDMMPHVTVYFSIDPEEGLKRIHANGS-REKNRLDL---EKLSFHTKVREGYQE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P R H VD++ S   V  ++L +V E ++K
Sbjct: 175 LMKRFPKRFHPVDASQSKDLVVQDVLKVVNEALKK 209


>gi|260102441|ref|ZP_05752678.1| dTMP kinase [Lactobacillus helveticus DSM 20075]
 gi|260083761|gb|EEW67881.1| dTMP kinase [Lactobacillus helveticus DSM 20075]
          Length = 216

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/206 (37%), Positives = 120/206 (58%), Gaps = 11/206 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G F+SFEG +GAGK+T +  +L +   +      VTREPGG+  AE  R ++L    D+ 
Sbjct: 7   GYFVSFEGPDGAGKSTVLKEVLDQIGPKLKPQYLVTREPGGSKIAEKIRDIILDPANDKM 66

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AAAR  HVE +IRPAL EGKI+  DRF+DSS AYQGE    + L ++ +++
Sbjct: 67  DAKTEALLYAAARSQHVEEIIRPALSEGKIVFSDRFVDSSLAYQGE---GRDLGIEEVKQ 123

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +  ++ PD T  LD+  +IGL R+Q     +E    D  E++++  H+K    FL 
Sbjct: 124 INDFATGKLDPDLTFFLDIAPEIGLSRIQKLRPGQE----DRLEQENIAFHKKVYNGFLK 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNIL 205
           +    PDR   +D+    + V   ++
Sbjct: 180 VKDLYPDRFVTIDATQPIEDVVNQVI 205


>gi|253699689|ref|YP_003020878.1| thymidylate kinase [Geobacter sp. M21]
 gi|259494271|sp|C6E2H4|KTHY_GEOSM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|251774539|gb|ACT17120.1| thymidylate kinase [Geobacter sp. M21]
          Length = 225

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 121/217 (55%), Gaps = 4/217 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEG GKTT + LLK  L      V VTREPGG P A+  R +LL        
Sbjct: 2   GFFITFEGIEGCGKTTQLRLLKERLVALGEKVTVTREPGGCPVADQMRAILLDAKNSAIT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++AAAR  HV+ VI PAL  G+ +LCDRF D++ AYQG         ++ L  +
Sbjct: 62  PLAELLLYAAARAQHVQEVIVPALERGETVLCDRFTDATVAYQGHGRGLDLSVIEELNTL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   V P  T+++D PV++GL R   R      A  + FER+ ++ H+K R  +L +A  
Sbjct: 122 ATGRVQPALTVLIDCPVEVGLSRALARIEATSGAKEERFERESLLFHQKVRDGYLALAAA 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLS 220
            P+R  +VD +   Q   T +L  V E +++R+  L 
Sbjct: 182 FPERFVVVDGSGDVQQ--TGLL--VEEALRRRMQSLG 214


>gi|330465259|ref|YP_004403002.1| thymidylate kinase [Verrucosispora maris AB-18-032]
 gi|328808230|gb|AEB42402.1| thymidylate kinase [Verrucosispora maris AB-18-032]
          Length = 753

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 80/217 (36%), Positives = 121/217 (55%), Gaps = 13/217 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +++GLF+ FEG EGAGK+T ++ L   L+ +  DV VTREPG T      R ++L    D
Sbjct: 512 VSAGLFVVFEGGEGAGKSTQLAQLAERLRAEGRDVVVTREPGATGVGTRIRSLVLDNNTD 571

Query: 61  EFGA--EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
           +      AEA+++AA R  HV  V+RPAL  G +++ DR++DSS AYQG   + + L +D
Sbjct: 572 DEAPSPRAEALLYAADRAHHVATVVRPALSRGAVVISDRYVDSSLAYQG---AGRTLPVD 628

Query: 119 SLQEIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ 175
            L  +S      + PD  ++LD+    GL RV  R     S   D  E + +  HE+ R 
Sbjct: 629 ELSWLSSWATGGLKPDLVVLLDIDPRAGLSRVAER-----SRAADRLEAESLAFHERVRY 683

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            FLD+A   P R  ++D+ H  + +A  + + V EL+
Sbjct: 684 AFLDLAAADPKRYLVLDAGHPVEQIAERVADRVTELL 720


>gi|161506952|ref|YP_001576906.1| thymidylate kinase [Lactobacillus helveticus DPC 4571]
 gi|172048179|sp|A8YTF9|KTHY_LACH4 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|160347941|gb|ABX26615.1| Thymidylate kinase [Lactobacillus helveticus DPC 4571]
 gi|328462877|gb|EGF34726.1| thymidylate kinase [Lactobacillus helveticus MTCC 5463]
          Length = 212

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/206 (37%), Positives = 120/206 (58%), Gaps = 11/206 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G F+SFEG +GAGK+T +  +L +   +      VTREPGG+  AE  R ++L    D+ 
Sbjct: 3   GYFVSFEGPDGAGKSTVLKEVLDQIGPKLKPQYLVTREPGGSKIAEKIRDIILDPANDKM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AAAR  HVE +IRPAL EGKI+  DRF+DSS AYQGE    + L ++ +++
Sbjct: 63  DAKTEALLYAAARSQHVEEIIRPALSEGKIVFSDRFVDSSLAYQGE---GRDLGIEEVKQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +  ++ PD T  LD+  +IGL R+Q     +E    D  E++++  H+K    FL 
Sbjct: 120 INDFATGKLDPDLTFFLDIAPEIGLSRIQKLRPGQE----DRLEQENIAFHKKVYNGFLK 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNIL 205
           +    PDR   +D+    + V   ++
Sbjct: 176 VKDLYPDRFVTIDATQPIEDVVNQVI 201


>gi|256848132|ref|ZP_05553576.1| thymidylate kinase [Lactobacillus coleohominis 101-4-CHN]
 gi|256715192|gb|EEU30169.1| thymidylate kinase [Lactobacillus coleohominis 101-4-CHN]
          Length = 212

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 125/219 (57%), Gaps = 16/219 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           G FISFEG +GAGKT+ IS ++ +L +K     V +TREPGG   +E  R +L       
Sbjct: 3   GRFISFEGPDGAGKTSVISAIQEWLTQKYGKQAVLLTREPGGNRISEQIRQILFDDHNTN 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA++FAAAR  H+   I PAL  GK +L DR++DSS AYQG     +HL  D + 
Sbjct: 63  MDARTEALLFAAARRQHIVEDIEPALQAGKFVLSDRYVDSSVAYQG---GGRHLGADDIW 119

Query: 122 EI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           E+   ++  ++PD TI LD+P ++GL+R+    S      ++  +R+ +  H+  R  +L
Sbjct: 120 ELNQFAIHGLLPDLTIYLDIPSELGLERI----SKHRQNQVNRLDREKLRFHQDVRNAYL 175

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            +A+    R  ++D++    +V    +N+V E++Q R +
Sbjct: 176 TLAQRHQKRIQLIDASQPLPTV----INMVQEMIQNRFN 210


>gi|308066851|ref|YP_003868456.1| Thymidylate kinase (dTMP kinase) [Paenibacillus polymyxa E681]
 gi|305856130|gb|ADM67918.1| Thymidylate kinase (dTMP kinase) [Paenibacillus polymyxa E681]
          Length = 215

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 124/216 (57%), Gaps = 9/216 (4%)

Query: 1   MN-SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           MN  G+FI+ EG +G+GKTT I  L +F++ + Y V  TREPGG   +E  R ++L    
Sbjct: 1   MNRKGIFITLEGGDGSGKTTMIQRLAKFMEEEGYPVITTREPGGIEISEKIRSIILDPAH 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               A  EA+++AAAR  H+   ++PA+ +G I+LCDRF+DSS  YQG         + S
Sbjct: 61  TSMDARTEALLYAAARRQHLVEKVKPAIEQGAIVLCDRFVDSSLVYQGFARGIGIEEVAS 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +   +V +  PD T  LD+  ++GL R+    +    A +D  + + +  H K R+ +L+
Sbjct: 121 INRFAVDDWEPDATFYLDIEPELGLARI----NASRGAEMDRLDMESISFHHKVREAYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           +AR  P+R  IVD++ + + V      ++ +L++KR
Sbjct: 177 LARKFPERITIVDASPAPEQVE----QVLKDLLKKR 208


>gi|172056067|ref|YP_001812527.1| dTMP kinase [Exiguobacterium sibiricum 255-15]
 gi|229621736|sp|B1YGD3|KTHY_EXIS2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|171988588|gb|ACB59510.1| dTMP kinase [Exiguobacterium sibiricum 255-15]
          Length = 212

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 118/213 (55%), Gaps = 6/213 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+ EG +GAGKTT + LL   L  + Y++ +TREPGGT      R ++L+    E 
Sbjct: 2   TGTFITVEGPDGAGKTTQLQLLADRLTAEGYEIVMTREPGGTRIGNEIRSLILNPDFQEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               E +++AA+R  HV  +IRPAL  GKI+LCDRF+D+S AYQG         + S+ +
Sbjct: 62  DEMTEILLYAASRAQHVNELIRPALAAGKIVLCDRFIDASIAYQGYGLGYTIEQVRSINQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + PD T + DL V    +R+ +R        LD  E++D    ++    F+ +A 
Sbjct: 122 QATNHLTPDRTYLFDLTVSESKQRMMDR------GALDRIEQRDDAFRQRVYDGFMTLAV 175

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +P+R  +VD+  S +S+ T +   V   ++KR
Sbjct: 176 QEPERIQLVDANQSIESLQTELCKDVLTYLKKR 208


>gi|15805151|ref|NP_293837.1| thymidylate kinase [Deinococcus radiodurans R1]
 gi|14285522|sp|Q9RY40|KTHY_DEIRA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|6457772|gb|AAF09698.1|AE001873_8 thymidylate kinase [Deinococcus radiodurans R1]
          Length = 206

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 120/218 (55%), Gaps = 17/218 (7%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ GLFI+ EG EGAGKTT ++ L+  L+   + V VTREPGGTP     R V+L   V 
Sbjct: 1   MSQGLFITLEGPEGAGKTTQLARLEARLRAAGHAVTVTREPGGTPLGTRVREVVLDPAV- 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     E ++++A+R   V  V+RPAL  G+ +LCDR+ DSS AYQG   + + L L  L
Sbjct: 60  EIEPLGEFLLYSASRAQLVREVLRPALERGETVLCDRYADSSLAYQG---AGRGLSLPLL 116

Query: 121 QEISVQ---EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           ++I+ +    + P  T++LDL   +GL+R   R         D  E+ D+  H + RQ F
Sbjct: 117 RQITAEVTGGLTPGLTVLLDLDPALGLQRAARR------GQPDRLEQADLTFHRRVRQGF 170

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           LD+A  +P R  ++D+      +   I    W  V +R
Sbjct: 171 LDLAHAEPQRFLVLDATRPEDELEAEI----WAAVSER 204


>gi|227894602|ref|ZP_04012407.1| thymidylate kinase [Lactobacillus ultunensis DSM 16047]
 gi|227863593|gb|EEJ71014.1| thymidylate kinase [Lactobacillus ultunensis DSM 16047]
          Length = 216

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 118/206 (57%), Gaps = 5/206 (2%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G F+SFEG +GAGK+T +  +L +   R      VTREPGG+  AE  R ++L    D+ 
Sbjct: 7   GYFVSFEGPDGAGKSTVLKEVLAKISPRLKPQYLVTREPGGSKIAEKIRDIILDPANDKM 66

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AA+R  HVE VI+PAL  GKI+  DRF+DSS AYQGE        +  + +
Sbjct: 67  DAKTEALLYAASRSQHVEEVIKPALAAGKIVFSDRFVDSSLAYQGEGRGLGIKEVKQIND 126

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +  ++ PD T  LD+  +IGLKR++     +E    D  E++++  H+K    FL +  
Sbjct: 127 FATDKLDPDLTFFLDVAPEIGLKRIEKLRPDQE----DRLEQENIAFHKKVYAGFLKVRD 182

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
             PDR   +D+    + V   +++++
Sbjct: 183 MYPDRFVTIDATQPIEKVVDQVISVL 208


>gi|321313698|ref|YP_004205985.1| thymidylate kinase [Bacillus subtilis BSn5]
 gi|320019972|gb|ADV94958.1| thymidylate kinase [Bacillus subtilis BSn5]
          Length = 212

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 126/215 (58%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVTATREPGGIDIAEQIREVILNENNTLM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
             + EA+++AAAR  H+   ++PAL +G I+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E ++ ++MP  T+   +  + GLKR+    S RE   LD  E+ D   H K ++ + +
Sbjct: 119 INEFAIGDMMPHVTVYFSIDPEEGLKRIYANGS-REKNRLD-LEKLD--FHTKVQEGYQE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R H VD+  S   V  ++L ++ E ++K
Sbjct: 175 LMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKK 209


>gi|254448227|ref|ZP_05061689.1| thymidylate kinase [gamma proteobacterium HTCC5015]
 gi|198262094|gb|EDY86377.1| thymidylate kinase [gamma proteobacterium HTCC5015]
          Length = 213

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 118/215 (54%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GK+T++  ++++L  +  +V  TREPGGTP  EA R VLL    +  G
Sbjct: 3   GRFITLEGGEGVGKSTNLRYVQQWLTGQGLNVVQTREPGGTPLGEALRGVLLGDQAEGIG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+AE +   AAR +H++ VI PAL  G  +LCDRF D+SYAYQG         + +L+  
Sbjct: 63  AKAELLTVFAARQEHLDKVIVPALERGDWVLCDRFTDASYAYQGGGRGLAFDTIAALENW 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T++LD P+++G+ R   R         D FER+     E   + +   A  
Sbjct: 123 VQGDLRPDLTLLLDAPLEVGMARAAER------GQADRFEREPRAFFEAVSEAYRRRAST 176

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSP 218
           + +R  ++D+A    SV   I  +    + +R++P
Sbjct: 177 EAERYAVIDAAQDLASVQAQIDRV----LSERLAP 207


>gi|320095385|ref|ZP_08027065.1| thymidylate kinase [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319977690|gb|EFW09353.1| thymidylate kinase [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 256

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 122/210 (58%), Gaps = 15/210 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG++GAGKTT I  ++ + + + ++V +T EPGGTP     R  L+  G D+  
Sbjct: 13  GVFITFEGVDGAGKTTQIRNVREWFEERGFEVVMTCEPGGTPLGAELRR-LVQNGPDDID 71

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA+++AA R  HV  V+RPAL  G ++L DR++DSS AYQG   +++ L +D +  +
Sbjct: 72  PRTEALLYAADRAYHVATVVRPALARGAVVLGDRYIDSSLAYQG---AARSLGVDEIAAM 128

Query: 124 S---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           S    + + P  T +LDLP ++G  R  +          D  ER+    HE+ R+ +L +
Sbjct: 129 SAWATEGLSPRTTFLLDLPPEVGAGRRTD--------APDRMERESADFHERVRREYLRL 180

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A  +PDR  ++D+  + + V + I  ++ E
Sbjct: 181 ADAEPDRIVVIDAVGTREEVFSEIRGVLVE 210


>gi|269836979|ref|YP_003319207.1| thymidylate kinase [Sphaerobacter thermophilus DSM 20745]
 gi|269786242|gb|ACZ38385.1| thymidylate kinase [Sphaerobacter thermophilus DSM 20745]
          Length = 212

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 91/219 (41%), Positives = 126/219 (57%), Gaps = 9/219 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LF++FEG EGAGK+T I  L   L+ + Y V  TREPGGT   EA R +LL+        
Sbjct: 3   LFVTFEGPEGAGKSTQIRRLASELEARGYSVVATREPGGTAIGEAIRQILLAPEHSAMLP 62

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E EA++  AAR  HV  VI+PAL  GKI+LCDRF+DS+  YQG         L +LQ  +
Sbjct: 63  ETEALLNTAARAQHVAEVIQPALAAGKIVLCDRFVDSTLVYQGAGRGLPTSDLLALQRFA 122

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            + + PD T++LDLPV++G  R   R S      L  F+   +  HE+ R  FL +AR+ 
Sbjct: 123 TRGLWPDLTLLLDLPVEVGQAR--RRAS---GEPLSRFDADALGFHERVRTGFLALARDD 177

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           P R  I+D+A S ++VA  +L +V E    R+ P   ++
Sbjct: 178 PARWRIIDAAQSEEAVAREVLAVVLE----RLPPAPGRQ 212


>gi|291482399|dbj|BAI83474.1| thymidylate kinase [Bacillus subtilis subsp. natto BEST195]
          Length = 212

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 126/215 (58%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNTLM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
             + EA+++AAAR  H+   ++PAL +G I+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E ++ ++MP  T+   +  + GLKR+    S RE   LD  E+ D   H K ++ + +
Sbjct: 119 INEFAIGDMMPHVTVYFSIDPEEGLKRIYANGS-REKNRLD-LEKLD--FHTKVQEGYQE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R H VD+  S   V  ++L ++ E ++K
Sbjct: 175 LMKRFPERFHSVDAGQSKGLVVQDVLKVIDEALKK 209


>gi|239618400|ref|YP_002941722.1| thymidylate kinase [Kosmotoga olearia TBF 19.5.1]
 gi|259494274|sp|C5CHP2|KTHY_KOSOT RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|239507231|gb|ACR80718.1| thymidylate kinase [Kosmotoga olearia TBF 19.5.1]
          Length = 208

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 116/204 (56%), Gaps = 11/204 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FISFEGI+G+GK+T ++L + +L+R + +    REPGGT A E  R +LL      F  
Sbjct: 1   MFISFEGIDGSGKSTQVALFREYLERNSMEYVFIREPGGTQAGEDIREILLHNEYKLF-P 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E E ++F A+R   V  VI PAL + K++L DRFLDSS AYQG         + +L E S
Sbjct: 60  ETELLLFMASRAQIVREVIIPALKKKKLVLADRFLDSSVAYQGYGRGLSIQMVTTLNEFS 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQN--RYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
              V P  T+ +D+PVD+ +KR++   ++   E   LD+F+R         RQ +L++A+
Sbjct: 120 TGGVTPHLTLFIDVPVDVAVKRMRREMKHDKIEMESLDFFKRV--------RQGYLELAK 171

Query: 183 NQPDRCHIVDSAHSFQSVATNILN 206
             P R  ++D   S + +   ++ 
Sbjct: 172 RDPKRILVIDGTMSVEKIHEQVVK 195


>gi|149376737|ref|ZP_01894495.1| thymidylate kinase [Marinobacter algicola DG893]
 gi|149358976|gb|EDM47442.1| thymidylate kinase [Marinobacter algicola DG893]
          Length = 210

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 115/211 (54%), Gaps = 6/211 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG GK+T ++     L     +  VTREPGGTP AE+ R +LL+   +   
Sbjct: 5   GQFITFEGTEGVGKSTQLANAASTLDALGVECVVTREPGGTPMAESIRELLLAPRDEPVN 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR  H+   I P L  G+ +LCDRF D+++AYQG         +  L+ +
Sbjct: 65  ETTELLLMFAARAQHLHTRILPELEAGRWVLCDRFTDATFAYQGGGRGVPTERIALLENL 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               V PD  ++LD PV+ G+ R ++R        LD FE++ V   E+ R+ +L  A N
Sbjct: 125 VQGTVRPDHVVLLDAPVETGMTRARHRGE------LDRFEQEAVAFFERIRETYLARAAN 178

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            P R HIVD++   ++V+  +  ++  LV +
Sbjct: 179 APGRYHIVDASQPIETVSAEVSGLLRNLVNR 209


>gi|283853941|ref|ZP_06371146.1| thymidylate kinase [Desulfovibrio sp. FW1012B]
 gi|283570672|gb|EFC18727.1| thymidylate kinase [Desulfovibrio sp. FW1012B]
          Length = 211

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 113/214 (52%), Gaps = 5/214 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EGIEG+GK+T I LL   L+R    V VTREPGG    +  R +LLS       +
Sbjct: 1   MFITLEGIEGSGKSTQIGLLTTALERTGRTVRVTREPGGCGLGQTLRAILLSLETRNLDS 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE  ++ A R  HV  VIRPAL  G+++LCDRF DS+ AYQG   S     L  L +++
Sbjct: 61  RAELFLYLADRAQHVAEVIRPALAAGQVVLCDRFADSTIAYQGYGRSLDVALLQQLNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNR-YSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           V    P  T++LD+  + GL+R   R      +A    FE + +  H + R  +  +A  
Sbjct: 121 VAGTWPQLTLLLDIDPEQGLRRALARNLQAGTTAAEGRFEAEHLDFHGRVRDGYRTLASL 180

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            P R   VD+     +VA      VW++V +R+ 
Sbjct: 181 HPRRFVTVDATPDAATVAAR----VWDVVSQRLG 210


>gi|163814924|ref|ZP_02206312.1| hypothetical protein COPEUT_01075 [Coprococcus eutactus ATCC 27759]
 gi|158449863|gb|EDP26858.1| hypothetical protein COPEUT_01075 [Coprococcus eutactus ATCC 27759]
          Length = 207

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 125/217 (57%), Gaps = 16/217 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+ EG +GAGKTT   LLK +L++K YDV +TR+PGG P +EA R V+L+    E G
Sbjct: 3   GIFITIEGPDGAGKTTQRELLKEYLEKKGYDVLITRDPGGNPISEAIREVILNKEFTEMG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS---L 120
              E +++A+AR   V+  I+PAL  G+ ++ DRF+DSS  YQG     + L +D+   +
Sbjct: 63  YMTELLLYASARAQLVKENIKPALEAGQAVIADRFVDSSAVYQG---IGRGLGVDTVYKI 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E ++Q +MPD T ++DL    G+ R +N+      A LD  E + +  H+K    +  +
Sbjct: 120 NEFALQGIMPDMTFLMDLNAQEGIARKKNQ------AELDRMENEKIEFHQKVVDGYRML 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           A   P+R   +D+          I  I+ + V+K+++
Sbjct: 174 ADMHPERIVKIDATLPINE----IHGIITKYVEKKLN 206


>gi|126726755|ref|ZP_01742595.1| Thymidylate kinase [Rhodobacterales bacterium HTCC2150]
 gi|126704084|gb|EBA03177.1| Thymidylate kinase [Rhodobacterales bacterium HTCC2150]
          Length = 209

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 112/204 (54%), Gaps = 10/204 (4%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEGI+G+GK+T    L   L    +DV  TREPGG+  AE  R +L+    D + AE
Sbjct: 12  FITFEGIDGSGKSTQAKRLVAHLTSLGHDVIHTREPGGSAGAEEIRRLLVEGDPDRWSAE 71

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL--QEI 123
            E ++F AAR DH+E  I PAL  GK ++ DRF DS+  YQG         +D+L  Q I
Sbjct: 72  TEILLFTAARRDHLEKTIIPALAAGKWVVSDRFADSTRVYQGATRGDLRGIVDALHAQMI 131

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            V+   PD T I+D+     L R      L   +  D FE   +   E+ RQ FLD+A++
Sbjct: 132 GVE---PDMTFIIDMDPVAALSR-----GLARKSGEDRFEDFGLDFQERLRQGFLDLAKD 183

Query: 184 QPDRCHIVDSAHSFQSVATNILNI 207
            PDRC ++D +    +V+ +I  +
Sbjct: 184 YPDRCRLIDGSRGIDAVSADITAV 207


>gi|331270648|ref|YP_004397140.1| thymidylate kinase [Clostridium botulinum BKT015925]
 gi|329127198|gb|AEB77143.1| thymidylate kinase [Clostridium botulinum BKT015925]
          Length = 210

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 124/215 (57%), Gaps = 10/215 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN G+FI+ EG +G+GKTT + +++++L+  N D   TREPGG   +E  R ++L     
Sbjct: 1   MNKGVFITLEGPDGSGKTTIVKMIEKYLKENNVDYISTREPGGINISEQIREIILDTKNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
           E  A  EA+++ A+R  H+   + PAL  GKI++CDRF+DSS AYQG    ++ + +D  
Sbjct: 61  EMDARTEALLYVASRRQHLAERVIPALKLGKIVICDRFIDSSLAYQG---YARGIGIDEV 117

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+ E ++   MP+ T+ LD+  +IGLKR+   +  RE   LD  E+ D   H+K R+ +
Sbjct: 118 MSINEFAIDGYMPNLTLYLDIEPEIGLKRISQNHK-REVNRLD-LEKLD--FHKKVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +    P+R   +++      V  ++ N +  +V
Sbjct: 174 FKVLEKYPNRIKKINANQPIDKVFEDVKNYLKFMV 208


>gi|261380492|ref|ZP_05985065.1| dTMP kinase [Neisseria subflava NJ9703]
 gi|284796744|gb|EFC52091.1| dTMP kinase [Neisseria subflava NJ9703]
          Length = 208

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 117/199 (58%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + ++    V  TREPGGTPA EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVMKAWFEKHQLPVLFTREPGGTPAGEALREILLNPAT-QVGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR  H+E VI PAL  G  ++ DRF D+++AYQG         + +L+    
Sbjct: 64  TETLLMFAARQQHLETVILPALKNGTHVVSDRFTDATFAYQGGGRGVPLQDIATLEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
            +  PD T++LD+P+++ + R+      RE    D FE+++     + R+++L  A  QP
Sbjct: 124 GDFRPDLTLLLDVPLEVSMARINQ---TREK---DRFEQEEAEFFNRVREVYLQRANEQP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++DS+ S  +V   I
Sbjct: 178 ERYAVIDSSQSLDAVKNQI 196


>gi|150015005|ref|YP_001307259.1| dTMP kinase [Clostridium beijerinckii NCIMB 8052]
 gi|189028831|sp|A6LPM3|KTHY_CLOB8 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|149901470|gb|ABR32303.1| dTMP kinase [Clostridium beijerinckii NCIMB 8052]
          Length = 213

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 123/211 (58%), Gaps = 10/211 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI FEG EG GKTT I  +  ++   N++   TREPGG   +E  R V+LS    
Sbjct: 1   MKKGLFIVFEGGEGTGKTTAIDAIYDWITENNFECIKTREPGGIKISEQIRQVILSKDNK 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
           E  A+ EA+++AAAR  H+   + PAL +G I+LCDRF+DSS AYQG    +++L ++  
Sbjct: 61  EMDAKTEALLYAAARRQHLVEKVIPALNQGVIVLCDRFIDSSLAYQG---YARNLGIEEV 117

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+ + ++ E MPD +++ DL   IGL R+ N    RE   LD    + +  HE+ R+ +
Sbjct: 118 LSINKFAIGEYMPDISVLFDLDPKIGLARIANN-DCREVNRLDI---EKLEFHERVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
             + +N   R   +D+ ++ ++V   I NI+
Sbjct: 174 DIVYKNNNHRIVKIDANNTKENVINQIKNIL 204


>gi|255320788|ref|ZP_05361963.1| thymidylate kinase [Acinetobacter radioresistens SK82]
 gi|255302165|gb|EET81407.1| thymidylate kinase [Acinetobacter radioresistens SK82]
          Length = 202

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 114/209 (54%), Gaps = 8/209 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  +    ++K  ++ +TREPGGTP AE  R +LLS   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIREIYAHYEQKGAEIILTREPGGTPLAEQIRALLLSVSHDEKMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL  GK +LCDRF D+S+AYQ          L  L + 
Sbjct: 61  DDTELLLMYAARAQHLQQVILPALQAGKTVLCDRFTDASFAYQCAGRGLNENKLAVLNQS 120

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            V   MPD T+ LD PV++G+ R       RE   LD FE++ V   EK R  +  + + 
Sbjct: 121 FVSR-MPDITLWLDAPVELGMSRA------RERGALDRFEQEKVSFFEKVRAGYTRLWQQ 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            P+R   +D+  + + V    L  + +L 
Sbjct: 174 HPERIKRLDATQAPEKVLEQALEQIGKLA 202


>gi|239825610|ref|YP_002948234.1| thymidylate kinase [Geobacillus sp. WCH70]
 gi|259494272|sp|C5D352|KTHY_GEOSW RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|239805903|gb|ACS22968.1| thymidylate kinase [Geobacillus sp. WCH70]
          Length = 210

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 121/215 (56%), Gaps = 10/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F SFEG +GAGKTT I+ L+ FL+ K +DV +TREPGG   AE  R ++L+    E  
Sbjct: 3   GRFFSFEGPDGAGKTTMITKLESFLREKGFDVLLTREPGGVRIAEEIRSIILNPKHTEMD 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA+++AAAR  H+   I PA+  GKI+LCDRF+DSS AYQG    ++ L +D + +I
Sbjct: 63  GRTEALLYAAARRQHLLEKIIPAIKAGKIVLCDRFVDSSLAYQG---FARGLGIDEILQI 119

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              ++    P  TI  D+   IGL+R+Q     RE   LD    + +  H K R+ +L I
Sbjct: 120 NQFAIDGFFPSLTIYFDIDPKIGLERIQKNKQ-REINRLDM---ESLSFHYKVREGYLKI 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A    DR  ++D++     V    +  V + ++ R
Sbjct: 176 AERFSDRIIVIDASKPVDEVFAMTIAAVMDQIEGR 210


>gi|326795549|ref|YP_004313369.1| Thymidylate kinase [Marinomonas mediterranea MMB-1]
 gi|326546313|gb|ADZ91533.1| Thymidylate kinase [Marinomonas mediterranea MMB-1]
          Length = 208

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 119/212 (56%), Gaps = 6/212 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG+GK+T I+ L+++++ +     +TREPGGTP AE  R V+LS   +   
Sbjct: 3   GKFITLEGGEGSGKSTAIACLEQWMKAQGIPYLLTREPGGTPLAEEIRQVVLSKRDETVN 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           +  E ++  AAR  HV   I PAL  G  ++ DRF+DSSY YQG         +DSL  +
Sbjct: 63  SITELLLVFAARAQHVAQKIAPALESGVWVISDRFIDSSYVYQGVARGLDIEDIDSLVRL 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V   +PD TI+LD+PV +G+ RV  R         D  + +    HE  R  FLD+A+ 
Sbjct: 123 AVGASLPDKTILLDVPVSVGMARVSARTG------NDRLDGESTQFHEMVRAGFLDLAKR 176

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
              R  IVD++   ++V   I+ I+ ++ Q +
Sbjct: 177 DSHRISIVDASVPQENVFEQIVTILEQVKQAK 208


>gi|159039919|ref|YP_001539172.1| dTMP kinase [Salinispora arenicola CNS-205]
 gi|157918754|gb|ABW00182.1| dTMP kinase [Salinispora arenicola CNS-205]
          Length = 703

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 81/216 (37%), Positives = 121/216 (56%), Gaps = 12/216 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-SCGV 59
           +++GLF+ FEG EGAGK+T ++LL   L+ +  DV VTREPG T   E  R +LL   G 
Sbjct: 445 VSAGLFVVFEGGEGAGKSTQLALLAARLRDQGRDVVVTREPGATGIGERIRSLLLGQPGS 504

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +     AEA+++AA R  HV  V+RPAL  G +++ DR++DSS AYQG   + + L +D 
Sbjct: 505 EVPSPRAEALLYAADRAHHVATVVRPALARGAVVVSDRYIDSSLAYQG---AGRTLPVDE 561

Query: 120 LQEIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +  +S      + PD  ++LD+    GL RV  R     S   D+ E + V  HE+ R  
Sbjct: 562 VSWLSSWATGGLKPDLVVLLDIDPHTGLSRVAVR-----SGATDHLEAESVSFHERVRYA 616

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           FLD+A   P    ++D+A     +A  +   + EL+
Sbjct: 617 FLDLAATDPKHYLVLDAARPADEIADEVARRITELL 652


>gi|331703062|ref|YP_004399749.1| Thymidylate kinase [Mycoplasma mycoides subsp. capri LC str. 95010]
 gi|328801617|emb|CBW53770.1| Thymidylate kinase [Mycoplasma mycoides subsp. capri LC str. 95010]
          Length = 213

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 125/216 (57%), Gaps = 7/216 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG++G+GKTT +  +K+ L+R NY V +TREPGG   AE  R ++L     +  A
Sbjct: 1   MFITFEGMDGSGKTTALLKVKKELERLNYQVLITREPGGEAIAEQIRQIILDNKNKDMDA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++F A+R  H++ VI+PAL +  I++ DRF+DS+ AYQG   S++++ +D + E+ 
Sbjct: 61  WTEALLFIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQG---SARNIGVDVVSEVQ 117

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            Q V+ +C   L L  D+     + R  +R  +  +  +++     +K  Q +L++ +N 
Sbjct: 118 -QIVLKNCLPDLTLFFDVSFSEAEKRMQIRGESSKNRLDKEKSDFKQKVYQGYLELVKNN 176

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV---QKRVS 217
           P R  ++D+      V    + I+ E +   +KR S
Sbjct: 177 PKRIKVIDANQDIDQVYNQAIKIILEKLKENEKRTS 212


>gi|315501244|ref|YP_004080131.1| thymidylate kinase [Micromonospora sp. L5]
 gi|315407863|gb|ADU05980.1| thymidylate kinase [Micromonospora sp. L5]
          Length = 717

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 79/216 (36%), Positives = 123/216 (56%), Gaps = 12/216 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           ++SGLF+ FEG EGAGK+T ++ L   L+ +  DV VTREPG TP  +  R ++L     
Sbjct: 474 VSSGLFVVFEGGEGAGKSTQLAELAERLRAQGRDVVVTREPGATPVGKRIRSLVLGTNPG 533

Query: 61  EFGA-EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           E  +  AEA+++AA R  HV  V+RPAL+ G +++ DR++DSS AYQG   + + L +D 
Sbjct: 534 EAPSPRAEALLYAADRAHHVATVVRPALVRGAVVISDRYVDSSLAYQG---AGRTLPVDE 590

Query: 120 LQEIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +  +S      + PD  ++LD+    GL RV++R     +   D  E + +  HE+ R  
Sbjct: 591 VSWLSSWATGGLKPDLVVLLDVEPRTGLSRVEDR-----NEGTDRLEAESLTFHERVRYA 645

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           FLD+A   P R  ++D++      A  +   V EL+
Sbjct: 646 FLDLAAGDPKRYLVLDASRPIDETADAVARRVGELL 681


>gi|270291181|ref|ZP_06197404.1| thymidylate kinase [Pediococcus acidilactici 7_4]
 gi|270280577|gb|EFA26412.1| thymidylate kinase [Pediococcus acidilactici 7_4]
          Length = 210

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 125/214 (58%), Gaps = 5/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M +G FISFEG +GAGKTT + ++++ +  R    + VTREPGG P +EA R ++L    
Sbjct: 1   MVNGHFISFEGPDGAGKTTILEAMVEHYRTRLADRLTVTREPGGNPISEAIRAIILDKNN 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            E  A  EA+++AAAR  H+   I PAL  G+++ CDR++DSS AYQG         +  
Sbjct: 61  TEMDARTEALLYAAARRQHLTETILPALARGQVVFCDRYVDSSIAYQGAGREIGPEAVYQ 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +   + +  +P+ TI LD+  ++GLKR+        +  +D  + + +  HE+ R  +L 
Sbjct: 121 MNLFATEGCLPEKTIYLDVSAEVGLKRIMT----HRTDDVDRLDLEQLDFHERVRDAYLA 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +A+  P+R  ++D++ S   V   ++N++ ++++
Sbjct: 177 LAKRYPERIVVIDASQSIGDVKKAVINVLDQILK 210


>gi|217976730|ref|YP_002360877.1| dTMP kinase [Methylocella silvestris BL2]
 gi|217502106|gb|ACK49515.1| dTMP kinase [Methylocella silvestris BL2]
          Length = 233

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 125/213 (58%), Gaps = 6/213 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G  I+ EG EG GK+T I  L + L+ +  +   TREPGG+  AE  R VLLS  V   G
Sbjct: 15  GRLITLEGGEGVGKSTQIGRLLQRLRDEGIEAVATREPGGSEGAEILRRVLLSGVVKPLG 74

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEAI+FAAAR+DH++ +I PAL  G  ++ DRF DS+ AYQG   S  +  +++L+  
Sbjct: 75  PAAEAILFAAARIDHIDALIEPALAAGIWVVSDRFADSTRAYQGGAGSLDNRLINALERT 134

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ ++ PD T+ILDLP   GL+R   R    ++  +D FE +D+  HE  R  FL IA +
Sbjct: 135 ALGDLQPDLTLILDLPPGEGLRRAAARRK--DADGVDRFEGEDLRFHEAIRAAFLTIAAD 192

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            P RC +VD++ S   VA  I    W  V  R+
Sbjct: 193 NPQRCVVVDASASEVEVAAAI----WTAVSDRL 221


>gi|257879313|ref|ZP_05658966.1| thymidylate kinase [Enterococcus faecium 1,230,933]
 gi|257881871|ref|ZP_05661524.1| thymidylate kinase [Enterococcus faecium 1,231,502]
 gi|257885061|ref|ZP_05664714.1| thymidylate kinase [Enterococcus faecium 1,231,501]
 gi|257890139|ref|ZP_05669792.1| thymidylate kinase [Enterococcus faecium 1,231,410]
 gi|257893467|ref|ZP_05673120.1| thymidylate kinase [Enterococcus faecium 1,231,408]
 gi|258615719|ref|ZP_05713489.1| thymidylate kinase [Enterococcus faecium DO]
 gi|260558755|ref|ZP_05830944.1| thymidylate kinase [Enterococcus faecium C68]
 gi|261207350|ref|ZP_05922037.1| thymidylate kinase [Enterococcus faecium TC 6]
 gi|289566857|ref|ZP_06447266.1| thymidylate kinase [Enterococcus faecium D344SRF]
 gi|293559585|ref|ZP_06676119.1| thymidylate kinase [Enterococcus faecium E1162]
 gi|293567580|ref|ZP_06678924.1| thymidylate kinase [Enterococcus faecium E1071]
 gi|294615743|ref|ZP_06695593.1| thymidylate kinase [Enterococcus faecium E1636]
 gi|294617668|ref|ZP_06697295.1| thymidylate kinase [Enterococcus faecium E1679]
 gi|294621756|ref|ZP_06700916.1| thymidylate kinase [Enterococcus faecium U0317]
 gi|257813541|gb|EEV42299.1| thymidylate kinase [Enterococcus faecium 1,230,933]
 gi|257817529|gb|EEV44857.1| thymidylate kinase [Enterococcus faecium 1,231,502]
 gi|257820913|gb|EEV48047.1| thymidylate kinase [Enterococcus faecium 1,231,501]
 gi|257826499|gb|EEV53125.1| thymidylate kinase [Enterococcus faecium 1,231,410]
 gi|257829846|gb|EEV56453.1| thymidylate kinase [Enterococcus faecium 1,231,408]
 gi|260075214|gb|EEW63527.1| thymidylate kinase [Enterococcus faecium C68]
 gi|260078410|gb|EEW66114.1| thymidylate kinase [Enterococcus faecium TC 6]
 gi|289161345|gb|EFD09236.1| thymidylate kinase [Enterococcus faecium D344SRF]
 gi|291589681|gb|EFF21485.1| thymidylate kinase [Enterococcus faecium E1071]
 gi|291591394|gb|EFF23053.1| thymidylate kinase [Enterococcus faecium E1636]
 gi|291596075|gb|EFF27341.1| thymidylate kinase [Enterococcus faecium E1679]
 gi|291598643|gb|EFF29700.1| thymidylate kinase [Enterococcus faecium U0317]
 gi|291606461|gb|EFF35861.1| thymidylate kinase [Enterococcus faecium E1162]
          Length = 214

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +GLFI+ EG +GAGKT+ ++ L   L+     ++  TREPGG P AE  R V+L    D 
Sbjct: 2   NGLFITIEGPDGAGKTSILNELYPLLKEVAKTEIIQTREPGGIPIAEEIRAVILDPKNDR 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   + PAL +GKI+LCDRF+DSS AYQG         +  L 
Sbjct: 62  MDERTEALLYAAARRQHLVEKVLPALAKGKIVLCDRFVDSSLAYQGAGRRIGVTEIARLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E + +   PD T+ LD+  D GL+R+ +NR +      +D  + + +  H++ R  +L +
Sbjct: 122 EFATEGTTPDFTLYLDVDSDTGLRRIKKNRQN-----QIDRLDSEGLEFHQRVRHAYLKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A   P+R H VD+  SF+ V     + + E
Sbjct: 177 AEENPERIHKVDARKSFEEVLQTSYHTIIE 206


>gi|58336718|ref|YP_193303.1| thymidylate kinase [Lactobacillus acidophilus NCFM]
 gi|73920822|sp|Q5FM02|KTHY_LACAC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|58254035|gb|AAV42272.1| thymidylate (dTMP) kinase [Lactobacillus acidophilus NCFM]
          Length = 216

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 120/213 (56%), Gaps = 8/213 (3%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            G F+SFEG +GAGK+T +  +L     +      VTREPGG+  AE  R ++L    D+
Sbjct: 2   KGYFVSFEGPDGAGKSTVLKEVLAEIAPQLKTQYLVTREPGGSKIAEKIRDIILDPANDK 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              + EA+++AAAR  HVE +I+PA+ EGK++  DRF+DSS AYQG+        +  + 
Sbjct: 62  MDPKTEALLYAAARSQHVEEIIKPAINEGKVVFSDRFVDSSLAYQGQGRDLGIAKVKQIN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +  ++ PD T  LD+  +IGL R++     +E    D  E++D+  H+K  + FL + 
Sbjct: 122 DFATDKLDPDLTFFLDIAPEIGLSRIKKLRPAQE----DRLEQEDIAFHQKVYEGFLKVI 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +  PDR  ++++      V   +  +V EL Q+
Sbjct: 178 KMYPDRFVVINATQPIDQV---VKQVVTELKQR 207


>gi|138893702|ref|YP_001124155.1| thymidylate kinase [Geobacillus thermodenitrificans NG80-2]
 gi|196250745|ref|ZP_03149432.1| dTMP kinase [Geobacillus sp. G11MC16]
 gi|166221745|sp|A4IJA6|KTHY_GEOTN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|134265215|gb|ABO65410.1| Thymidylate kinase [Geobacillus thermodenitrificans NG80-2]
 gi|196209695|gb|EDY04467.1| dTMP kinase [Geobacillus sp. G11MC16]
          Length = 225

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 118/207 (57%), Gaps = 6/207 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G F SFEG EGAGKTT I  L+ FL+ + +DV VTREPGG   AEA R ++L+    E 
Sbjct: 2   NGYFFSFEGPEGAGKTTMIGKLESFLRERGFDVMVTREPGGVRIAEAIRALILNREYTEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G+++LCDRF+DSS AYQG         +  + E
Sbjct: 62  DGRTEALLYAAARRQHLLEKIVPALEAGRVVLCDRFVDSSLAYQGFARGLGVEEVWKINE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            ++   MP  T+  D+   IGL+R+ QNR   RE   LD    + +  H+K R+ +  +A
Sbjct: 122 FAIDGYMPSLTVYFDIDPQIGLERIRQNRE--REVNRLDL---ETLSFHDKVREGYRKLA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           +   +R  ++D++     V +  +  V
Sbjct: 177 KRFAERIVVIDASRPLDDVFSETVATV 203


>gi|33592905|ref|NP_880549.1| thymidylate kinase [Bordetella pertussis Tohama I]
 gi|33596203|ref|NP_883846.1| thymidylate kinase [Bordetella parapertussis 12822]
 gi|33601614|ref|NP_889174.1| thymidylate kinase [Bordetella bronchiseptica RB50]
 gi|46576478|sp|Q7VXD2|KTHY_BORPE RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|46576488|sp|Q7WA31|KTHY_BORPA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|46576494|sp|Q7WJ63|KTHY_BORBR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|33572553|emb|CAE42133.1| thymidylate kinase [Bordetella pertussis Tohama I]
 gi|33573206|emb|CAE36861.1| thymidylate kinase [Bordetella parapertussis]
 gi|33576051|emb|CAE33130.1| thymidylate kinase [Bordetella bronchiseptica RB50]
          Length = 208

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 117/211 (55%), Gaps = 9/211 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+TH + + + L+     V  TREPGGTP  E  R +LLS   +   
Sbjct: 5   GRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPVGEKLRELLLS---EPMA 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E E ++  AAR +HV  VI PAL  G+ ++CDRF D+SYAYQG         + +L++ 
Sbjct: 62  LETETLLMFAARCEHVREVIAPALARGEWVVCDRFTDASYAYQGGGRQLGAARVAALEQW 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T + D+P+D+       R  L  S  LD FER++    E+ R  + + AR+
Sbjct: 122 VHPDLQPDRTWLFDVPLDVA------RARLARSRQLDRFEREEDAFFERTRAAYHERARS 175

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
              R  I+DS+   + V   + + V ELV +
Sbjct: 176 SDGRIRIIDSSRPLEVVRAQLDSEVRELVAQ 206


>gi|257094047|ref|YP_003167688.1| thymidylate kinase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257046571|gb|ACV35759.1| dTMP kinase [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 211

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGI+GAGK++HI+ +  FL+R+   V  TREPGGTP  EA R +LL    +   
Sbjct: 10  GKFITFEGIDGAGKSSHIAGVAAFLRRRGLQVLTTREPGGTPLGEALRELLLH---EAMH 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E EA++  AAR +H+  VI PAL  G  ++CDRF D++YAYQ      +      L+E 
Sbjct: 67  LETEALLMFAARREHLARVIEPALERGDWVVCDRFSDATYAYQSGGRGLERKKFAQLEEW 126

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               + PD T++ DL   I   R+     + ++  LD FE++    HE+ R+ +L+ A  
Sbjct: 127 VHSHLQPDLTLLFDLSSSIASGRI-----VAQARELDRFEQERSDFHERVRRAYLERAIA 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P R  I+D+  + +++   I +I+
Sbjct: 182 APQRIQIIDAEQAPEAIKKMIEDII 206


>gi|85706301|ref|ZP_01037395.1| thymidylate kinase [Roseovarius sp. 217]
 gi|85669074|gb|EAQ23941.1| thymidylate kinase [Roseovarius sp. 217]
          Length = 208

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 112/207 (54%), Gaps = 6/207 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLF+SFEGI+G+GK+T    L   L+    DV +TREPGG+P AE  R ++L    D 
Sbjct: 3   GQGLFLSFEGIDGSGKSTQARRLAEALRGVGRDVVLTREPGGSPGAEEIRRLVLEGDKDR 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E VI PAL  G +++CDRF DS+  YQG   S     +D L 
Sbjct: 63  WSAETEILLFTAARRDHLERVIAPALDRGAVVICDRFADSTRMYQGLGRSDLRGLVDQLH 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD T+++D+   +GL R  +R           FE     +  + R  FL +A
Sbjct: 123 GLMIGR-EPDLTVLIDIDPGVGLGRALSR-----GGAEARFESFGEGMQARMRAGFLALA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    R  ++D A    +VA ++  +V
Sbjct: 177 QEFAPRFAVIDGAGDLDAVAEDVARVV 203


>gi|325962187|ref|YP_004240093.1| thymidylate kinase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468274|gb|ADX71959.1| thymidylate kinase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 231

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 115/210 (54%), Gaps = 5/210 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG +GAGK+T  +LL   L+ +   V  TREPGGTP  E  R ++L  G    
Sbjct: 6   SGLFIAFEGGDGAGKSTQAALLAETLEARGLAVLRTREPGGTPIGEKLRSLVLDHGHGLI 65

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA++FAA+R  H   VIRPAL  G+++L DR++DSS AYQG   +     + SL E
Sbjct: 66  DAHTEALIFAASRAAHASQVIRPALERGEVVLTDRYIDSSVAYQGAGRALGEDAVRSLNE 125

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + P  T++LD+   +G  R          A  D  E +    H + R  FLD+AR
Sbjct: 126 WATSGLQPHLTVLLDVDPAVGRSRRTA-----GDAAEDRMESEADEFHARIRDAFLDLAR 180

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +P+   ++ + H    +++ IL  V  L+
Sbjct: 181 RRPESYLVLPAHHPVSELSSRILARVDALL 210


>gi|323465901|gb|ADX69588.1| Thymidylate kinase [Lactobacillus helveticus H10]
          Length = 216

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 120/206 (58%), Gaps = 11/206 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G F+SFEG +GAGK+T +  +L +   +      VTREPGG+  AE  R ++L    D+ 
Sbjct: 7   GYFVSFEGPDGAGKSTVLKEVLDQIGPKLKPQYLVTREPGGSKIAEKIRDIILDPANDKM 66

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AAAR  HVE +IRPAL +GKI+  DRF+DSS AYQGE    + L ++ +++
Sbjct: 67  DAKTEALLYAAARSQHVEEIIRPALSDGKIVFSDRFVDSSLAYQGE---GRDLGIEEVKQ 123

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +  ++ PD T  LD+  +IGL R+Q     +E    D  E++++  H+K    FL 
Sbjct: 124 INDFATGKLDPDLTFFLDIAPEIGLSRIQKLRPGQE----DRLEQENIAFHKKVYNGFLK 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNIL 205
           +    PDR   +D+    + V   ++
Sbjct: 180 VKDLYPDRFVTIDATQPIEDVVNQVI 205


>gi|227903280|ref|ZP_04021085.1| thymidylate (dTMP) kinase [Lactobacillus acidophilus ATCC 4796]
 gi|227868909|gb|EEJ76330.1| thymidylate (dTMP) kinase [Lactobacillus acidophilus ATCC 4796]
          Length = 220

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 120/213 (56%), Gaps = 8/213 (3%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            G F+SFEG +GAGK+T +  +L     +      VTREPGG+  AE  R ++L    D+
Sbjct: 6   KGYFVSFEGPDGAGKSTVLKEVLAEIAPQLKTQYLVTREPGGSKIAEKIRDIILDPANDK 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              + EA+++AAAR  HVE +I+PA+ EGK++  DRF+DSS AYQG+        +  + 
Sbjct: 66  MDPKTEALLYAAARSQHVEEIIKPAINEGKVVFSDRFVDSSLAYQGQGRDLGIAKVKQIN 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +  ++ PD T  LD+  +IGL R++     +E    D  E++D+  H+K  + FL + 
Sbjct: 126 DFATDKLDPDLTFFLDIAPEIGLSRIKKLRPAQE----DRLEQEDIAFHQKVYEGFLKVI 181

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +  PDR  ++++      V   +  +V EL Q+
Sbjct: 182 KMYPDRFVVINATQPIDQV---VKQVVTELKQR 211


>gi|221307837|ref|ZP_03589684.1| thymidylate kinase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221312159|ref|ZP_03593964.1| thymidylate kinase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221317092|ref|ZP_03598386.1| thymidylate kinase [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221321355|ref|ZP_03602649.1| thymidylate kinase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|255767017|ref|NP_387909.2| thymidylate kinase [Bacillus subtilis subsp. subtilis str. 168]
 gi|239938655|sp|P37537|KTHY_BACSU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|225184644|emb|CAB11804.2| thymidylate kinase [Bacillus subtilis subsp. subtilis str. 168]
          Length = 212

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 126/215 (58%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
             + EA+++AAAR  H+   ++PAL +G I+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E ++ ++MP  T+   +  + GLKR+    S RE   LD  E+ D   H K ++ + +
Sbjct: 119 INEFAIGDMMPHVTVYFSIDPEEGLKRIYANGS-REKNRLD-LEKLD--FHTKVQEGYQE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R H VD+  S   V  ++L ++ E ++K
Sbjct: 175 LMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKK 209


>gi|254475335|ref|ZP_05088721.1| thymidylate kinase [Ruegeria sp. R11]
 gi|214029578|gb|EEB70413.1| thymidylate kinase [Ruegeria sp. R11]
          Length = 227

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 115/206 (55%), Gaps = 6/206 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++FEGI+G+GK+T   +L   L+ +  DV +TREPGG+  AE  R ++L    D +
Sbjct: 15  GGLFVTFEGIDGSGKSTQCRMLADTLRARGLDVVLTREPGGSDGAEEIRRLVLEGDPDRW 74

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE E ++F AAR DH+E  I PAL  G++++CDRF DS+  YQG         +D L  
Sbjct: 75  SAETELLLFTAARRDHLERRILPALAAGQVVVCDRFADSTRMYQGLSRGDLRASVDQLHR 134

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +    PD TI++D+    GL R + R    E      FE   + + ++ R  FL +A+
Sbjct: 135 LMIGH-EPDLTILIDMDPAKGLARAKGRQGSEE-----RFEDFGLDLQQRMRAGFLALAQ 188

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
              +R  ++D       VA ++L+IV
Sbjct: 189 EFANRFRVIDGDRPMDVVAQDVLDIV 214


>gi|261338416|ref|ZP_05966300.1| dTMP kinase [Bifidobacterium gallicum DSM 20093]
 gi|270276387|gb|EFA22241.1| dTMP kinase [Bifidobacterium gallicum DSM 20093]
          Length = 200

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 120/208 (57%), Gaps = 22/208 (10%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-----SCGV 59
           +FI+FEGI+GAGKTT + LL + LQ     V VTREPGGT    + R +LL        +
Sbjct: 1   MFITFEGIDGAGKTTQVKLLAQALQEAGRSVEVTREPGGTALGASLRRLLLEGVADGSAI 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           DE    AEA++FAA R  HV  VIRPA+  G  ++CDR++DSS AYQG     + +  D 
Sbjct: 61  DE---HAEALMFAADRAQHVAQVIRPAMQRGDDVICDRYIDSSVAYQG---GGRDIGADQ 114

Query: 120 LQEISVQE---VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           ++ +S+     ++PD TI+LDL   +   R+ NR + R  +  D F R+        R+ 
Sbjct: 115 IRALSMWATGGLVPDLTIVLDLDPALSAARL-NRPADRMESAGDEFARRT-------REA 166

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNI 204
           FL +A  +P+R  ++D++   + +A ++
Sbjct: 167 FLAMAAAEPERFRVIDASLPVERIAADV 194


>gi|22537716|ref|NP_688567.1| thymidylate kinase [Streptococcus agalactiae 2603V/R]
 gi|25011666|ref|NP_736061.1| thymidylate kinase [Streptococcus agalactiae NEM316]
 gi|76787087|ref|YP_330195.1| thymidylate kinase [Streptococcus agalactiae A909]
 gi|76799459|ref|ZP_00781603.1| thymidylate kinase [Streptococcus agalactiae 18RS21]
 gi|77408332|ref|ZP_00785074.1| thymidylate kinase [Streptococcus agalactiae COH1]
 gi|46576569|sp|Q8DYB3|KTHY_STRA5 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|46576575|sp|Q8E3X8|KTHY_STRA3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|123601435|sp|Q3JZV8|KTHY_STRA1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|22534605|gb|AAN00440.1|AE014263_19 thymidylate kinase [Streptococcus agalactiae 2603V/R]
 gi|24413206|emb|CAD47285.1| unknown [Streptococcus agalactiae NEM316]
 gi|76562144|gb|ABA44728.1| thymidylate kinase [Streptococcus agalactiae A909]
 gi|76585186|gb|EAO61800.1| thymidylate kinase [Streptococcus agalactiae 18RS21]
 gi|77173095|gb|EAO76222.1| thymidylate kinase [Streptococcus agalactiae COH1]
 gi|319745548|gb|EFV97850.1| thymidylate kinase [Streptococcus agalactiae ATCC 13813]
          Length = 211

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 121/215 (56%), Gaps = 5/215 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M  GL ISFEG +GAGKTT +  +   L+ K + D+  TREPGG   +E  RH++L    
Sbjct: 1   MKKGLMISFEGPDGAGKTTVLEAVLPLLREKLSQDILTTREPGGVTISEEIRHIILDVKH 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            +   + E +++ AAR  H+   + PAL EGKI+L DRF+DSS AYQG         +  
Sbjct: 61  TQMDKKTELLLYMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKW 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L + +     PD T+  D+P ++GL+R+Q     RE   LD  E+ D  +H++ RQ +L+
Sbjct: 121 LNDYATDSHKPDLTLYFDVPSEVGLERIQKSVQ-REVNRLD-LEQLD--MHQRVRQGYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +A ++P+R   +D++     V     +I+ + + +
Sbjct: 177 LADSEPNRIVTIDASQQLDEVIAETFSIILDRINQ 211


>gi|304312953|ref|YP_003812551.1| Thymidylate kinase [gamma proteobacterium HdN1]
 gi|301798686|emb|CBL46918.1| Thymidylate kinase [gamma proteobacterium HdN1]
          Length = 216

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 113/208 (54%), Gaps = 6/208 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GL I+ EG EG GK+T++  ++  L  +      TREPGGTP AE  R +LL+   +
Sbjct: 1   MKPGLLITLEGTEGVGKSTNLQFIRDTLSEQKIPFICTREPGGTPLAETLRELLLAPRDE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            F   AE ++  AAR  H+ +VIRPAL  G  ++CDRF D+++AYQG         +  L
Sbjct: 61  PFDPLAELLIMFAARAQHIAHVIRPALERGLWVICDRFTDATFAYQGGGRGVPMNIIAQL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           + +  +E+ PD  I+LD+   +GL+R   R      A  D FER+     E+ R ++L+ 
Sbjct: 121 EALVQRELRPDAVILLDISPQLGLERAGQR------AAPDRFERERCEFFERVRSVYLER 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P R + VD++     V   + +I+
Sbjct: 175 ADADPARYYRVDASRPLVDVQQELKDIL 202


>gi|90962199|ref|YP_536115.1| thymidylate kinase [Lactobacillus salivarius UCC118]
 gi|227891204|ref|ZP_04009009.1| thymidylate kinase [Lactobacillus salivarius ATCC 11741]
 gi|122448751|sp|Q1WSU7|KTHY_LACS1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|90821393|gb|ABE00032.1| Thymidylate kinase [Lactobacillus salivarius UCC118]
 gi|227867078|gb|EEJ74499.1| thymidylate kinase [Lactobacillus salivarius ATCC 11741]
          Length = 208

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 124/207 (59%), Gaps = 7/207 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-TREPGGTPAAEAARHVLLSCGVDEF 62
           G FI+FEGI+G+GKT+ +  +   L  K  D ++ TREPGG   +EA R ++L+    E 
Sbjct: 3   GKFITFEGIDGSGKTSVLKGVIEHLNDKRIDNYIWTREPGGNRISEAIRKIILNVEYTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQ 121
            A  EA+++AAAR  H+ + + PAL EGK++LCDRF+DSS  YQG  RD      +  L 
Sbjct: 63  DARTEALLYAAARRQHLVDTVLPALNEGKLVLCDRFVDSSVVYQGVARDIGVEPVI-KLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E + + + PD T+  D+  +I LKR+ N    R++  +D  +++ +  + K RQ +L +A
Sbjct: 122 EFATENLKPDLTLYYDVEPEISLKRISNN---RQNQ-VDRLDKESMDFYHKVRQAYLSLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
            +  +R  ++D++ +   V  + L+I+
Sbjct: 178 ESNKERIKVIDASQNLDKVIDDTLSIL 204


>gi|167465293|ref|ZP_02330382.1| dTMP kinase [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322381217|ref|ZP_08055220.1| thymidylate kinase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154793|gb|EFX47064.1| thymidylate kinase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 221

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 123/216 (56%), Gaps = 5/216 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+F++FEG +G+GKTT I LL   L ++ + V  TREPGGTP ++  R ++LS    E  
Sbjct: 3   GVFVTFEGPDGSGKTTQIRLLADALNKQGFQVLQTREPGGTPISDQIRSLILSPEHQEMK 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E +++AA+R  HV  VI PAL +GKI+LCDRF+D+S AYQ      +   +  +   
Sbjct: 63  DQTEVLLYAASRAQHVHEVILPALKQGKIVLCDRFIDASLAYQAYGLGIEFESVIEVNRF 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++P+ T +LD+PV+I   R+  R        LD  E+K    H++ R+ F  I + 
Sbjct: 123 ASSGLLPNRTYLLDVPVEISRSRLTRR-----EEGLDRIEQKGRDYHQRVREGFHQIYKE 177

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
            P+R  ++++  + + +A  I    +  ++ ++  +
Sbjct: 178 NPERICLIEAEGNVEDIALRIQTDFFSWLKGKIGKM 213


>gi|314937925|ref|ZP_07845241.1| thymidylate kinase [Enterococcus faecium TX0133a04]
 gi|314941416|ref|ZP_07848309.1| thymidylate kinase [Enterococcus faecium TX0133C]
 gi|314948529|ref|ZP_07851909.1| thymidylate kinase [Enterococcus faecium TX0082]
 gi|314951284|ref|ZP_07854338.1| thymidylate kinase [Enterococcus faecium TX0133A]
 gi|314992885|ref|ZP_07858286.1| thymidylate kinase [Enterococcus faecium TX0133B]
 gi|314998089|ref|ZP_07862977.1| thymidylate kinase [Enterococcus faecium TX0133a01]
 gi|313587931|gb|EFR66776.1| thymidylate kinase [Enterococcus faecium TX0133a01]
 gi|313592689|gb|EFR71534.1| thymidylate kinase [Enterococcus faecium TX0133B]
 gi|313596501|gb|EFR75346.1| thymidylate kinase [Enterococcus faecium TX0133A]
 gi|313599839|gb|EFR78682.1| thymidylate kinase [Enterococcus faecium TX0133C]
 gi|313642783|gb|EFS07363.1| thymidylate kinase [Enterococcus faecium TX0133a04]
 gi|313645026|gb|EFS09606.1| thymidylate kinase [Enterococcus faecium TX0082]
          Length = 231

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +GLFI+ EG +GAGKT+ ++ L   L+     ++  TREPGG P AE  R V+L    D 
Sbjct: 19  NGLFITIEGPDGAGKTSILNELYPLLKEVAKTEIIQTREPGGIPIAEEIRAVILDPKNDR 78

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   + PAL +GKI+LCDRF+DSS AYQG         +  L 
Sbjct: 79  MDERTEALLYAAARRQHLVEKVLPALAKGKIVLCDRFVDSSLAYQGAGRRIGVTEIARLN 138

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E + +   PD T+ LD+  D GL+R+ +NR +      +D  + + +  H++ R  +L +
Sbjct: 139 EFATEGTTPDFTLYLDVDSDTGLRRIKKNRQN-----QIDRLDSEGLEFHQRVRHAYLKL 193

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A   P+R H VD+  SF+ V     + + E
Sbjct: 194 AEENPERIHKVDARKSFEEVLQTSYHTIIE 223


>gi|182678512|ref|YP_001832658.1| dTMP kinase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634395|gb|ACB95169.1| dTMP kinase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 237

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 118/214 (55%), Gaps = 5/214 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG EG GK+T    L    + +      TREPGG+P AE  R +LLS  +   G
Sbjct: 22  GFFITLEGGEGTGKSTQARKLVARFEAQGLRAIATREPGGSPNAEILRDILLSGVIKPLG 81

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA++F+AAR+DH++ VI+PAL  G  ++ DRF DS+  YQG   +     L  L++ 
Sbjct: 82  PLAEALMFSAARIDHLDQVIKPALAAGTTVVSDRFADSTRVYQGVAGNLDPHRLTLLEQA 141

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA-CLDYFERKDVMIHEKRRQIFLDIAR 182
            +   +PD T++LDL  + GL R   R +  +S    D FE +D+  H + R+ F  + +
Sbjct: 142 VLNGTVPDLTLVLDLAPETGLARAAARRANIDSGDGPDRFESEDLTYHRRLREAFRALPK 201

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            +P RC ++D+  S   V   +    W  +Q+R+
Sbjct: 202 REPGRCLLIDADASADIVTERL----WTAIQQRL 231


>gi|301300450|ref|ZP_07206650.1| dTMP kinase [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851947|gb|EFK79631.1| dTMP kinase [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 208

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 124/207 (59%), Gaps = 7/207 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-TREPGGTPAAEAARHVLLSCGVDEF 62
           G FI+FEGI+G+GKT+ +  +   L  K  D ++ TREPGG   +EA R ++L+    E 
Sbjct: 3   GKFITFEGIDGSGKTSVLKGVIEHLNGKKIDNYIWTREPGGNRISEAIRKIILNVEYTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQ 121
            A  EA+++AAAR  H+ + + PAL EGK++LCDRF+DSS  YQG  RD      +  L 
Sbjct: 63  DARTEALLYAAARRQHLVDTVLPALNEGKLVLCDRFVDSSVVYQGVARDIGVEPVI-KLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E + + + PD T+  D+  +I LKR+ N    R++  +D  +++ +  + K RQ +L +A
Sbjct: 122 EFATENLKPDLTLYYDVEPEISLKRISNN---RQNQ-VDRLDKESMDFYHKVRQAYLSLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
            +  +R  ++D++ +   V  + L+I+
Sbjct: 178 ESNKERIKVIDASQNLDKVIDDTLSIL 204


>gi|255023366|ref|ZP_05295352.1| thymidylate kinase [Listeria monocytogenes FSL J1-208]
          Length = 208

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD +    L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  I   
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKIINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|304315605|ref|YP_003850750.1| thymidylate kinase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302777107|gb|ADL67666.1| thymidylate kinase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 205

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 122/212 (57%), Gaps = 7/212 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G  I+FEGI+G+GKTT I+LLK +L     D+ V REPGGT   E  R++LL    +
Sbjct: 1   MYKGKLITFEGIDGSGKTTQINLLKEYLLNIGRDIVVLREPGGTSVGEKIRNILLDKK-N 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +    AEA+++AA+R + V+ VI P+L  GKI++ DRF+DSS  YQG         ++ +
Sbjct: 60  KIVPTAEALLYAASRAELVKEVIIPSLNNGKIVILDRFVDSSIVYQGYARGIGVKAVEEI 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             I++  ++PD TI LD+     +KR+  R         D  E +D+  HEK  + +  +
Sbjct: 120 NNIAIAGLVPDLTIYLDIKPKDTIKRIDRRKD------KDRLEMEDLEFHEKVYEGYKQL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +++PDR  ++D+ H    +  +I+  + +++
Sbjct: 174 IKSRPDRYLVIDATHDIDYIQKSIVKEISKII 205


>gi|85708666|ref|ZP_01039732.1| thymidylate kinase [Erythrobacter sp. NAP1]
 gi|85690200|gb|EAQ30203.1| thymidylate kinase [Erythrobacter sp. NAP1]
          Length = 216

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 113/211 (53%), Gaps = 4/211 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEG EG GK+T    L   L+ +   V VTREPGGTP AEA R +LL    D +G
Sbjct: 7   GLFIAFEGGEGTGKSTQTLKLADALRARGKVVEVTREPGGTPGAEAIRQLLLHPPGDGWG 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+AEA++FAAAR DHV   I+P+L +G  ++ DRF+DSS AYQG         + +L   
Sbjct: 67  AQAEALLFAAARSDHVAQHIKPSLEKGVWVVTDRFVDSSRAYQGGAGGLGDEAITALHAF 126

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               + PD TI+L++  D    R+  R + R+    D    +    H      F  +A  
Sbjct: 127 GSDGLRPDLTILLEVDED----RLTQRLAERDGGTSDAIGGRSADYHRAVAARFRKLAEA 182

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            P+   IVD   +   V   +L+ + +L+ +
Sbjct: 183 DPNGFRIVDGTGTPDEVHNRVLDALADLLGQ 213


>gi|116874058|ref|YP_850839.1| thymidylate kinase [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|123458754|sp|A0AM28|KTHY_LISW6 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|116742936|emb|CAK22060.1| thymidylate kinase [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 208

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + ++    D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMEEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  I + 
Sbjct: 123 AIEDTIPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDISYHEKVQAGYEKIIKM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            PDR   VD+    + +   IL
Sbjct: 179 FPDRFMRVDATMQPEEITEVIL 200


>gi|225181529|ref|ZP_03734971.1| dTMP kinase [Dethiobacter alkaliphilus AHT 1]
 gi|225167777|gb|EEG76586.1| dTMP kinase [Dethiobacter alkaliphilus AHT 1]
          Length = 209

 Score =  134 bits (338), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 116/217 (53%), Gaps = 13/217 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG +GAGKTT ++ L    ++    V  TREPGGTP  +A R +LL     
Sbjct: 1   MKKGFFITLEGPDGAGKTTQLTRLADAARQMGIQVVCTREPGGTPVGDAVRRILLDTAYS 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ---GERDSSQHLFL 117
           E     E  ++AAAR      VI PAL +G+++LCDRF+DS+ AYQ   GE D S  +  
Sbjct: 61  EMVPLTEVFLYAAARAQLFHQVIGPALKQGQLVLCDRFIDSTLAYQSYGGEMDFS-FVLE 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            +LQ +S +  +PD T +LD+   +G++R       R S   D  E+K +  H + R  F
Sbjct: 120 TNLQAVSHR--LPDLTFVLDIDPSVGVER-------RGSGTADRVEQKALSFHHRVRDGF 170

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           L +A   P+R  +V    S   V   I N V  L++K
Sbjct: 171 LSLADKFPERIKVVKGTQSEDEVFAVIWNQVAPLLEK 207


>gi|311070675|ref|YP_003975598.1| thymidylate kinase [Bacillus atrophaeus 1942]
 gi|310871192|gb|ADP34667.1| thymidylate kinase [Bacillus atrophaeus 1942]
          Length = 212

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 127/215 (59%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K+ L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKKSLAARGLQVTATREPGGIDIAEQIREVILNEKNTLM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
            A+ EA+++AAAR  H+   ++PAL +G I+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DAKTEALLYAAARRQHLVEKVKPALEQGHIVLCDRFIDSSLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E ++ ++MP+ T+   +  + GL R+     LRE   LD    +++  H + R+ + +
Sbjct: 119 INEFAIGDMMPNLTVYFSIKPEEGLSRIHAN-GLREKNRLDL---EELSFHTRVREGYHE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P R   +D++ S + V  ++  ++ E ++K
Sbjct: 175 LMKRFPKRFRTIDASQSKERVIEDVQIVINEALKK 209


>gi|227550403|ref|ZP_03980452.1| thymidylate kinase [Enterococcus faecium TX1330]
 gi|257888432|ref|ZP_05668085.1| thymidylate kinase [Enterococcus faecium 1,141,733]
 gi|257897193|ref|ZP_05676846.1| thymidylate kinase [Enterococcus faecium Com12]
 gi|257899191|ref|ZP_05678844.1| thymidylate kinase [Enterococcus faecium Com15]
 gi|293379610|ref|ZP_06625747.1| dTMP kinase [Enterococcus faecium PC4.1]
 gi|293572059|ref|ZP_06683070.1| thymidylate kinase [Enterococcus faecium E980]
 gi|227180462|gb|EEI61434.1| thymidylate kinase [Enterococcus faecium TX1330]
 gi|257824486|gb|EEV51418.1| thymidylate kinase [Enterococcus faecium 1,141,733]
 gi|257833758|gb|EEV60179.1| thymidylate kinase [Enterococcus faecium Com12]
 gi|257837103|gb|EEV62177.1| thymidylate kinase [Enterococcus faecium Com15]
 gi|291607844|gb|EFF37155.1| thymidylate kinase [Enterococcus faecium E980]
 gi|292641759|gb|EFF59932.1| dTMP kinase [Enterococcus faecium PC4.1]
          Length = 214

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +GLFI+ EG +GAGKT+ ++ L   L+     ++  TREPGG P AE  R V+L    D 
Sbjct: 2   NGLFITIEGPDGAGKTSILNELFPLLKEVAKTEIIQTREPGGIPIAEEIRAVILDPKNDR 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   + PAL +GKI+LCDRF+DSS AYQG         +  L 
Sbjct: 62  MDERTEALLYAAARRQHLVEKVLPALAKGKIVLCDRFVDSSLAYQGAGRRIGVTEIARLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E + +   PD T+ LD+  D GL+R+ +NR +      +D  + + +  H++ R  +L +
Sbjct: 122 EFATEGTTPDFTLYLDVDSDTGLRRIKKNRQN-----QIDRLDSEGLEFHQRVRHAYLKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A   P+R H VD+  SF+ V     + + E
Sbjct: 177 AEENPERIHKVDARKSFEEVLQTSYHTIIE 206


>gi|145596534|ref|YP_001160831.1| thymidylate kinase [Salinispora tropica CNB-440]
 gi|145305871|gb|ABP56453.1| thymidylate kinase [Salinispora tropica CNB-440]
          Length = 705

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 82/215 (38%), Positives = 120/215 (55%), Gaps = 12/215 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-SCGVD 60
           ++GLF+ FEG EGAGK+T ++LL   L+ +  DV VTREPG T   E  R +LL   G +
Sbjct: 446 SAGLFVVFEGGEGAGKSTQLALLAARLRDQGRDVVVTREPGATGVGERIRSLLLGQPGSE 505

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AEA+++AA R  HV  V+RPAL  G ++  DR++DSS AYQG     + L +D +
Sbjct: 506 VPSPRAEALLYAADRAHHVATVVRPALARGAVVTSDRYVDSSLAYQG---VGRTLPVDEV 562

Query: 121 QEIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
             +S      + PD  ++LD+  + GL RV  R  +      D+ E + V  HE+ R  F
Sbjct: 563 SWLSSWATGGLKPDLVVLLDIDPNTGLSRVAARGGVS-----DHLEAESVSFHERVRYAF 617

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD+A   P R  ++D+A     +A  +   V EL+
Sbjct: 618 LDLAAADPRRYLVLDAARPTDEIADEVARRVAELL 652


>gi|300214869|gb|ADJ79285.1| Thymidylate kinase (dTMP kinase) [Lactobacillus salivarius CECT
           5713]
          Length = 208

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 124/207 (59%), Gaps = 7/207 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-TREPGGTPAAEAARHVLLSCGVDEF 62
           G F++FEGI+G+GKT+ +  +   L  K  D ++ TREPGG   +EA R ++L+    E 
Sbjct: 3   GKFVTFEGIDGSGKTSVLKGVIEHLNDKRIDNYIWTREPGGNRISEAIRKIILNVEYTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQ 121
            A  EA+++AAAR  H+ + + PAL EGK++LCDRF+DSS  YQG  RD      +  L 
Sbjct: 63  DARTEALLYAAARRQHLVDTVLPALNEGKLVLCDRFVDSSVVYQGVARDIGVEPVI-KLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E + + + PD T+  D+  +I LKR+ N    R++  +D  +++ +  + K RQ +L +A
Sbjct: 122 EFATENLKPDLTLYYDVEPEISLKRISNN---RQNQ-VDRLDKESMDFYHKVRQAYLSLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
            +  +R  ++D++ +   V  + L+I+
Sbjct: 178 ESNKERIKVIDASQNLDKVIDDTLSIL 204


>gi|225848089|ref|YP_002728252.1| thymidylate kinase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643400|gb|ACN98450.1| thymidylate kinase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 204

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 8/207 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEGIEG+GK+T    L  +L       ++TREPGGT   +  R +LLS   + F 
Sbjct: 2   GVFITFEGIEGSGKSTQAKRLYEYLTNIGIKAYLTREPGGTSIGKKIREILLSHWEENFP 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           + AE +++ A R  HV N+I+P L +  I++ DRF DS+ AYQ       +  +D L ++
Sbjct: 62  SIAELLLYQADRNIHVNNIIKPLLQQDYIVISDRFYDSTTAYQHYARGIDYSIVDYLNKL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + + + P  T +LDLPV    KR+       ES  L++        H+K R+ FL IA  
Sbjct: 122 ATEGIKPHITFLLDLPVQEAFKRLNREKDRLESEGLNF--------HQKVREGFLKIADM 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWE 210
           + DR  ++D   S   +   ILNI+ E
Sbjct: 174 EKDRVIVLDGLKSPDEIFNQILNILKE 200


>gi|46908871|ref|YP_015260.1| thymidylate kinase [Listeria monocytogenes str. 4b F2365]
 gi|47092313|ref|ZP_00230104.1| thymidylate kinase [Listeria monocytogenes str. 4b H7858]
 gi|47095500|ref|ZP_00233109.1| thymidylate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|224499368|ref|ZP_03667717.1| thymidylate kinase [Listeria monocytogenes Finland 1988]
 gi|226225244|ref|YP_002759351.1| thymidylate kinase [Listeria monocytogenes Clip81459]
 gi|254824945|ref|ZP_05229946.1| thymidylate kinase [Listeria monocytogenes FSL J1-194]
 gi|254830871|ref|ZP_05235526.1| thymidylate kinase [Listeria monocytogenes 10403S]
 gi|254852005|ref|ZP_05241353.1| thymidylate kinase [Listeria monocytogenes FSL R2-503]
 gi|254899850|ref|ZP_05259774.1| thymidylate kinase [Listeria monocytogenes J0161]
 gi|254912944|ref|ZP_05262956.1| thymidylate kinase [Listeria monocytogenes J2818]
 gi|254931036|ref|ZP_05264395.1| thymidylate kinase [Listeria monocytogenes HPB2262]
 gi|254937325|ref|ZP_05269022.1| thymidylate kinase [Listeria monocytogenes F6900]
 gi|254991884|ref|ZP_05274074.1| thymidylate kinase [Listeria monocytogenes FSL J2-064]
 gi|255025775|ref|ZP_05297761.1| thymidylate kinase [Listeria monocytogenes FSL J2-003]
 gi|255519688|ref|ZP_05386925.1| thymidylate kinase [Listeria monocytogenes FSL J1-175]
 gi|300763550|ref|ZP_07073548.1| thymidylate kinase [Listeria monocytogenes FSL N1-017]
 gi|59798313|sp|Q71W79|KTHY_LISMF RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|259494275|sp|C1KZP7|KTHY_LISMC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|46882144|gb|AAT05437.1| thymidylate kinase [Listeria monocytogenes serotype 4b str. F2365]
 gi|47016110|gb|EAL07034.1| thymidylate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|47019292|gb|EAL10034.1| thymidylate kinase [Listeria monocytogenes str. 4b H7858]
 gi|225877706|emb|CAS06420.1| Putative thymidylate kinase [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258605303|gb|EEW17911.1| thymidylate kinase [Listeria monocytogenes FSL R2-503]
 gi|258609931|gb|EEW22539.1| thymidylate kinase [Listeria monocytogenes F6900]
 gi|293582582|gb|EFF94614.1| thymidylate kinase [Listeria monocytogenes HPB2262]
 gi|293590945|gb|EFF99279.1| thymidylate kinase [Listeria monocytogenes J2818]
 gi|293594185|gb|EFG01946.1| thymidylate kinase [Listeria monocytogenes FSL J1-194]
 gi|300515827|gb|EFK42876.1| thymidylate kinase [Listeria monocytogenes FSL N1-017]
 gi|328468175|gb|EGF39181.1| thymidylate kinase [Listeria monocytogenes 1816]
 gi|328469553|gb|EGF40494.1| thymidylate kinase [Listeria monocytogenes 220]
          Length = 208

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD +    L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  +   
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|313631628|gb|EFR98875.1| thymidylate kinase [Listeria seeligeri FSL N1-067]
          Length = 208

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  ++L + ++    D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTMLTKKMEEAGVDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALEAGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  I   
Sbjct: 123 AIEDTIPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDISYHEKVQAGYEKIMAM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            PDR   VD+  + + +   IL
Sbjct: 179 FPDRYMRVDATKTPEEITDVIL 200


>gi|121534353|ref|ZP_01666177.1| dTMP kinase [Thermosinus carboxydivorans Nor1]
 gi|121307123|gb|EAX48041.1| dTMP kinase [Thermosinus carboxydivorans Nor1]
          Length = 210

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 119/215 (55%), Gaps = 9/215 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEG +GAGKTT ++LL  +L+ + + V  TREPGGTP  +A R +LL        
Sbjct: 3   GLFITFEGADGAGKTTQLALLADYLRAQGWPVRCTREPGGTPLGDAIRALLLDPANARMA 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQE 122
              EA+++ AAR  HV  VI PAL  G+I+L DR+ DS+  YQG  R   +H  L ++  
Sbjct: 63  PRTEALLYMAARAQHVAEVIAPALARGEIVLSDRYADSTIVYQGVARQLPEH-ELAAINA 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + PD TI+LD   ++   R+  R         D  ER+    HE+ RQ FL +A 
Sbjct: 122 FATGGLEPDLTILLDCRQEVLSGRMAGR------GAKDRIEREAARFHEQVRQGFLRLA- 174

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
              DR  ++++  S Q+V   ++  V + + +R S
Sbjct: 175 AASDRFCVIEADGSVQAVHARVIAAVQQFLDRRGS 209


>gi|312866475|ref|ZP_07726693.1| dTMP kinase [Streptococcus downei F0415]
 gi|311098169|gb|EFQ56395.1| dTMP kinase [Streptococcus downei F0415]
          Length = 206

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 120/203 (59%), Gaps = 4/203 (1%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
            I+ EG +GAGKT+ +  L   L+ + + V  TREPGG   AE+ R V+L         +
Sbjct: 1   MITLEGPDGAGKTSVLERLVPLLEAQGHQVVTTREPGGVAIAESIREVILDVKNTAMDEK 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E +++ AAR  H    + P L +GK++L DRF+DSS AYQG         +D L + ++
Sbjct: 61  TELLLYIAARRQHFVEKVLPDLAQGKLVLVDRFIDSSVAYQGYGRGLSVTDIDWLNDYAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
           ++  PD T++ DLP ++GL R++ +  +RE   LD  E+ D  +H++ RQ +L++A++QP
Sbjct: 121 EDTKPDLTLLFDLPSELGLARIE-QAEVREVNRLD-LEKLD--MHQRVRQGYLELAKSQP 176

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++D+A   + V  + L+ +
Sbjct: 177 ERIKVIDAAQELEKVVADALSTI 199


>gi|220932870|ref|YP_002509778.1| dTMP kinase [Halothermothrix orenii H 168]
 gi|254808299|sp|B8CZT1|KTHY_HALOH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|219994180|gb|ACL70783.1| dTMP kinase [Halothermothrix orenii H 168]
          Length = 207

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+ EGIEG+GK+T I +L + L++  +DV +TREPGGTP  +  R +LL    +  G
Sbjct: 3   GLFITLEGIEGSGKSTQIEMLYKRLKKDGFDVIITREPGGTPIGKEIRKLLLDPD-NIMG 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A+AE +++AA R  HV  +I+PAL  GK++L DRF+DSS AYQG         + ++ E 
Sbjct: 62  AKAEFLLYAADRAQHVVELIKPALESGKVVLADRFIDSSIAYQGYGRGLDIDVVKTVNEW 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +    PD T +LDL V+ GL+R +  YS       D  ER+ V  H + RQ +  +A +
Sbjct: 122 VIDGCWPDLTFVLDLDVEKGLERARG-YSPDNQG--DRLERELVTFHRRVRQAYHQLAED 178

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +  R  ++D+  S + +   I + V
Sbjct: 179 R--RFIMLDADRSREEIHREIYHKV 201


>gi|150387935|ref|YP_001317984.1| dTMP kinase [Alkaliphilus metalliredigens QYMF]
 gi|149947797|gb|ABR46325.1| dTMP kinase [Alkaliphilus metalliredigens QYMF]
          Length = 211

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 119/214 (55%), Gaps = 6/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +GLFISFEG++GAGK+T I   K F + + Y V +TREPGGT  +E  R  +L     
Sbjct: 1   MKNGLFISFEGVDGAGKSTQIHYAKDFFEERGYKVSLTREPGGTRISEIIREAILDRTHQ 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++AA+R  HVE  I PAL EG+++LCDRF+DSS  YQG         + ++
Sbjct: 61  EMTHRTEALLYAASRAQHVEEFILPALAEGRVVLCDRFVDSSMVYQGRGRGLGFDAVRNI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD TI  ++   + L R+    +++E    D  E++ +  H    + + D+
Sbjct: 121 NQFATGGLEPDLTIFFNIHPQVSLGRI----NVKEKG--DRLEQEKMAFHYTVYESYHDL 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A+    R  ++++    + + + +  I+  L+++
Sbjct: 175 AQMNSSRIKVIEANQEVEKIKSEVEKIMTNLLRR 208


>gi|83319417|ref|YP_424009.1| thymidylate kinase [Mycoplasma capricolum subsp. capricolum ATCC
           27343]
 gi|123536025|sp|Q2STA4|KTHY_MYCCT RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|83283303|gb|ABC01235.1| thymidylate kinase [Mycoplasma capricolum subsp. capricolum ATCC
           27343]
          Length = 213

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 125/216 (57%), Gaps = 7/216 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG++G+GKTT +  +K  L+R NY V +TREPGG   AE  R ++L     +  A
Sbjct: 1   MFITFEGMDGSGKTTALLKVKEELERLNYKVLITREPGGEVIAEQIRQIILDNKNKDMDA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++F A+R  H++ VI+PAL +  I++ DRF+DS+ AYQG   S++++ +D + E+ 
Sbjct: 61  WTEALLFIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQG---SARNIGVDVVSEVQ 117

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            Q V+ +C   L L  D+     + R  +R  +  +  ++++    +K  Q +L++ +N 
Sbjct: 118 -QIVLKNCLPDLTLFFDVSFSEAEKRMQIRGESSKNRLDKEENNFKQKVYQGYLELVKNN 176

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV---QKRVS 217
           P R  ++D+      V    + I+ E +   +KR S
Sbjct: 177 PKRIKVIDANKDIDQVYNQAIKIILEKLKENEKRTS 212


>gi|300744314|ref|ZP_07073333.1| dTMP kinase [Rothia dentocariosa M567]
 gi|300380039|gb|EFJ76603.1| dTMP kinase [Rothia dentocariosa M567]
          Length = 249

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 123/216 (56%), Gaps = 13/216 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI FEG +GAGKTT ++ L+  L+ + Y V  TREPGGTP  EA R ++L  G  E  
Sbjct: 20  GLFIVFEGGDGAGKTTQLARLQAALEAQGYTVIATREPGGTPLGEALRELVLKHGSSEVD 79

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A AEA++FAA+R  H    IRPAL  G ++L DR+LDSS AYQG     ++L  D++ ++
Sbjct: 80  ARAEALIFAASRAAHAAQKIRPALAAGAVVLSDRYLDSSAAYQG---IGRNLGKDTITDL 136

Query: 124 S---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           S    ++++P  TI+LD+P+    +R+ +R        +D  E +           F DI
Sbjct: 137 SRWATEDLIPHATILLDVPLTDESQRMSDR------GTVDRIEAEGADFKACVHTAFADI 190

Query: 181 ARNQPDRCH-IVDSAHSFQSVATNILNIVWELVQKR 215
           AR   D  H +VD   S  +V   +L +V  L++ R
Sbjct: 191 ARQNADGAHYVVDGCGSVDAVHERVLEVVRPLLKSR 226


>gi|241759767|ref|ZP_04757867.1| dTMP kinase [Neisseria flavescens SK114]
 gi|241319775|gb|EER56171.1| dTMP kinase [Neisseria flavescens SK114]
          Length = 208

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 117/199 (58%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + ++    V  TREPGGTPA EA R +LL+  V +    
Sbjct: 5   FITLDGIDGAGKSTNLAVMKAWFEKHQLPVLFTREPGGTPAGEALREILLNP-VTQVSLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR  H+E VI PAL  G  ++ DRF D+++AYQG         + +L+    
Sbjct: 64  TETLLMFAARQQHLETVILPALKNGTHVVSDRFTDATFAYQGGGRGVPLQDIATLEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
            +  PD T++LD+P+++ + R+      RE    D FE+++     + R+++L  A  QP
Sbjct: 124 GDFRPDLTLLLDVPLEVSMARINQ---TREK---DRFEQEEAEFFNRVREVYLQRANEQP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++DS+ S  +V   I
Sbjct: 178 ERYAVIDSSQSLDAVKNQI 196


>gi|302878048|ref|YP_003846612.1| thymidylate kinase [Gallionella capsiferriformans ES-2]
 gi|302580837|gb|ADL54848.1| thymidylate kinase [Gallionella capsiferriformans ES-2]
          Length = 200

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 117/204 (57%), Gaps = 13/204 (6%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG++GAGK+TH++     L++   DV VTREPGGTP  E  R +LL+         
Sbjct: 4   FITFEGVDGAGKSTHLAWFAATLRQHGVDVVVTREPGGTPLGEQLREMLLN---QPMSIG 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++  AAR++HVE +I+PAL+ GK ++ DRF D+S+AYQG     + +  D L+++  
Sbjct: 61  TEAMLMFAARVEHVEQIIKPALLAGKWVISDRFSDASFAYQG---GGRGMDWDKLRQLEQ 117

Query: 126 Q-EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
             ++ PD T+  D+PV++   R+ N  S      LD FE++     E+ R  +       
Sbjct: 118 WVDLRPDLTLFFDVPVEVARARLSNNVS------LDRFEQEQGEFFERVRAGYHRRVAEN 171

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
           P R  ++D+A S   V   + +IV
Sbjct: 172 PPRYAVIDAAQSIALVQQQLQSIV 195


>gi|256384283|gb|ACU78853.1| dTMP kinase [Mycoplasma mycoides subsp. capri str. GM12]
 gi|256385116|gb|ACU79685.1| dTMP kinase [Mycoplasma mycoides subsp. capri str. GM12]
 gi|296455961|gb|ADH22196.1| dTMP kinase [synthetic Mycoplasma mycoides JCVI-syn1.0]
          Length = 213

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 124/216 (57%), Gaps = 7/216 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG++G+GKTT +  +K  L+R NY V +TREPGG   AE  R ++L     +  A
Sbjct: 1   MFITFEGMDGSGKTTALLKVKEELERLNYKVLITREPGGEAIAEQIRQIILDNKNKDMDA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++F A+R  H++ VI+PAL +  I++ DRF+DS+ AYQG   S++++ +D + E+ 
Sbjct: 61  WTEALLFIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQG---SARNIGVDVVSEVQ 117

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            Q V+ +C   L L  D+     + R  +R  +  +  +++     +K  Q +L++ +N 
Sbjct: 118 -QIVLKNCLPDLTLFFDVSFSEAEKRMQIRGESSKNRLDKEKSDFKQKVYQGYLELVKNN 176

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV---QKRVS 217
           P R  ++D+      V    + I+ E +   +KR S
Sbjct: 177 PKRIKVIDANQDIDQVYNQAIKIILEKLKENEKRTS 212


>gi|167042818|gb|ABZ07536.1| putative thymidylate kinase [uncultured marine microorganism
           HF4000_ANIW137I15]
          Length = 247

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 114/219 (52%), Gaps = 11/219 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G+ I+FEGIEG+GKTT  SLL   L+ +   V  TREPGGT   E  R ++L  G +  
Sbjct: 24  AGILITFEGIEGSGKTTQASLLADRLREQGLSVFPTREPGGTHLGEGIRRLVLEPGQEAI 83

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AE  +  AAR  HV   IRPAL  GK++LCDRF DS+  YQG         ++ +  
Sbjct: 84  DPVAELFLMEAARAQHVAAKIRPALDAGKVVLCDRFTDSTLVYQGLARGLAWKTIEDVNL 143

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR-------ESACLDYFERKDVMIHEKRRQ 175
           ++ + + P  TI+LDL +  GL R + R           E+   + F+ +D   HE  R 
Sbjct: 144 LAAKGIRPHTTILLDLDISAGLARTRTRADSAVQADGSIETGETNRFDLEDREFHEIVRS 203

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            FL +A+  P R  +V +A S + V       VW  ++K
Sbjct: 204 GFLRLAKEDPGRVKVVRAAGSAEEVHEE----VWRALEK 238


>gi|311028959|ref|ZP_07707049.1| thymidylate kinase [Bacillus sp. m3-13]
          Length = 212

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 119/211 (56%), Gaps = 4/211 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEG EGAGKT+ I  L   L  + + + +TREPGG   AE  R+V+L C   E  
Sbjct: 3   GLFITFEGPEGAGKTSVIQKLGAELTEQEFPILLTREPGGIAIAEQIRNVILDCDNTEMD 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++AAAR  H+   + PAL E KI+LCDRF+DSS AYQG         + S+ E 
Sbjct: 63  ARTEALLYAAARRQHLVERVIPALKENKIVLCDRFIDSSLAYQGYARGIGVEDVLSINEF 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + +++MP  TI  D+  + GLKR+    + RE   LD   ++ +  H K ++ +  +   
Sbjct: 123 ATEKMMPSLTIYFDIEPEAGLKRIAANNN-REINRLD---QEKLDFHYKVKEGYDLVKEK 178

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             +R  +VD++  F+SV   +  ++     K
Sbjct: 179 YGERIRVVDASMDFESVCNQVREVLISYFSK 209


>gi|212637874|ref|YP_002314394.1| Thymidylate kinase [Anoxybacillus flavithermus WK1]
 gi|226732650|sp|B7GFF9|KTHY_ANOFW RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|212559354|gb|ACJ32409.1| Thymidylate kinase [Anoxybacillus flavithermus WK1]
          Length = 209

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 124/215 (57%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           S LF SFEG EGAGKTT + +LK +L  ++ DV  TREPGG   AE  R V+L    +  
Sbjct: 2   SYLFFSFEGPEGAGKTTIVRMLKDYLSEQHVDVVATREPGGIDIAEQIRAVILHPNNERM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL +GK++LCDRF+DSS AYQG    ++ L +D +  
Sbjct: 62  DARTEALLYAAARRQHLVEKVIPALKDGKVVLCDRFIDSSLAYQG---VARGLGIDEILA 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +++  MP  TI  D+   +GL R++   S RE   LD    +++  HE+ R+ ++ 
Sbjct: 119 INAFAIENWMPILTIYFDIDPSLGLARIRENGS-REVNRLDL---EELSFHEQVRKGYMV 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +    P+R   VD+      V  ++  ++  L++K
Sbjct: 175 LLDRFPNRIKKVDATQPITKVFEDVWALIEPLIRK 209


>gi|304385465|ref|ZP_07367810.1| thymidylate kinase [Pediococcus acidilactici DSM 20284]
 gi|304328672|gb|EFL95893.1| thymidylate kinase [Pediococcus acidilactici DSM 20284]
          Length = 209

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 124/212 (58%), Gaps = 5/212 (2%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FISFEG +GAGKTT + ++++ +  R    + VTREPGG P +EA R ++L     E
Sbjct: 2   NGHFISFEGPDGAGKTTILEAMVEHYRTRLADRLTVTREPGGNPISEAIRAIILDKNNTE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA+++AAAR  H+   I PAL  G+++ CDR++DSS AYQG         +  + 
Sbjct: 62  MDARTEALLYAAARRQHLTETILPALARGQVVFCDRYVDSSIAYQGAGREIGPEAVYQMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             + +  +P+ TI LD+  ++GLKR+        +  +D  + + +  HE+ R  +L +A
Sbjct: 122 LFATEGCLPEKTIYLDVSAEVGLKRIMT----HRTDDVDRLDLEQLDFHERVRDAYLALA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +  P+R  ++D++ S   V   ++N++ ++++
Sbjct: 178 KRYPERIVVIDASQSIGDVKKAVINVLDQILK 209


>gi|238062269|ref|ZP_04606978.1| dTMP kinase [Micromonospora sp. ATCC 39149]
 gi|237884080|gb|EEP72908.1| dTMP kinase [Micromonospora sp. ATCC 39149]
          Length = 698

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 79/215 (36%), Positives = 118/215 (54%), Gaps = 11/215 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           ++SGLF+ FEG EGAGK+T ++ L   L+ +  +V VTREPG T      R +LL    +
Sbjct: 457 VSSGLFVVFEGGEGAGKSTQLAALAEQLRGQGREVVVTREPGATEVGARIRALLLDATAE 516

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AEA+++AA R  HV  V+RPAL  G +++ DR++DSS AYQG   + + L +D +
Sbjct: 517 GPSPRAEALLYAADRAHHVATVVRPALARGAVVISDRYVDSSLAYQG---AGRTLPVDEV 573

Query: 121 QEIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
             +S      + PD  ++LD+    GL RV  R     S   D  E + V  HE+ R  F
Sbjct: 574 SWLSSWATGGLKPDLVVLLDVDPHTGLSRVAAR-----SEGTDRLEAESVAFHERVRYAF 628

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD+A N P R  ++D++   +  A  +   V E +
Sbjct: 629 LDLAANDPKRYLVLDASRPVEETAALVARRVKEFL 663


>gi|77464120|ref|YP_353624.1| thymidylate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|126462963|ref|YP_001044077.1| dTMP kinase [Rhodobacter sphaeroides ATCC 17029]
 gi|123591351|sp|Q3J0G1|KTHY_RHOS4 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|166223108|sp|A3PLT9|KTHY_RHOS1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|77388538|gb|ABA79723.1| thymidylate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|126104627|gb|ABN77305.1| thymidylate kinase [Rhodobacter sphaeroides ATCC 17029]
          Length = 217

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 112/197 (56%), Gaps = 1/197 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F++ EGI+G+GK+  +  L   L  +  DV VTREPGGTP  EA R ++L+   + + 
Sbjct: 5   GFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGGTPEGEAIRGLVLAGADEAWD 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE ++  AAR+ HV  VI PAL +G++++ DR+  S+ AYQG        F+ +L   
Sbjct: 65  PMAELLLMTAARVQHVRRVIAPALAQGRVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAE 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +  ++ PD T++LDL   IGL R + R +  E+     FE  D+  HE+ R  FL  A  
Sbjct: 125 ATGDLWPDLTLVLDLEAGIGLARSRRRLT-GETLDEGRFESLDLAFHERIRAAFLAQAAR 183

Query: 184 QPDRCHIVDSAHSFQSV 200
            P R  ++D++ + + V
Sbjct: 184 DPGRHAVIDASGTPEEV 200


>gi|296271416|ref|YP_003654048.1| thymidylate kinase [Thermobispora bispora DSM 43833]
 gi|296094203|gb|ADG90155.1| thymidylate kinase [Thermobispora bispora DSM 43833]
          Length = 686

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 116/209 (55%), Gaps = 8/209 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEG EG+GKTT   +L  +L+ + YDV  TREPGGT      R +LL        
Sbjct: 466 GLFIAFEGGEGSGKTTQARMLAIWLRDQGYDVVQTREPGGTKLGMRLRAILLDSAHQGIS 525

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             +EA+++AA R +HVE VIRPAL  G  ++ DR++DSS AYQG         +  + E 
Sbjct: 526 GRSEALLYAADRAEHVEKVIRPALRRGSAVISDRYVDSSLAYQGAGRMLDRDEVARINEW 585

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD T++LD+P  +GL+R+         +  D  E + +  HE+ R+    +A  
Sbjct: 586 ATGGLVPDLTVVLDVPPAVGLRRM--------GSPADRLEAEPLEFHERVRRELRALAAA 637

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +P+R  +VD     + V   I + V E++
Sbjct: 638 EPERYLVVDGTLPQEEVTRIIQDRVREIL 666


>gi|255017566|ref|ZP_05289692.1| thymidylate kinase [Listeria monocytogenes FSL F2-515]
          Length = 208

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD +    L  +   
Sbjct: 64  KNEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  +   
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|269468275|gb|EEZ79959.1| thymidylate kinase [uncultured SUP05 cluster bacterium]
          Length = 205

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ +G+EGAGK+T I+ +  +L+ K  +V +TREPGGT   E  R +LLS    
Sbjct: 1   MQKGKFITIDGVEGAGKSTQINFICGYLKDKGINVALTREPGGTELGEKIRTLLLSPKTK 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              ++ E ++  AAR +H+   I P L +G  +L DRF D+SYAYQG         +  L
Sbjct: 61  SMHSDTELLLMFAARNEHIHAKIMPILEKGDWVLSDRFTDASYAYQGGGRGLDVDRIAKL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +E  +Q+  PD T++LD+PV++G+ RV++R         D  E +D+    + R  ++  
Sbjct: 121 EEWVLQDFTPDMTLLLDVPVELGMSRVESR------GEKDRIELEDMDFFNRVRDAYISR 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           ++  PDR  ++DS+ + +     I
Sbjct: 175 SKQFPDRIKLIDSSETVEHTKEQI 198


>gi|329894944|ref|ZP_08270743.1| Thymidylate kinase [gamma proteobacterium IMCC3088]
 gi|328922673|gb|EGG30008.1| Thymidylate kinase [gamma proteobacterium IMCC3088]
          Length = 212

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 119/207 (57%), Gaps = 12/207 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EG GK+T ++L+K  L+++   V VTREPGGT  AE  R VLLS   +
Sbjct: 1   MRKGYFITFEGGEGTGKSTQLALVKEALEQRGIKVCVTREPGGTELAEEIRRVLLSPRNE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAY-QGER--DSSQHLFL 117
                 E ++  AAR  H+  VI PA+  G+ +LCDRF D++YAY QG R  D  +   L
Sbjct: 61  TVDPTTELLLMFAARAQHLAQVILPAVDRGEWVLCDRFTDATYAYQQGGRGVDEDKIAIL 120

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           + L ++      PD T++ D P++I L+R+++R        LD FE++ +   ++ R  +
Sbjct: 121 ERLVQMGFN---PDLTLLFDAPIEISLQRMRDR------GALDRFEQEGLEFMKRVRSTY 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNI 204
           L  AR + +R  ++D+  +   V  ++
Sbjct: 172 LTRARVESERFRVIDATATVDDVRASV 198


>gi|126736701|ref|ZP_01752440.1| thymidylate kinase [Roseobacter sp. CCS2]
 gi|126713816|gb|EBA10688.1| thymidylate kinase [Roseobacter sp. CCS2]
          Length = 202

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN   FI+FEGI+G+GK+T        L+ +  DV +TREPGG+P AE  R ++L+   D
Sbjct: 1   MNKPRFITFEGIDGSGKSTQSRRFADHLRAQGGDVVLTREPGGSPGAEEIRQLVLTGDPD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +  E E ++F A+R DH+E  I PAL  GK ++ DRF DS+  YQG         +DSL
Sbjct: 61  RWSPETEILLFTASRRDHLEKTIEPALTAGKTVISDRFADSTRVYQGATRGDLRAMVDSL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             + +    PD T I+D+     L+R      L   +  D FE   +   E  R  FL +
Sbjct: 121 HRLMIAR-EPDLTFIIDMDPATALER-----GLARKSGEDRFEDFGLGFQETLRHGFLAL 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A + P RC ++D   +   +A+ I
Sbjct: 175 AHDHPKRCVLIDGNRTPDQIASEI 198


>gi|254514398|ref|ZP_05126459.1| thymidylate kinase [gamma proteobacterium NOR5-3]
 gi|219676641|gb|EED33006.1| thymidylate kinase [gamma proteobacterium NOR5-3]
          Length = 210

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 114/208 (54%), Gaps = 6/208 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG EGAGK+T ++ ++R L+    D+  TREPGGT   E  R  LL+        
Sbjct: 1   MFITLEGGEGAGKSTAMTYVERGLREAGVDLICTREPGGTRLGEQLRETLLAPSETGINP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE ++  AAR  H+   I PAL  G+ +LCDRF D+SYAYQG   +     +  L+E+ 
Sbjct: 61  LAELLMMFAARAQHLSECILPALGRGQWVLCDRFTDASYAYQGAGRNMGESPVAVLEELV 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + PD T++LD+P + GL R + R        LD FE++D    E+ RQ +L  A+  
Sbjct: 121 QGGLRPDLTLLLDVPSETGLSRARGR------GALDRFEQEDHAFFERVRQSYLSRAKRS 174

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV 212
             R  I+D++    +V   +  +V +L+
Sbjct: 175 SGRYQIIDASADLAAVEQALEAVVQDLL 202


>gi|149197612|ref|ZP_01874662.1| thymidylate kinase [Lentisphaera araneosa HTCC2155]
 gi|149139182|gb|EDM27585.1| thymidylate kinase [Lentisphaera araneosa HTCC2155]
          Length = 209

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 123/218 (56%), Gaps = 14/218 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+   FI  EG EGAGK+T I L+K  L+ +   V + REPGGTP AE  R V+ S  VD
Sbjct: 1   MDCSRFIVVEGSEGAGKSTAIKLIKNLLEEQGQTVTLAREPGGTPMAEDLRTVIKSASVD 60

Query: 61  E-FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD- 118
           E   A  E ++  AAR+  VENVIRPAL  G+ L+CDRF  S++AYQG     + L LD 
Sbjct: 61  EKVDARTELLIMYAARVQLVENVIRPALERGEWLVCDRFFYSTWAYQG---GGRELGLDL 117

Query: 119 --SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
              + +I + ++ P  TI +DL  ++GL+R + R        LD FE + +    + R +
Sbjct: 118 IRPIHDICLADMTPGLTIFMDLDPELGLERARGR------GALDRFELEQIDFFHRTRAM 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +  +  ++      +D++ S + V  ++LN++   +++
Sbjct: 172 YTQLC-DERKEMQKLDASQSLEEVHAHLLNLIRPYIEQ 208


>gi|237756554|ref|ZP_04585078.1| thymidylate kinase [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691282|gb|EEP60366.1| thymidylate kinase [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 204

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 8/197 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIE +GKTT I+LL  +L+    +V  TREPGGT   +  R +LLS   ++F 
Sbjct: 2   GFFITFEGIEASGKTTQINLLYDYLKSIGKNVIKTREPGGTKIGQKIREILLSKWDEKFP 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++ A R  H+ N+I+P+L    I+L DR++DS+ AYQ       +  +  L  +
Sbjct: 62  YIAELLLYEADRNIHIHNIIKPSLEADYIVLSDRYIDSTTAYQHYARGIDYEIVSYLNTL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   + P+ T ++D+P  I LKR+        S   D  E +D+  H+K R+ FL IA N
Sbjct: 122 ATDRLKPNLTFLIDIPAQISLKRL--------SKTKDRIESEDIEFHKKLREGFLKIAEN 173

Query: 184 QPDRCHIVDSAHSFQSV 200
           + DR  ++D       +
Sbjct: 174 EKDRFVVIDGTMDIMEI 190


>gi|315639687|ref|ZP_07894827.1| thymidylate kinase [Enterococcus italicus DSM 15952]
 gi|315484648|gb|EFU75104.1| thymidylate kinase [Enterococcus italicus DSM 15952]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 117/210 (55%), Gaps = 11/210 (5%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           SGLFI+ EG +GAGKTT ++ L  R  +  N  V  TREPGG   +E  R ++L    +E
Sbjct: 2   SGLFITIEGPDGAGKTTALNELFPRLEKETNRKVIATREPGGVRISEKIRDLILDPNNEE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS-- 119
                EA+++AAAR  H+  VI PAL  G I+LCDRF+DSS AYQG   + + + ++S  
Sbjct: 62  MDVRTEALLYAAARRQHLIEVIMPALAAGHIVLCDRFVDSSLAYQG---AGRRIGIESVA 118

Query: 120 -LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            + E + + + PD T+ LD+  D GL+R+Q        A +D  E + +  H++ R  +L
Sbjct: 119 QINEFATEGLQPDFTLYLDIDSDEGLRRIQT----SRKAGIDRLETEGLEFHQRVRHAYL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIV 208
            +   +P+R  ++ +    Q V      I+
Sbjct: 175 KLVEKEPERFSLIHANQDVQEVVNECYTII 204


>gi|293550622|ref|ZP_06673290.1| thymidylate kinase [Enterococcus faecium E1039]
 gi|291603243|gb|EFF33427.1| thymidylate kinase [Enterococcus faecium E1039]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 117/210 (55%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +GLFI+ EG +GAGKT+ ++ L   L+     ++  TREPGG P AE  R V+L    D 
Sbjct: 2   NGLFITIEGPDGAGKTSILNELYPLLKEVAKTEIIQTREPGGIPIAEEIRAVILDPKNDR 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   + PAL +GKI+LCDRF+DSS AYQG         +  L 
Sbjct: 62  MDERTEALLYAAARRQHLVEKVLPALAKGKIVLCDRFVDSSLAYQGAGRRIGVTEIARLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E + +   PD T+ LD+  D GL+R+ +NR +      +D  + + +  H++ R  +L +
Sbjct: 122 EFATEGTTPDFTLYLDVDSDTGLRRIKKNRQN-----QIDRLDSEGLEFHQRVRHAYLKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A   P+R H VD+   F+ V     + + E
Sbjct: 177 AEENPERIHKVDARKGFEEVLQTSYHTIIE 206


>gi|290891876|ref|ZP_06554873.1| thymidylate kinase [Listeria monocytogenes FSL J2-071]
 gi|290558470|gb|EFD91987.1| thymidylate kinase [Listeria monocytogenes FSL J2-071]
          Length = 208

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  +   
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|262368570|ref|ZP_06061899.1| thymidylate kinase [Acinetobacter johnsonii SH046]
 gi|262316248|gb|EEY97286.1| thymidylate kinase [Acinetobacter johnsonii SH046]
          Length = 199

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 8/205 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  +   L+++   V +TREPGGTP AE  R +LLS   +E   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIYEHLEQQGQQVVLTREPGGTPMAEQIRSLLLSVNHEESMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL + K +LCDRF D+S+AYQ          L  L E 
Sbjct: 61  NDTELLLMYAARAQHLQQVIVPALTKHKTVLCDRFTDASFAYQCAGRGLSQSKLQLLNEN 120

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            V   MPD T  LD P++ G+ R       RE   LD FE++ V   EK R  +  +   
Sbjct: 121 FVSH-MPDITFWLDAPIETGMSRA------RERGALDRFEQEKVTFFEKVRAGYQQLWEQ 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P+R   +D+  S + V    L  +
Sbjct: 174 YPERVKRLDATQSPEQVFAQALQYL 198


>gi|221639987|ref|YP_002526249.1| Thymidylate kinase [Rhodobacter sphaeroides KD131]
 gi|254808303|sp|B9KKV1|KTHY_RHOSK RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|221160768|gb|ACM01748.1| Thymidylate kinase [Rhodobacter sphaeroides KD131]
          Length = 217

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 112/197 (56%), Gaps = 1/197 (0%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G F++ EGI+G+GK+  +  L   L  +  DV VTREPGGTP  EA R ++L+   + + 
Sbjct: 5   GFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGGTPEGEAIRGLVLAGADEAWD 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE ++  AAR+ HV  VI PAL +G++++ DR+  S+ AYQG        F+ +L   
Sbjct: 65  PMAELLLMTAARVQHVRRVIAPALAQGQVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAE 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +  ++ PD T++LDL   IGL R + R +  E+     FE  D+  HE+ R  FL  A  
Sbjct: 125 ATGDLWPDLTLVLDLEAGIGLARSRRRLT-GETLDEGRFESLDLAFHERIRAAFLAQAAR 183

Query: 184 QPDRCHIVDSAHSFQSV 200
            P R  ++D++ + + V
Sbjct: 184 DPGRHAVIDASGTPEEV 200


>gi|56961832|ref|YP_173554.1| thymidylate kinase [Bacillus clausii KSM-K16]
 gi|59798132|sp|Q5WLY2|KTHY_BACSK RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|56908066|dbj|BAD62593.1| thymidylate kinase [Bacillus clausii KSM-K16]
          Length = 213

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 118/200 (59%), Gaps = 4/200 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG EGAGKTT I+L++  L  + Y+V  TREPGG   AE  R +LL     
Sbjct: 1   MKKGLFITVEGGEGAGKTTIINLVQEQLATQGYEVIRTREPGGVELAEQIRDLLLHTQGV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++AAAR +H+   I PAL EG ++LCDR++DSS  YQG         + ++
Sbjct: 61  EMDNRTEALLYAAARREHLIKKIVPALAEGALVLCDRYIDSSLVYQGHARGIGMEEVRAI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +++  MPD T+  D+  +IGL+RVQ + ++R    LD   ++ +  H++ ++ +  +
Sbjct: 121 NGFAIETYMPDLTLYFDVEPEIGLERVQ-KDAVRSWNRLD---QETLTFHKRVQEGYKKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSV 200
            + +P+R   +D+  SF  V
Sbjct: 177 LKAEPERIKAIDANRSFAEV 196


>gi|116617408|ref|YP_817779.1| thymidylate kinase [Leuconostoc mesenteroides subsp. mesenteroides
           ATCC 8293]
 gi|227431245|ref|ZP_03913299.1| thymidylate kinase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|122272391|sp|Q03ZG6|KTHY_LEUMM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|116096255|gb|ABJ61406.1| thymidylate kinase [Leuconostoc mesenteroides subsp. mesenteroides
           ATCC 8293]
 gi|227353007|gb|EEJ43179.1| thymidylate kinase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 213

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 118/205 (57%), Gaps = 13/205 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M   +FISFEG EGAGKT+ +  L   L+ K   D+  TREPGG P +EA R +L     
Sbjct: 1   MPKPIFISFEGPEGAGKTSVLEALISELKTKLGDDLVTTREPGGNPISEAIRSILQPEED 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +      EA+++ AAR  H+   I+PAL + KI++ DR++DSS AYQG     + L +D+
Sbjct: 61  NGMDKRTEALLYTAARRQHLVENIKPALDQNKIVISDRYVDSSLAYQG---GGRGLGIDN 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQ 175
           + EI   ++  ++PD TI LD+PV+IGL RV +NR        +D  +++ +  H+K R+
Sbjct: 118 IWEINQFAIDGLLPDMTIYLDVPVEIGLARVNENR-----QGKIDRLDKESISFHQKVRE 172

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSV 200
            +L +     DR  IVD+      V
Sbjct: 173 TYLKLQSEFSDRIKIVDATQPLNKV 197


>gi|92113730|ref|YP_573658.1| thymidylate kinase [Chromohalobacter salexigens DSM 3043]
 gi|122420045|sp|Q1QX49|KTHY_CHRSD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|91796820|gb|ABE58959.1| thymidylate kinase [Chromohalobacter salexigens DSM 3043]
          Length = 212

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG GK+T+++ +  +L  +  +V  TREPGGTP AEA R +LL     
Sbjct: 1   MTPGRFITLEGGEGVGKSTNVAFVCDWLSARGIEVVRTREPGGTPRAEAIRELLLDPAPQ 60

Query: 61  E-FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           E     AE ++  AAR  H+   IRPAL  G  ++CDRF D+++AYQG         + +
Sbjct: 61  EPLDETAELLLMFAARAQHLAARIRPALARGAWVVCDRFTDATFAYQGGGRGLDETRIAT 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L+ +  Q + PD T++LD+PV+   +RV+ R   R     D FER+        R+ +L 
Sbjct: 121 LEALVQQGLQPDLTLLLDMPVEAAQRRVERRGIER-----DRFERERGAFFNAVRESYLA 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNI 204
            A   P R  ++D+  S ++V  +I
Sbjct: 176 RAAQAPTRFAVIDADRSLEAVQASI 200


>gi|77406664|ref|ZP_00783707.1| thymidylate kinase [Streptococcus agalactiae H36B]
 gi|77174736|gb|EAO77562.1| thymidylate kinase [Streptococcus agalactiae H36B]
          Length = 211

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 120/215 (55%), Gaps = 5/215 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M  GL ISFEG +GAGKTT +  +   L+ K + D+  TREPGG   +E  RH++L    
Sbjct: 1   MKKGLMISFEGPDGAGKTTVLEAVLPLLREKLSQDILTTREPGGVTISEEIRHIILDVKH 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            +   + E +++ AAR  H+   + PAL EGKI+L DRF+DSS AYQG         +  
Sbjct: 61  TQMDKKTELLLYMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKW 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L + +     PD T+  D+P ++GL+R+Q     RE   LD  E+ D  +H++ RQ +L+
Sbjct: 121 LNDYATDSHKPDLTLYFDVPSEVGLERIQKSVQ-REVNRLD-LEQLD--MHQRVRQGYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +A  +P+R   +D++     V     +I+ + + +
Sbjct: 177 LADLEPNRIVTIDASQQLDEVIAETFSIILDRINQ 211


>gi|294787793|ref|ZP_06753037.1| dTMP kinase [Simonsiella muelleri ATCC 29453]
 gi|294484086|gb|EFG31769.1| dTMP kinase [Simonsiella muelleri ATCC 29453]
          Length = 207

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 115/199 (57%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FIS +GI+GAGKTT ++++K++ +++N  V  TREPGGTP  E  R +LL+    +    
Sbjct: 5   FISLDGIDGAGKTTQLNVIKQWFEKQNLPVQFTREPGGTPLGEKLRDILLNP-TSQINLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR  H++++I P L +   ++ DRF D+++AYQG         +  L+    
Sbjct: 64  TETLLMFAARQQHLDDIILPTLNQNISIVSDRFTDATFAYQGGGRGLPESDIAQLENWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI+LD+P++I ++R++N    RE    D FER++     + R  +L+ A   P
Sbjct: 124 GSLRPDLTILLDVPLEIAIQRIENS---REK---DRFERENSTFFNQVRTAYLNRAAANP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
            R  I+DS+H  +S    I
Sbjct: 178 KRYAIIDSSHDKESTKAQI 196


>gi|196233920|ref|ZP_03132757.1| dTMP kinase [Chthoniobacter flavus Ellin428]
 gi|196221969|gb|EDY16502.1| dTMP kinase [Chthoniobacter flavus Ellin428]
          Length = 218

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 118/224 (52%), Gaps = 7/224 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVL-LSCGV 59
           M  G+F+SFEG EG GK+T I LL   L+   + V +TREPGGT   E  RH+L  S   
Sbjct: 1   MPRGIFVSFEGSEGCGKSTQIRLLADRLKALGHQVILTREPGGTEIGEQLRHLLQFSKAG 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               +E E ++FAA+R   V  VI PAL  G I+L DRFLDS+  YQG         + +
Sbjct: 61  HAMASETELLLFAASRAQLVREVIAPALEAGAIVLADRFLDSTTVYQGVARKLDPAEVAA 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +   +V + +PD T + DL  D+ + R + R+    +   D  E +     E  R  +L 
Sbjct: 121 INRFAVGDTLPDITFVFDL--DLAIARERMRHRPAPAGAPDRMESQPAAFFEAVRAGYLA 178

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           +AR    R  ++D+A + + ++    N +W+ +  R+SPL   K
Sbjct: 179 LARENTTRVRLLDAAGTVEDLS----NRIWQELAPRLSPLPVTK 218


>gi|298530498|ref|ZP_07017900.1| thymidylate kinase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509872|gb|EFI33776.1| thymidylate kinase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 223

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 124/213 (58%), Gaps = 7/213 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T    L+ +L+   Y V VT EPGG+      R +LLS   D+   
Sbjct: 1   MFITFEGIEGCGKSTQTEFLRDYLEGLGYSVLVTLEPGGSRLGVELRRMLLSLESDDLTR 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           EAE  ++ A R  HV  VIRPAL  G+I++ DRF  S+ AYQG     + + +D+LQE++
Sbjct: 61  EAELFLYLADRAQHVHQVIRPALEAGRIVISDRFTHSTLAYQG---YGREMGVDALQEMN 117

Query: 125 VQEV---MPDCTIILDLPVDIGLKRVQNRYSLRE-SACLDYFERKDVMIHEKRRQIFLDI 180
           +  V   +PD T +LDLP + GL+R   R   +  ++    FE + +  H + RQ +L++
Sbjct: 118 IMAVDGTVPDITFLLDLPPETGLRRALGRNMEKNLTSSEGRFEAEALEFHVRVRQGYLEL 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A  + ++  ++D+    ++V   ++  V E+++
Sbjct: 178 ASRKKEKIVVLDAQALPETVFQGVVGKVNEIMK 210


>gi|315605270|ref|ZP_07880316.1| thymidylate kinase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315313087|gb|EFU61158.1| thymidylate kinase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 268

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 123/222 (55%), Gaps = 9/222 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG +G+GK+T I  ++ +   +  +V VTREPGGT      R  L+  G ++  
Sbjct: 7   GVFITFEGGDGSGKSTQILAVRDWFASRGREVVVTREPGGTELGAEIRR-LVQNGPEDVD 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++AA R  HV  V+ PAL  G ++L DR++DSS AYQG   S     + SL   
Sbjct: 66  ARTEALLYAADRAYHVTTVVAPALERGAVVLGDRYIDSSLAYQGAARSLGVDEISSLSAW 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + + + P  T +LDLP ++GL+R  +          D  ER+ +  HE+ R  +L +A  
Sbjct: 126 ATRGLYPSLTFLLDLPPEVGLRRHTD--------APDRMERESMDFHERVRHEYLRLADA 177

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225
           +PDR  ++D+  + + V + I  ++ E  +  V+ +    D+
Sbjct: 178 EPDRIVVIDAVGTVEEVFSEIRGVLVERFEGGVATIDEAADV 219


>gi|300172669|ref|YP_003771834.1| thymidylate kinase [Leuconostoc gasicomitatum LMG 18811]
 gi|299887047|emb|CBL91015.1| thymidylate kinase [Leuconostoc gasicomitatum LMG 18811]
          Length = 214

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 126/220 (57%), Gaps = 13/220 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGV 59
           M   LFI+FEG EGAGKT+ + +L   L+    D +  TREPGG P +EA R +L     
Sbjct: 1   MTKPLFITFEGPEGAGKTSVLEILISELKPLLGDELITTREPGGNPISEAIRAILQPAED 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +      EA+++ AAR  H+  +I PAL  GK+++ DR++DSS AYQG     + L +D+
Sbjct: 61  NGMDERTEALLYTAARRQHLVEIILPALKSGKVVISDRYIDSSLAYQG---GGRGLGVDN 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQ 175
           + +I   + + +MPD TI  D+P ++GL RV+ NR        +D  +++++  H+  RQ
Sbjct: 118 IWQINQFATEGLMPDLTIYFDVPPELGLARVKANR-----QGKIDRLDKENLSFHQTVRQ 172

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +L +  +  DR  I+D+A S   V  +   ++ + ++ R
Sbjct: 173 TYLQLQHDFSDRIKIIDAAQSLDQVVADTRELLLKTLKTR 212


>gi|319638548|ref|ZP_07993310.1| thymidylate kinase [Neisseria mucosa C102]
 gi|317400297|gb|EFV80956.1| thymidylate kinase [Neisseria mucosa C102]
          Length = 208

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 115/199 (57%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + ++    V  TREPGGTPA EA R +LL+    +    
Sbjct: 5   FITLDGIDGAGKSTNLAVMKAWFEKHKLPVLFTREPGGTPAGEALREILLNPAT-QVSLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR  H+E VI PAL  G  ++ DRF D+++AYQG         + +L+    
Sbjct: 64  TETLLMFAARQQHLETVILPALKNGTHVVSDRFTDATFAYQGGGRGVPLQDIATLEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
            +  PD T++LD+P+++ + R+      RE    D FE++      + R+++L  A  QP
Sbjct: 124 GDFRPDLTLLLDVPLEVSMARINQ---TREK---DRFEQEAAEFFNRVREVYLQRAAKQP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++DS  S  +V T I
Sbjct: 178 ERYAVIDSGQSLDAVKTQI 196


>gi|72163182|ref|YP_290839.1| thymidylate kinase [Thermobifida fusca YX]
 gi|71916914|gb|AAZ56816.1| thymidylate kinase [Thermobifida fusca YX]
          Length = 686

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 115/201 (57%), Gaps = 7/201 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF+  EG EG+GK+T +  +  +L+ + +DV  TREPG T      R +LL    +   
Sbjct: 465 GLFVVLEGGEGSGKSTQVREIAVWLRDEGFDVLTTREPGATKLGMRLRTMLLDKANEGMA 524

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++AA R +HV+ VIRPAL  G I++ DR++DS+ AYQG         + ++   
Sbjct: 525 ARTEALLYAADRAEHVDKVIRPALERGAIVISDRYVDSTLAYQGAGRELDPDDVATINNW 584

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD TI+LD+P + GL+R  +R +       D  E +++  HE+ R+ FL++A  
Sbjct: 585 ATGRLVPDLTILLDIPAEEGLRRHADRPA-------DRLESENLEFHERVRRCFLELADR 637

Query: 184 QPDRCHIVDSAHSFQSVATNI 204
            PDR  ++D+    + +   I
Sbjct: 638 APDRYLVLDAREPQEEITKAI 658


>gi|16804730|ref|NP_466215.1| thymidylate kinase [Listeria monocytogenes EGD-e]
 gi|224502896|ref|ZP_03671203.1| thymidylate kinase [Listeria monocytogenes FSL R2-561]
 gi|255028105|ref|ZP_05300056.1| thymidylate kinase [Listeria monocytogenes LO28]
 gi|284800421|ref|YP_003412286.1| hypothetical protein LM5578_0167 [Listeria monocytogenes 08-5578]
 gi|284993607|ref|YP_003415375.1| hypothetical protein LM5923_0167 [Listeria monocytogenes 08-5923]
 gi|23821785|sp|Q8Y3Y6|KTHY_LISMO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|16412193|emb|CAD00906.1| lmo2693 [Listeria monocytogenes EGD-e]
 gi|284055983|gb|ADB66924.1| hypothetical protein LM5578_0167 [Listeria monocytogenes 08-5578]
 gi|284059074|gb|ADB70013.1| hypothetical protein LM5923_0167 [Listeria monocytogenes 08-5923]
          Length = 208

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD +    L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKSVLCDRFMDSSLAYQGAGRDMNMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  +   
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|225849733|ref|YP_002729967.1| thymidylate kinase [Persephonella marina EX-H1]
 gi|225646361|gb|ACO04547.1| thymidylate kinase [Persephonella marina EX-H1]
          Length = 216

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIEGAGK+T   +L  +L +   +  +TREPGGT   +  R +LL+   + F 
Sbjct: 12  GFFITFEGIEGAGKSTQSKMLYEYLIKNGKNAVLTREPGGTDLGKKIREILLNPSKEIFP 71

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++ A R  HV N+I+P L  G  ++ DRF DS+ AYQG         ++ L +I
Sbjct: 72  PVAELMLYEADRNIHVHNIIKPYLNRGFYVISDRFTDSTLAYQGYARGIDIELVERLNDI 131

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + + + PD T I+D+PV+ G+KR+ +RY  RE    D  E++ V  H++ R+ FL IA+ 
Sbjct: 132 ASEGIKPDITFIIDIPVEEGMKRI-HRY--REK---DRIEQEGVDFHKRLREGFLRIAQK 185

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           + +R  ++D     + +   IL I+
Sbjct: 186 ERERVVLLDGRKDKEIIFNEILEIL 210


>gi|467418|dbj|BAA05264.1| unknown [Bacillus subtilis]
          Length = 212

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 125/215 (58%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SGLFI+FEG EGAGKTT +  +K  L  +   V  TREPGG   AE  R V+L+      
Sbjct: 2   SGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVILNENNILM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
             + EA+++AAAR  H+   ++PAL +G I+LCDRF+DS  AYQG    ++ L +D   S
Sbjct: 62  DPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSPLAYQG---YARGLGIDEVLS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E ++ ++MP  T+   +  + GLKR+    S RE   LD  E+ D   H K ++ + +
Sbjct: 119 INEFAIGDMMPHVTVYFSIDPEEGLKRIYANGS-REKNRLD-LEKLD--FHTKVQEGYQE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  P+R H VD+  S   V  ++L ++ E ++K
Sbjct: 175 LMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKK 209


>gi|77411409|ref|ZP_00787756.1| thymidylate kinase [Streptococcus agalactiae CJB111]
 gi|77162582|gb|EAO73546.1| thymidylate kinase [Streptococcus agalactiae CJB111]
          Length = 211

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 120/215 (55%), Gaps = 5/215 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M  GL ISFEG +GAGKTT +  +   L+ K + D+  TREPGG   +E  RH++L    
Sbjct: 1   MKKGLMISFEGPDGAGKTTVLEAVVPLLREKLSQDILTTREPGGVTISEEIRHIILDVKH 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            +   + E +++ AAR  H+   + PAL EGKI+L DRF+DSS AYQG         +  
Sbjct: 61  TQMDKKTELLLYMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKW 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L + +     PD T+  D+P ++GL+R+Q     RE   LD  E+ D  +H++ RQ +L+
Sbjct: 121 LNDYATDSHKPDLTLYFDVPSEVGLERIQKSVQ-REINRLD-LEQLD--MHQRVRQGYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +A  +P+R   +D++     V     +I+ + + +
Sbjct: 177 LADLEPNRIVTIDASQQLDEVIAETFSIILDRINQ 211


>gi|315283971|ref|ZP_07871975.1| thymidylate kinase [Listeria marthii FSL S4-120]
 gi|313612387|gb|EFR86525.1| thymidylate kinase [Listeria marthii FSL S4-120]
          Length = 208

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+  G +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITXXGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  + + 
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVIKM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            PDR   VD+  + + +   IL
Sbjct: 179 FPDRFMRVDATKTPEEITETIL 200


>gi|323706279|ref|ZP_08117845.1| thymidylate kinase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534331|gb|EGB24116.1| thymidylate kinase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 205

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 120/212 (56%), Gaps = 7/212 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G  I+FEGI+G+GKTT I+LLK++L     D+ V REPGGT   E  R +LL    +
Sbjct: 1   MYKGKLITFEGIDGSGKTTQINLLKKYLLEIGRDIVVLREPGGTAIGEKIREILLDKK-N 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AEA+++AA+R + V+ VI P+L +GKI++ DRF+DSS  YQG         ++ +
Sbjct: 60  NIVPSAEALLYAASRAELVKEVIIPSLNDGKIVILDRFVDSSIVYQGYARGLGVEVVEEI 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             I++  ++PD T+ LD+     L R+  R         D  E +D   HEK  + ++ +
Sbjct: 120 NSIAIDGLVPDLTVYLDIKPKDTLMRIDRR------KDKDRLEIEDAEFHEKVYEGYMKL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +++P R  IVD+ H    +   I++ V +++
Sbjct: 174 IKSKPGRYFIVDATHDIYYIQKVIIDEVSKII 205


>gi|225075646|ref|ZP_03718845.1| hypothetical protein NEIFLAOT_00662 [Neisseria flavescens
           NRL30031/H210]
 gi|224953068|gb|EEG34277.1| hypothetical protein NEIFLAOT_00662 [Neisseria flavescens
           NRL30031/H210]
          Length = 208

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + ++    V  TREPGGTPA EA R +LL+    +    
Sbjct: 5   FITLDGIDGAGKSTNLAVMKAWFEKHQLPVLFTREPGGTPAGEALREILLNPAT-QVSLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR  H+E VI PAL  G  ++ DRF D+++AYQG         + +L+    
Sbjct: 64  TETLLMFAARQQHLETVILPALKNGTHVVSDRFTDATFAYQGGGRGVPLQDIATLEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
            +  PD T++LD+P+++ + RV      RE    D FE++      + R+++L  A  QP
Sbjct: 124 GDFRPDLTLLLDVPLEVSMARVNQ---TREK---DRFEQEKAEFFNRVREVYLQRANEQP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS+ S  +V   I  ++
Sbjct: 178 ERYAVIDSSQSLDAVKNQIETVL 200


>gi|217966109|ref|YP_002351787.1| thymidylate kinase [Listeria monocytogenes HCC23]
 gi|254808300|sp|B8DAU8|KTHY_LISMH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|217335379|gb|ACK41173.1| thymidylate kinase [Listeria monocytogenes HCC23]
 gi|307572281|emb|CAR85460.1| tmk [Listeria monocytogenes L99]
          Length = 208

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAVGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  +   
Sbjct: 123 AIEDTLPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|160914736|ref|ZP_02076950.1| hypothetical protein EUBDOL_00743 [Eubacterium dolichum DSM 3991]
 gi|158433276|gb|EDP11565.1| hypothetical protein EUBDOL_00743 [Eubacterium dolichum DSM 3991]
          Length = 210

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 117/216 (54%), Gaps = 6/216 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+FEG +G+GKTT   L    L+   Y V  TREPGG   AE  RH++L     
Sbjct: 1   MKKGLFITFEGNDGSGKTTISMLAYESLKAAGYPVIYTREPGGIDIAEQIRHIILDPANT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AA+R  H+   + PAL + +I+LCDRFLDSS AYQG         +  +
Sbjct: 61  AMDGRCEALLYAASRRQHLVEKVLPALEKKQIVLCDRFLDSSLAYQGVARGIGVDEVYGI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E +++  MPD TI LD+ +++GL RV +R        LD  +++ +  H+   + +  +
Sbjct: 121 NEFAIEGCMPDATIYLDVSLEVGLARVASR------GNLDRMDQESMDFHQAVAKGYAIV 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
                 R HIV++    + V  + L ++ E+VQ  V
Sbjct: 175 REKFAKRMHIVNADQEVEKVLADTLKVLEEIVQPYV 210


>gi|269128739|ref|YP_003302109.1| thymidylate kinase [Thermomonospora curvata DSM 43183]
 gi|268313697|gb|ACZ00072.1| thymidylate kinase [Thermomonospora curvata DSM 43183]
          Length = 671

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 122/225 (54%), Gaps = 16/225 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG EGAGKTT   L   +L+   YDV  T EPG T      R +LL        
Sbjct: 451 GVFIAFEGGEGAGKTTQARLTAIWLRDHGYDVVTTNEPGATKVGMRLRAILLDKETTGLS 510

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A AE +++AA R +HV NVI+PAL  G I++ DR++DSS AYQG     + L ++ + E+
Sbjct: 511 ARAETLLYAADRANHVANVIKPALERGAIVVSDRYVDSSLAYQG---YGRELPVEEIAEV 567

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +   + PD T++LDLP   GL R  +     ES  LD+        HE+ R+ F  +
Sbjct: 568 NRWATDGLQPDLTVLLDLPPQTGLGRFASPADRMESEPLDF--------HERVRRGFRKL 619

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225
           A   PDR  ++D+    + ++  I + + +++   + P  S +DI
Sbjct: 620 AEADPDRYLVLDATRPQEELSRQIRDRLRQILPDPIPP--STEDI 662


>gi|167747824|ref|ZP_02419951.1| hypothetical protein ANACAC_02546 [Anaerostipes caccae DSM 14662]
 gi|317473408|ref|ZP_07932702.1| thymidylate kinase [Anaerostipes sp. 3_2_56FAA]
 gi|167653186|gb|EDR97315.1| hypothetical protein ANACAC_02546 [Anaerostipes caccae DSM 14662]
 gi|316899058|gb|EFV21078.1| thymidylate kinase [Anaerostipes sp. 3_2_56FAA]
          Length = 216

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 120/204 (58%), Gaps = 12/204 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+ EG +GAGK+T I LL+ +L +K YD+ V REPGGT  +EA R V+L+      G
Sbjct: 7   GIFITMEGPDGAGKSTQIDLLRVYLLQKGYDIIVCREPGGTVISEAIREVILNRDYKNMG 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++AAAR   VE VI+PAL +GK+++CDRF++SS  YQG    ++ L +D + E+
Sbjct: 67  HMTELLLYAAARAQLVEEVIQPALDQGKVVICDRFIESSAVYQG---IARGLGVDLVYEV 123

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +V   MPD T++LD+  + G+ R       ++ A LD  E + +  H K  + +  +
Sbjct: 124 NRFAVGNTMPDITLLLDVDAETGIGRK------KQQAELDRMESEKLEFHRKVVEGYRLL 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A    +R   +D  +S + +   I
Sbjct: 178 AERDKNRMVKIDGRNSIEEIHRQI 201


>gi|308235275|ref|ZP_07666012.1| thymidylate kinase [Gardnerella vaginalis ATCC 14018]
 gi|311114155|ref|YP_003985376.1| thymidylate kinase [Gardnerella vaginalis ATCC 14019]
 gi|310945649|gb|ADP38353.1| thymidylate kinase [Gardnerella vaginalis ATCC 14019]
          Length = 233

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 110/194 (56%), Gaps = 12/194 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +N GLFISFEGI+G GKTT +  L+ FLQ +  +V VTREPGGTP  E  R++LL  G  
Sbjct: 13  LNKGLFISFEGIDGVGKTTQVEALRDFLQARGLEVVVTREPGGTPLGEQLRNILLHGGA- 71

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDS 119
              A  EA++FAA R  H   +I PAL  G +++ DR++DSS AYQ G R+ +     D 
Sbjct: 72  -ISARTEALLFAADRAQHAAQIIIPALRRGAVVITDRYIDSSLAYQSGGRELTMQDVRD- 129

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L E +   + P+ T +LD+       R+  +    ESA LD+  R         R+ FLD
Sbjct: 130 LSEWASNCLWPNRTYLLDMSEKDAAVRLHGQADRMESAGLDFARRT--------REAFLD 181

Query: 180 IARNQPDRCHIVDS 193
           +A+    R  ++D+
Sbjct: 182 LAKQNAQRFCVLDA 195


>gi|300087976|ref|YP_003758498.1| thymidylate kinase [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527709|gb|ADJ26177.1| thymidylate kinase [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 207

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 111/213 (52%), Gaps = 11/213 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EGAGK+T   LL   L        +TREPGGTP  E    +L    + 
Sbjct: 1   MKQGKFITFEGCEGAGKSTQAGLLAGMLASNGMKTILTREPGGTPLGEEISRLLKWGKIG 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +  A +E ++F A+R + V  VI PAL  GKI++CDRF DSS  YQG         +  +
Sbjct: 61  DIDALSELLLFNASRAELVFTVIEPALKAGKIVICDRFTDSSLVYQGGGRGLSTETVIRV 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +I+ + + PD TI+LD+P+  G  R  N  +       D FE++    H+  RQ +L +
Sbjct: 121 NDIATRGLKPDMTILLDIPISTGQHRKSNSVA-------DRFEQEADEFHKSVRQSYLAL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A   P+R  +V+   S     + +   VW+ V+
Sbjct: 174 AEADPERWKVVNGTLS----RSEVTEAVWKHVK 202


>gi|313606342|gb|EFR83276.1| thymidylate kinase [Listeria monocytogenes FSL F2-208]
          Length = 208

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  +LL + +     D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD +    L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +P+ T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  +   
Sbjct: 123 AIEDTLPNRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDITYHEKVQAGYEKVINM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERFMRVDATKTPEEITETIL 200


>gi|183602882|ref|ZP_02964242.1| thymidylate kinase [Bifidobacterium animalis subsp. lactis HN019]
 gi|219682707|ref|YP_002469090.1| thymidylate kinase [Bifidobacterium animalis subsp. lactis AD011]
 gi|241190283|ref|YP_002967677.1| Thymidylate kinase [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|241195689|ref|YP_002969244.1| Thymidylate kinase [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|183217883|gb|EDT88534.1| thymidylate kinase [Bifidobacterium animalis subsp. lactis HN019]
 gi|219620357|gb|ACL28514.1| thymidylate kinase [Bifidobacterium animalis subsp. lactis AD011]
 gi|240248675|gb|ACS45615.1| Thymidylate kinase [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|240250243|gb|ACS47182.1| Thymidylate kinase [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|289178000|gb|ADC85246.1| Thymidylate kinase [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295793270|gb|ADG32805.1| Thymidylate kinase [Bifidobacterium animalis subsp. lactis V9]
          Length = 206

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 121/217 (55%), Gaps = 15/217 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +GLFISFEG++GAGKTT ++LL  +L+    +V VTREPGGT      R +LL+   D
Sbjct: 1   MGAGLFISFEGVDGAGKTTQVNLLADYLRALGREVVVTREPGGTALGTQIRAMLLTTNPD 60

Query: 61  -EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            E     EA++FAA R  HV  VIRPAL  G +++ DR+LDSS AYQ      + L  D 
Sbjct: 61  EEISPRTEALLFAADRAQHVSEVIRPALERGAVVITDRYLDSSLAYQS---GGRELTADD 117

Query: 120 LQEISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           ++ +S+     ++P  T +LD+       R+++     ESA  D+ +R         R  
Sbjct: 118 IRTLSMWATNNLLPARTYLLDIDPRASHTRLEHAEDRMESAGDDFQQRT--------RTA 169

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           FL++A  QP R  ++D+  S   +A  I + V  L++
Sbjct: 170 FLELAAVQPQRFCVIDAQQSVGEIAALICDDVANLLE 206


>gi|297543636|ref|YP_003675938.1| thymidylate kinase [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|296841411|gb|ADH59927.1| thymidylate kinase [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 204

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 111/206 (53%), Gaps = 8/206 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G FISFEGI+G GKTT I  LK +L +K Y++ V REPGGT   E  R +LL    +  
Sbjct: 2   KGKFISFEGIDGCGKTTQIKFLKEYLLKKGYNILVLREPGGTNVGEKVRDILLDK-YNFI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               E +++A++R   VE  I PA+ EGKI+L DRF+DSSY YQG         +  + E
Sbjct: 61  SPVTEMLLYASSRAQLVEEKILPAIKEGKIVLLDRFVDSSYVYQGYARGLGIEKVKIVNE 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I+   ++PD TI +D+  +  +KR   R +       D  ER+    H+K R+ ++ + +
Sbjct: 121 IATMGILPDVTIYIDITPEEAMKRRGKREA-------DRLERESWDFHKKVREGYIKLVK 173

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
             P R   +D       V  +I++ V
Sbjct: 174 EYPKRFVFIDGMQEIVKVHQDIIDAV 199


>gi|237748461|ref|ZP_04578941.1| thymidylate kinase [Oxalobacter formigenes OXCC13]
 gi|229379823|gb|EEO29914.1| thymidylate kinase [Oxalobacter formigenes OXCC13]
          Length = 207

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 114/210 (54%), Gaps = 9/210 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +SG FI+FEGI+GAGK+THI  +   L+  N  V VTREPGGT   E  R +LL    D+
Sbjct: 6   HSGRFITFEGIDGAGKSTHIQFVTDLLRADNRQVVVTREPGGTVLGEKLREMLLH---DK 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              E EA++  AAR +H+  VI PAL  G  ++ DRF D+S+AYQG         +  L+
Sbjct: 63  MNLETEALLMFAARREHIAEVIEPALQRGDWVISDRFTDASFAYQGGGRGLDLHKMRQLE 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E     + PD T++ D+  ++   R      L  +   D FER+      + R  +L  A
Sbjct: 123 EWVHPHLQPDLTLLFDVSPEVAQAR------LEAARSPDKFEREKSGFFNRVRDEYLRRA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
           +  PDR  ++DS+ S +++   I  ++ EL
Sbjct: 177 KEFPDRFRVIDSSRSIEAIRETIKGLIGEL 206


>gi|256827342|ref|YP_003151301.1| thymidylate kinase [Cryptobacterium curtum DSM 15641]
 gi|256583485|gb|ACU94619.1| thymidylate kinase [Cryptobacterium curtum DSM 15641]
          Length = 295

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 108/209 (51%), Gaps = 4/209 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG +GAGK+THI  L R L++  Y V   REPGGT A EA R V+L    +   
Sbjct: 59  GAFITFEGGDGAGKSTHIKFLARALEQCGYSVVRLREPGGTQAGEALRQVVLDPSYEGLS 118

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           AE+E +++ AAR   V+ VI PAL  GKI+LCDRF DS+ AYQ         F+      
Sbjct: 119 AESELLIYEAARAQLVKEVIAPALAAGKIVLCDRFCDSTIAYQAYGRGLSRDFVQEANLF 178

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + Q + PD T+++  P      R Q   + R     D  E   V  H + R+ F  IA +
Sbjct: 179 ACQGIKPDRTVLIKAPTSA---RKQLERATRAQG-PDRIELAGVEFHTRVREAFDAIAAS 234

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            PDR  +V SA      A  +   V + V
Sbjct: 235 DPDRVRVVVSASRKSETARLVFAAVADCV 263


>gi|34499178|ref|NP_903393.1| thymidylate kinase [Chromobacterium violaceum ATCC 12472]
 gi|46576426|sp|Q7NRQ7|KTHY_CHRVO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|34105029|gb|AAQ61385.1| dTMP kinase [Chromobacterium violaceum ATCC 12472]
          Length = 212

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 112/205 (54%), Gaps = 7/205 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +  G FI+ EGI+GAGK+TH+S ++ +L R   D   TREPGGTP +E  R +LL  G  
Sbjct: 5   VRRGRFITLEGIDGAGKSTHLSFIRDWLARHGVDAAFTREPGGTPLSEKIRDLLLDPGTV 64

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               +AEA++  AAR  H+  VI PAL  G+ L+ DRF DS+YA+QG         + +L
Sbjct: 65  A-SLDAEALLAFAARQQHIAEVIEPALAAGRWLVSDRFTDSTYAFQGGGRGVPFERIRAL 123

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++   + + PD T++ DLP ++   R+        +   D FE++    H + R  +L  
Sbjct: 124 EDWVQRGLQPDLTLLFDLPTEVAAGRMAG------TRVPDRFEQEAADFHRRVRAAYLRR 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNIL 205
           A   P R  ++D++     +  +I+
Sbjct: 178 AEEAPQRIAVLDASRGIADIQADIV 202


>gi|257869781|ref|ZP_05649434.1| thymidylate kinase [Enterococcus gallinarum EG2]
 gi|257803945|gb|EEV32767.1| thymidylate kinase [Enterococcus gallinarum EG2]
          Length = 215

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 111/209 (53%), Gaps = 5/209 (2%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           SGLFI+ EG +GAGKT+ +  L  R       D+  TREPGG   AE  R ++L     E
Sbjct: 2   SGLFITIEGPDGAGKTSVLEELYPRLQLEAKRDIVKTREPGGVKIAEKIRRIILDPKNSE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+  VI PAL EGKI++CDRF+DSS AYQG         +  + 
Sbjct: 62  MDERTEALLYAAARRQHLIQVILPALNEGKIVICDRFVDSSLAYQGAGRRIGIPEIARIN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E + +   PD T+ LD+  D GL+R+Q       +  LD  + + +  H++ R  +L +A
Sbjct: 122 EFATEGTEPDFTLYLDVDSDTGLRRIQE----HRAHQLDRLDAEGLEFHQRVRHAYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              P R H VD+    Q V     + + E
Sbjct: 178 EENPVRIHKVDARMGLQDVVETSFSAIVE 206


>gi|184154763|ref|YP_001843103.1| thymidylate kinase [Lactobacillus fermentum IFO 3956]
 gi|227514030|ref|ZP_03944079.1| dTMP kinase [Lactobacillus fermentum ATCC 14931]
 gi|260663208|ref|ZP_05864100.1| thymidylate kinase [Lactobacillus fermentum 28-3-CHN]
 gi|238692945|sp|B2GAE1|KTHY_LACF3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|183226107|dbj|BAG26623.1| thymidylate kinase [Lactobacillus fermentum IFO 3956]
 gi|227087616|gb|EEI22928.1| dTMP kinase [Lactobacillus fermentum ATCC 14931]
 gi|260552400|gb|EEX25451.1| thymidylate kinase [Lactobacillus fermentum 28-3-CHN]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 117/206 (56%), Gaps = 11/206 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGVDE 61
           SG FISFEG +GAGKT+ ++ ++  L  +  D V  TREPGG P AE  R VLL      
Sbjct: 2   SGRFISFEGPDGAGKTSVLTAIRTGLVNQLGDQVVYTREPGGNPIAEQVRAVLLDKQNGA 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AA+R  HV   ++PAL  GK++LCDR+LDSS AYQG     + L +D + 
Sbjct: 62  MDDWTEALLYAASRRQHVVETLKPALEAGKLILCDRYLDSSIAYQG---GGRELGIDRIW 118

Query: 122 EI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           E+   ++  ++PD TI LDLPV+ GL R++       +  ++  + +    H + RQ +L
Sbjct: 119 ELNQYAIDGLLPDLTIFLDLPVETGLARIEK----GRAETINRLDEQTTNFHRRVRQAYL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNI 204
            +A   P+R   V++      V  ++
Sbjct: 175 TLAERFPERIVKVNADQELARVIEDV 200


>gi|317153459|ref|YP_004121507.1| thymidylate kinase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943710|gb|ADU62761.1| thymidylate kinase [Desulfovibrio aespoeensis Aspo-2]
          Length = 213

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 111/206 (53%), Gaps = 3/206 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GKTT I+ LK + + +   VH+TREPGG+      R +LL     +   
Sbjct: 1   MFITFEGIEGTGKTTQIARLKEYFESRGRAVHLTREPGGSRVGRELRQMLLHVDNADLTP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E  ++ A R  HV  VIRP L  G+++LCDRF DS+  YQG         L  L E++
Sbjct: 61  ITELFLYLADRAQHVAQVIRPQLEAGRVVLCDRFADSTIVYQGFGRGLDTAILKQLNEVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLDIAR 182
           V  V PD TI+LD+  ++GLKR   R +L +    +   FE + +  H + R+ +L  A 
Sbjct: 121 VDGVWPDLTIVLDIDPEVGLKRATLR-NLDDGKAKEEGRFEAEHISFHRRIREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
              DR  + D++ +   V   +  ++
Sbjct: 180 LNRDRIRVADASATPDEVFARVKALI 205


>gi|313636002|gb|EFS01921.1| thymidylate kinase [Listeria seeligeri FSL S4-171]
          Length = 208

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  ++L + ++    D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTMLTKKMEEAGVDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALEAGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+      RE   LD   ++D+  HEK +  +  I   
Sbjct: 123 AIEDTIPDRTYYLDVPAEVGLARIAANKG-REVNRLD---KEDISYHEKVQAGYEKIMAM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERYMRVDATKTPEEITDVIL 200


>gi|304405877|ref|ZP_07387535.1| thymidylate kinase [Paenibacillus curdlanolyticus YK9]
 gi|304345120|gb|EFM10956.1| thymidylate kinase [Paenibacillus curdlanolyticus YK9]
          Length = 211

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 119/210 (56%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+FI+ EG EGAGKTT IS L   L      V +TREPGG P AE  R V+L     
Sbjct: 1   MEQGVFITIEGGEGAGKTTIISRLAAELSALGDTVTITREPGGIPIAEQIRAVILDRNHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AAAR  H+   + PAL +G ++LCDRF+DSS AYQG         + ++
Sbjct: 61  GMDGRTEALLYAAARRQHLVEKVVPALEKGHVVLCDRFIDSSLAYQGHARGIGMEAVLAI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              ++  +MP  T+ LD+  ++GL+R+Q    +RE   ++  + + +  HE+ R+ FL +
Sbjct: 121 NAFAIDGMMPKLTLYLDVRPEVGLRRIQE-AEVRE---INRIDLEAITFHEQVREGFLQL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A+   DR  ++D+  S  +V    ++I+ +
Sbjct: 177 AQMYSDRIVVIDAEQSADAVFEQCMSIILK 206


>gi|313664899|ref|YP_004046770.1| dTMP kinase [Mycoplasma leachii PG50]
 gi|312949571|gb|ADR24167.1| dTMP kinase [Mycoplasma leachii PG50]
          Length = 213

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 122/216 (56%), Gaps = 7/216 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG++G+GKTT +  +K  L+R NY V +TREPGG   AE  R ++L         
Sbjct: 1   MFITFEGMDGSGKTTALLKVKEELERLNYKVLITREPGGEVIAEQIRQIILDNKNKNMDV 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++F A+R  H++ VI+PAL +  I++ DRF+DS+ AYQG   +     ++ +Q+I 
Sbjct: 61  WTEALLFIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQGSARNIGVDVVNQVQQIV 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           ++  +PD T+  D+      KR+Q    LR  +  +  + ++    +K  Q +L++ +N 
Sbjct: 121 LKNCLPDLTLFFDVSFSEAEKRMQ----LRGESSKNRLDEEENNFKQKVYQGYLELIKNN 176

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV---QKRVS 217
           P+R  ++D+      V    + I+ E +   +KR S
Sbjct: 177 PERIKVIDANKDIDQVYNQAIKIILEKLKENEKRTS 212


>gi|262379436|ref|ZP_06072592.1| thymidylate kinase [Acinetobacter radioresistens SH164]
 gi|262298893|gb|EEY86806.1| thymidylate kinase [Acinetobacter radioresistens SH164]
          Length = 202

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 116/211 (54%), Gaps = 12/211 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  +    ++K  ++ +TREPGGT  AE  R +LLS   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIREIYAHYEQKGAEIILTREPGGTSLAEQIRALLLSVSHDEKMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ--GERDSSQHLFLDSLQ 121
            + E ++  AAR  H++ VI PAL  GK +LCDRF D+S+AYQ  G   +   L L +  
Sbjct: 61  DDTELLLMYAARAQHLQQVILPALQAGKTVLCDRFTDASFAYQCAGRGLNENKLALLNQS 120

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +S    MPD T+ LD PV++G+ R       RE   LD FE++ V   EK R  +  + 
Sbjct: 121 FVS---RMPDITLWLDAPVELGMSRA------RERGALDRFEQEKVSFFEKVRAGYTRLW 171

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +  P+R   +D+  + + V    L  + +L 
Sbjct: 172 QQHPERIKRLDATQAPEKVLEQALEQIGKLA 202


>gi|298244278|ref|ZP_06968084.1| thymidylate kinase [Ktedonobacter racemifer DSM 44963]
 gi|297551759|gb|EFH85624.1| thymidylate kinase [Ktedonobacter racemifer DSM 44963]
          Length = 217

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 116/217 (53%), Gaps = 9/217 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+ ISFEG++GAGKTT ++LL+ +LQ +      TREPGG+P     R +LL+    
Sbjct: 1   MERGVLISFEGLDGAGKTTQMNLLEAWLQSQGVSYLRTREPGGSPLGVEIRRLLLNRPDL 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AEA++F A R  H   VI PAL EGK+++ DR  DSS AYQG         ++ L
Sbjct: 61  HISPLAEALLFQADRAQHFAEVILPALDEGKVIVSDRCFDSSIAYQGAARGVGEQLVEDL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR-----ESACLDYFERKDVMIHEKRRQ 175
             ++ Q   PD TI+LDLP +    +VQ R +L            +F+R+    H   R+
Sbjct: 121 SLLATQGHQPDLTIMLDLPPE----KVQQRTNLAVDQGGTRTEQSHFDRETETFHRTLRE 176

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            FL +AR  P R  ++D++ + + +   I   V  L+
Sbjct: 177 AFLTLARRHPQRIKVLDASRTPEVIQREIQGHVERLL 213


>gi|289435959|ref|YP_003465831.1| hypothetical protein lse_2598 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172203|emb|CBH28749.1| tmk [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 208

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 116/202 (57%), Gaps = 6/202 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG +G+GKTT  ++L + ++    D   TREPGG+P +E  R+++L  G +E   
Sbjct: 4   IFITLEGPDGSGKTTVGTMLTKKMEEAGVDFIKTREPGGSPISEKVRNIVLGIGNEEMDP 63

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQEI 123
           + E ++ A AR  HV   IRPAL  GK +LCDRF+DSS AYQG  RD      L  +   
Sbjct: 64  KTEVLLIAGARRQHVVETIRPALEAGKTVLCDRFMDSSLAYQGAGRDMDMEQVL-QVNLY 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++++ +PD T  LD+P ++GL R+    +  +   ++  +++D+  HEK +  +  I   
Sbjct: 123 AIEDTIPDRTYYLDVPAEVGLARI----AANKGREINRLDKEDISYHEKVQAGYEKIMAM 178

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
            P+R   VD+  + + +   IL
Sbjct: 179 FPERYMRVDATKTPEEITDVIL 200


>gi|188996346|ref|YP_001930597.1| dTMP kinase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|229621845|sp|B2V7X0|KTHY_SULSY RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|188931413|gb|ACD66043.1| dTMP kinase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 204

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 116/203 (57%), Gaps = 8/203 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGIE +GKTT I+LL  +L+    +V  TREPGGT   +  R +LLS   ++F 
Sbjct: 2   GFFITFEGIEASGKTTQINLLYDYLKSIGKNVIKTREPGGTKIGQKIREILLSKWDEKFP 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++ + R  H++++++P+L  G I+L DR++DS+ AYQ       +  +  L  +
Sbjct: 62  YIAELLLYESDRNIHIQSIVKPSLDAGYIVLSDRYIDSTTAYQHYARGIDYEIVSYLNTL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   + P+ T ++D+PV+I LKR+        S   D  E +D+  H+K R+ FL IA N
Sbjct: 122 ATDGLKPNLTFLIDIPVEISLKRL--------SESKDRIESEDIEFHKKLREGFLKIAEN 173

Query: 184 QPDRCHIVDSAHSFQSVATNILN 206
           +  R  ++D       +   I++
Sbjct: 174 EKGRFVVIDGTMDIMEIHKIIVD 196


>gi|255262414|ref|ZP_05341756.1| thymidylate kinase [Thalassiobium sp. R2A62]
 gi|255104749|gb|EET47423.1| thymidylate kinase [Thalassiobium sp. R2A62]
          Length = 208

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 108/203 (53%), Gaps = 9/203 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + G FI+FEGI+G+GK+T   +L   + R      +TREPGG+  AE  R +LLS   D 
Sbjct: 3   DHGHFITFEGIDGSGKSTQARML---VDRLGAQTLLTREPGGSEGAEEIRGLLLSGDTDR 59

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  I PAL  G  ++ DRF DS+  YQG         +D L 
Sbjct: 60  WSAETEILLFTAARRDHLEKTIEPALAAGTTVISDRFADSTRVYQGATRGDLRATVDQLH 119

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +    PD T I+D+   I LKR      L      D FE   +   E  R  FL +A
Sbjct: 120 TLMIGR-EPDLTFIIDMDPAIALKR-----GLARETGEDRFEDFGLAFQETLRHGFLALA 173

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
           R+ P+RC ++D   + + VA+ +
Sbjct: 174 RDMPNRCVVIDGNRTPEQVASEV 196


>gi|56418559|ref|YP_145877.1| thymidylate kinase [Geobacillus kaustophilus HTA426]
 gi|261417524|ref|YP_003251206.1| thymidylate kinase [Geobacillus sp. Y412MC61]
 gi|297528399|ref|YP_003669674.1| thymidylate kinase [Geobacillus sp. C56-T3]
 gi|319765181|ref|YP_004130682.1| thymidylate kinase [Geobacillus sp. Y412MC52]
 gi|73920820|sp|Q5L3W9|KTHY_GEOKA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|56378401|dbj|BAD74309.1| thymidylate kinase [Geobacillus kaustophilus HTA426]
 gi|261373981|gb|ACX76724.1| thymidylate kinase [Geobacillus sp. Y412MC61]
 gi|297251651|gb|ADI25097.1| thymidylate kinase [Geobacillus sp. C56-T3]
 gi|317110047|gb|ADU92539.1| thymidylate kinase [Geobacillus sp. Y412MC52]
          Length = 214

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 111/198 (56%), Gaps = 4/198 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G F SFEG EGAGKTT IS L+  L+ +  DV  TREPGG   AEA R ++L+    E 
Sbjct: 6   NGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPGGVRIAEAIRSIILNRDYTEM 65

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF+DSS AYQG         +  + E
Sbjct: 66  DGRTEALLYAAARRQHLLEKIVPALEAGCVVLCDRFVDSSLAYQGFARGLGIEEVWKINE 125

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++   MP  TI  D+   IGL+R++ R   RE   LD    + +  HEK R+ + ++AR
Sbjct: 126 FAIDGYMPSLTIYFDIDPQIGLERIR-RNRGREVNRLDL---ETLSFHEKVREGYRELAR 181

Query: 183 NQPDRCHIVDSAHSFQSV 200
              DR  ++D+      V
Sbjct: 182 RFADRIVVIDANRPLDDV 199


>gi|126652958|ref|ZP_01725100.1| thymidylate kinase [Bacillus sp. B14905]
 gi|126590288|gb|EAZ84410.1| thymidylate kinase [Bacillus sp. B14905]
          Length = 215

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 123/216 (56%), Gaps = 10/216 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M S LFI+FEG EGAGKTT I  +   L   N DV  TREPGG   AE  R ++L+    
Sbjct: 7   MKSNLFITFEGPEGAGKTTVIQKIAERLAEINIDVLATREPGGIEIAEKIRTIILNPAHT 66

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
                 EA+++AAAR  H    ++PAL  GK+++CDRF+DSS AYQG    ++ + +D  
Sbjct: 67  AMDERTEALLYAAARSQHYFEKVQPALDAGKLVICDRFIDSSLAYQG---YARGIGIDEV 123

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+ E ++ + +PD TI+ D+  ++GL R+    + RE   LD    + +  H+K  + +
Sbjct: 124 LSINEFAIGKKLPDMTILFDIAPEVGLARIYATGN-REVNRLDV---ESLPFHQKVHEGY 179

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           L +    P+R  IV++     SV  ++ +++ + +Q
Sbjct: 180 LLLVERYPERIRIVNADQDIDSVVEDVWSLLLDAIQ 215


>gi|296111513|ref|YP_003621895.1| thymidylate kinase [Leuconostoc kimchii IMSNU 11154]
 gi|295833045|gb|ADG40926.1| thymidylate kinase [Leuconostoc kimchii IMSNU 11154]
          Length = 214

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 124/220 (56%), Gaps = 13/220 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M   LFI+FEG EGAGKT+ ++ L+  F Q    D+  TREPGG P +EA R +L     
Sbjct: 1   MTKPLFITFEGPEGAGKTSVLNQLVAEFQQTLGDDLISTREPGGNPISEAIRAILQPEED 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +      EA+++ AAR  H+   + PAL  GK+++ DR++DSS AYQG     + L +D 
Sbjct: 61  NGMDDRTEALLYTAARRQHLVETVLPALKAGKVVISDRYVDSSLAYQG---GGRGLGVDH 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQ 175
           + +I   ++  ++PD TI  DLP ++GL RV+ NR        +D  +++ +  H+K R+
Sbjct: 118 IWQINQFAIDGLLPDLTIYFDLPSELGLARVKANR-----QGKIDRLDKESLAFHQKVRK 172

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +L++     DR  IVD+  S  +V      ++ E ++ R
Sbjct: 173 TYLELQVKFSDRIKIVDATQSLDNVVDATRQLILERMKYR 212


>gi|167038531|ref|YP_001666109.1| dTMP kinase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167038727|ref|YP_001661712.1| dTMP kinase [Thermoanaerobacter sp. X514]
 gi|256751401|ref|ZP_05492280.1| thymidylate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913688|ref|ZP_07131005.1| thymidylate kinase [Thermoanaerobacter sp. X561]
 gi|307723297|ref|YP_003903048.1| thymidylate kinase [Thermoanaerobacter sp. X513]
 gi|320116927|ref|YP_004187086.1| thymidylate kinase [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|238687559|sp|B0K119|KTHY_THEPX RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|238687643|sp|B0K7K7|KTHY_THEP3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|166852967|gb|ABY91376.1| dTMP kinase [Thermoanaerobacter sp. X514]
 gi|166857365|gb|ABY95773.1| dTMP kinase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256749783|gb|EEU62808.1| thymidylate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890373|gb|EFK85518.1| thymidylate kinase [Thermoanaerobacter sp. X561]
 gi|307580358|gb|ADN53757.1| thymidylate kinase [Thermoanaerobacter sp. X513]
 gi|319930018|gb|ADV80703.1| thymidylate kinase [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 203

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 112/206 (54%), Gaps = 8/206 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G FISFEGI+G GKTT I  L+ +L ++ Y++ V REPGGT   E  R +LL    +  
Sbjct: 2   KGKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKVGEKVRDILLDKN-NFI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               E +++A++R   VE  I PA+ EGKI+L DRF+DSSY YQG         +  + E
Sbjct: 61  SPVTEMLLYASSRAQLVEEKILPAIEEGKIVLLDRFVDSSYVYQGYARGLGIEKVKVVNE 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I+   ++PD TI +D+  +  +KR   R +       D  ER+    H+K R+ ++ + +
Sbjct: 121 IATMGILPDVTIYIDITPEEAMKRRGKREA-------DRLERESWDFHKKVREGYIKLVK 173

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
             P R   +D       V  +I+++V
Sbjct: 174 EFPKRFVFIDGMQELMKVHKDIIDVV 199


>gi|320159579|ref|YP_004172803.1| thymidylate kinase [Anaerolinea thermophila UNI-1]
 gi|319993432|dbj|BAJ62203.1| thymidylate kinase [Anaerolinea thermophila UNI-1]
          Length = 205

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 113/200 (56%), Gaps = 6/200 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EG+GKTT I L   FL+ + YDV  TREPGGT  ++  R VL++        
Sbjct: 1   MFITFEGPEGSGKTTQIRLFAEFLRARGYDVLTTREPGGTEISDQIRAVLVNLRNTAMHP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E ++F AAR   VE VIRPAL  G ++L DR+ DS+ AYQG         L  L + +
Sbjct: 61  RTEILLFQAARAQLVEQVIRPALSRGTLVLSDRYADSTLAYQGYGHGYPLEELRRLIDFA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              ++PD T +LD+    GL+R Q      E   LD +   D+  H++ R  +L++AR +
Sbjct: 121 TGGLIPDLTFLLDVNPAQGLERKQRE---GEWNRLDAY---DLGFHQRVRAGYLEMARAE 174

Query: 185 PDRCHIVDSAHSFQSVATNI 204
           P R  +VD+  S + + ++I
Sbjct: 175 PHRWVVVDATQSIEVIQSDI 194


>gi|148259980|ref|YP_001234107.1| dTMP kinase [Acidiphilium cryptum JF-5]
 gi|326403065|ref|YP_004283146.1| thymidylate kinase [Acidiphilium multivorum AIU301]
 gi|146401661|gb|ABQ30188.1| thymidylate kinase [Acidiphilium cryptum JF-5]
 gi|325049926|dbj|BAJ80264.1| thymidylate kinase [Acidiphilium multivorum AIU301]
          Length = 210

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+ EG EGAGK+T I+ L   L+   ++V  TREPGGTP AEA R ++L      F 
Sbjct: 5   GVFITLEGGEGAGKSTQIARLAARLRAAGHEVLTTREPGGTPGAEAIRALMLDP-ARHFA 63

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             A+ ++  AAR DHV  +IRPAL  G ++LCDRF DS+ AYQG         + +L   
Sbjct: 64  PLADTLLVFAARADHVAAIIRPALEHGAVVLCDRFTDSTMAYQGHGLGVDRAAIATLG-- 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++    PD T+ILDLP  I   R+ +R         D +E+ D     +    F  IA  
Sbjct: 122 AMIGATPDLTLILDLPDAIARARLAHR-----GGAADRYEQFDTGFAIRVADGFRAIAAA 176

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
           +PDRC +VD+A   + V   +  ++
Sbjct: 177 EPDRCVLVDAAGGIEDVTETLAGLI 201


>gi|325982933|ref|YP_004295335.1| thymidylate kinase [Nitrosomonas sp. AL212]
 gi|325532452|gb|ADZ27173.1| thymidylate kinase [Nitrosomonas sp. AL212]
          Length = 208

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 119/215 (55%), Gaps = 13/215 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G F++ EGI+GAGK+T +  +   LQR      VTREPGGT   E  R +LL   + 
Sbjct: 1   MKQGKFLTLEGIDGAGKSTQLVWIAELLQRAGLSAVVTREPGGTLLGEQLRALLLDKFI- 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GER--DSSQHLFL 117
               E EA++  AAR +H++ VI PAL +G+ ++ DRF D+S+AYQ G R  DS++ + L
Sbjct: 60  SMHPETEALLMFAARREHLDKVIFPALAQGQWVISDRFTDASFAYQSGGRGLDSAKLVIL 119

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           +   + ++Q   PD T+  D+P D+G +RV           +D FE++      + R  +
Sbjct: 120 EQWVQGALQ---PDLTLYFDVPADVGQQRVSR------GGVVDRFEQEQADFFLRVRAAY 170

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           LD A+  PDR  I+DS  S   V   +  I+  L+
Sbjct: 171 LDRAQQFPDRIKIIDSNRSLPEVKVAVEQILQPLL 205


>gi|89898307|ref|YP_515417.1| thymidylate kinase [Chlamydophila felis Fe/C-56]
 gi|123483364|sp|Q254L6|KTHY_CHLFF RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|89331679|dbj|BAE81272.1| thymidylate kinase [Chlamydophila felis Fe/C-56]
          Length = 207

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 112/209 (53%), Gaps = 8/209 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI  EG EG+GK++   LLK  L  +   V  TREPGG+P  E  R+ +L+  +     
Sbjct: 1   MFIVIEGCEGSGKSSLTELLKNRLITEGKSVIATREPGGSPLGEQVRNWILNPSLPGISP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL--QE 122
             E  +F A+R  H+   I PAL  GKI++CDRF DS+  YQG  +     ++ +L    
Sbjct: 61  YTELFLFLASRAQHITEKIIPALESGKIVICDRFHDSTIVYQGIAEGLGKEYVTNLCHHV 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +  ++ +PD T +LD+PVD G+KR Q + S      LD FE K ++ H K R+ FL +A 
Sbjct: 121 VGEKKFLPDLTCLLDIPVDTGIKRKQQQKS------LDKFEDKPLVYHNKIREGFLSLAE 174

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWEL 211
             P+   I+D     ++    ++    EL
Sbjct: 175 ANPENYLILDGRQPLEASLNKVMTAYTEL 203


>gi|161831009|ref|YP_001596429.1| thymidylate kinase [Coxiella burnetii RSA 331]
 gi|164686003|ref|ZP_01946518.2| thymidylate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|165919105|ref|ZP_02219191.1| thymidylate kinase [Coxiella burnetii RSA 334]
 gi|161762876|gb|ABX78518.1| thymidylate kinase [Coxiella burnetii RSA 331]
 gi|164601531|gb|EAX32890.2| thymidylate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|165917174|gb|EDR35778.1| thymidylate kinase [Coxiella burnetii RSA 334]
          Length = 223

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 118/220 (53%), Gaps = 8/220 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGIEG GKTT ++ ++  L        VTREPGGTP AEA R VLLS   +   
Sbjct: 6   GRFISFEGIEGVGKTTALNWVREQLDAARIPYVVTREPGGTPIAEAIRDVLLSHSDEMMC 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  A R  ++ +V+ PAL  G+ +L DRF D+S+AYQG         ++ L   
Sbjct: 66  PDTELLLMFAGRAQNIAHVVLPALRRGQWVLSDRFTDASFAYQGGGRGIPVKHIEELAGW 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  + PD T++LD PV +GL RV++R         D  E + +   ++ R+ +L +A  
Sbjct: 126 VLGNLKPDLTLLLDAPVSVGLCRVKSR------GAKDRIEAEGLEFFKRVRECYLALANQ 179

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           +P R  ++ +     +V   I+  +  L+    SPL  +K
Sbjct: 180 EPARFRVIHTDQDLSNVKNQIMKAIKPLLT--ASPLPGEK 217


>gi|154706615|ref|YP_001424915.1| thymidylate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|154355901|gb|ABS77363.1| thymidylate kinase [Coxiella burnetii Dugway 5J108-111]
          Length = 223

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 118/220 (53%), Gaps = 8/220 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGIEG GKTT ++ ++  L        VTREPGGTP AEA R VLLS   +   
Sbjct: 6   GRFISFEGIEGVGKTTALNWVREQLDATRIPYVVTREPGGTPIAEAIRDVLLSHSDEMMC 65

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  A R  ++ +V+ PAL  G+ +L DRF D+S+AYQG         ++ L   
Sbjct: 66  PDTELLLMFAGRAQNIAHVVLPALRRGQWVLSDRFTDASFAYQGGGRGIPVKHIEELAGW 125

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  + PD T++LD PV +GL RV++R         D  E + +   ++ R+ +L +A  
Sbjct: 126 VLGNLKPDLTLLLDAPVSVGLCRVKSR------GAKDRIEAEGLEFFKRVRECYLALANQ 179

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           +P R  ++ +     +V   I+  +  L+    SPL  +K
Sbjct: 180 EPARFRVIHTDQDLSNVKNQIMKAIKPLLT--ASPLPGEK 217


>gi|309390261|gb|ADO78141.1| thymidylate kinase [Halanaerobium praevalens DSM 2228]
          Length = 208

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 120/208 (57%), Gaps = 5/208 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEGIEG+GKTT I+ L  +L++  +DV ++REPGGT   +  R +LL    D
Sbjct: 1   MAEGFFITFEGIEGSGKTTQINRLADYLRKNEHDVLISREPGGTELGQKIRKILLDPHFD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               + E +++AA R  HV+  I+PAL  GKI++ DRF+DS+ AYQ       +  +  +
Sbjct: 61  TMDYKTEILLYAADRAQHVKEKIKPALKAGKIVISDRFVDSNLAYQAAGRGLDYEQVYQI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
               +    PD T ILD+ +  GL+R + + S  ++   D  ER+    H++ R+ +L++
Sbjct: 121 NNWVIGSTWPDLTFILDIDIKKGLERAR-KLSFDQAG--DRLEREVDDFHQRVREAYLEM 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A    +R  ++++A S   +  +I NI+
Sbjct: 178 A--VAERFCLINAARSIVEIEKDIKNII 203


>gi|42560606|ref|NP_975057.1| thymidylate kinase [Mycoplasma mycoides subsp. mycoides SC str.
           PG1]
 gi|59798304|sp|Q6MUI5|KTHY_MYCMS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|42492102|emb|CAE76699.1| THYMIDYLATE KINASE [Mycoplasma mycoides subsp. mycoides SC str.
           PG1]
 gi|301320609|gb|ADK69252.1| dTMP kinase [Mycoplasma mycoides subsp. mycoides SC str.
           Gladysdale]
          Length = 213

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 121/216 (56%), Gaps = 7/216 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG++G+GKTT +  +K  L+R NY V +TREPGG   AE  R ++L     +  A
Sbjct: 1   MFITFEGMDGSGKTTTLLKVKEELERLNYQVLITREPGGEAIAEQIRQIILDNKNRDMDA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++F A+R  H++ VI+PAL +  I++ DRF+DS+ AYQG   +     ++ +Q+I 
Sbjct: 61  WTEALLFIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQGSARNIGVDVVNQVQQIV 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           ++  +PD T+  D+      KR+Q    +R     +  + +     +K  Q +L++ +N 
Sbjct: 121 LKNCLPDLTLFFDVSFSEAEKRMQ----IRGENSKNRLDEEKSDFKQKVYQGYLELVKNN 176

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV---QKRVS 217
           P R  ++D+      V    + I+ E +   +KR S
Sbjct: 177 PKRIKVIDANQDIDQVYNQAIKIILEKLKENEKRTS 212


>gi|254468768|ref|ZP_05082174.1| thymidylate kinase [beta proteobacterium KB13]
 gi|207087578|gb|EDZ64861.1| thymidylate kinase [beta proteobacterium KB13]
          Length = 201

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 114/208 (54%), Gaps = 10/208 (4%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ EGI+GAGK+TH+  ++ +L +KN    +TREPGGT   E  R +LL    D+    
Sbjct: 4   FITVEGIDGAGKSTHLEFIQSYLNKKNIQNKLTREPGGTEIGEKLRQLLLH---DDMDVG 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR +H+  VI+PAL     ++CDRF D+SYAYQ         F+ SL+E+  
Sbjct: 61  TETMMMFAARHEHLITVIQPALQSNISIICDRFTDASYAYQQGGKGIDKSFVKSLEELVH 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T + DL  D    R+ N  +      LD FE++        R+++L++A+   
Sbjct: 121 PNLTPDLTFLFDLDPDTAHSRISNERN------LDKFEKQSSTFFNGVRKVYLELAKAHS 174

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQ 213
            R H++DS+ +   +   I   + ELV+
Sbjct: 175 -RFHVIDSSQTIDQIQQVISKKLDELVK 201


>gi|311896975|dbj|BAJ29383.1| putative thymidylate kinase [Kitasatospora setae KM-6054]
          Length = 1055

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 112/201 (55%), Gaps = 8/201 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG +GAGK+T    L  +++ K ++V +TREPGG+P  +  R ++L  G     
Sbjct: 516 GYFIALEGGDGAGKSTQAQALAEWIRAKGHEVVLTREPGGSPIGQRLRALVLDVGNTGLS 575

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA+++AA R +HVENVIRPAL  G ++L DR++DSS AYQG         +  +   
Sbjct: 576 HRAEALIYAADRAEHVENVIRPALERGAVVLTDRYMDSSIAYQGAGRDLAATEVARISRW 635

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD T++LD  VD    R  +R+    +  LD  E +    H++ R  FL +A  
Sbjct: 636 ATGGLVPDLTVVLD--VDPTAAR--DRF----TEALDRLESEPTEFHQRVRSGFLALAAA 687

Query: 184 QPDRCHIVDSAHSFQSVATNI 204
            P R  +VD   S  +V T I
Sbjct: 688 DPARYLVVDGTQSAAAVTTAI 708


>gi|293605096|ref|ZP_06687488.1| dTMP kinase [Achromobacter piechaudii ATCC 43553]
 gi|292816499|gb|EFF75588.1| dTMP kinase [Achromobacter piechaudii ATCC 43553]
          Length = 207

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 113/205 (55%), Gaps = 14/205 (6%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + G FI+ EG++GAGK+TH   +  FL+    +V  TREPGGTP  E  R ++L+   D+
Sbjct: 3   SRGRFITLEGVDGAGKSTHTDWIADFLRSNGREVVSTREPGGTPLGEKLRALVLT---DQ 59

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD--S 119
            G + E ++  AAR +HV  VI PAL  G  ++CDR+ D++YAYQG     + L  +  +
Sbjct: 60  MGLDTETLLMFAARCEHVRQVIEPALARGAWVVCDRYTDATYAYQG---GGRELGAERVA 116

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + E  +    PD T + D+P+++   R+ +    RE    D FER+     E+ R  +  
Sbjct: 117 VLERWMHAGQPDRTWLFDVPLEVARARLAD---AREP---DRFEREGAAFFERTRTAYHA 170

Query: 180 IARNQPDRCHIVDSAHSFQSVATNI 204
            A+  P R HI+DS  S   + T +
Sbjct: 171 RAKADPGRIHIIDSTQSIAQIRTEL 195


>gi|315037614|ref|YP_004031182.1| thymidylate kinase [Lactobacillus amylovorus GRL 1112]
 gi|325956093|ref|YP_004286703.1| thymidylate kinase [Lactobacillus acidophilus 30SC]
 gi|312275747|gb|ADQ58387.1| thymidylate kinase [Lactobacillus amylovorus GRL 1112]
 gi|325332658|gb|ADZ06566.1| thymidylate kinase [Lactobacillus acidophilus 30SC]
          Length = 212

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 117/212 (55%), Gaps = 11/212 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH----VTREPGGTPAAEAARHVLLSCG 58
           +G F+SFEG +GAGK+T   +LK  L +    +     VTREPGG+  AE  R ++L   
Sbjct: 2   TGYFVSFEGPDGAGKST---VLKEVLAKIGSQLKPQYLVTREPGGSKIAEKIRDIILDPA 58

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
            D+  A+ EA+++AAAR  HVE +I+PAL  GKI+  DRF+DSS AYQGE        + 
Sbjct: 59  NDKMDAKTEALLYAAARSQHVEEIIKPALEAGKIVFSDRFVDSSLAYQGEGRDLGIKEVK 118

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            + + +  ++ PD T  +D+  +IGL R+Q     +E    D  E++++  H+K  Q FL
Sbjct: 119 QINDFATNKLDPDLTFFIDVAPEIGLSRIQKLRPGQE----DRLEQENLSFHKKVYQGFL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
            +    P+R   +D       V   ++  + +
Sbjct: 175 KVRAMYPERFVTIDGTQPIDQVVDQVITTLKQ 206


>gi|253680847|ref|ZP_04861650.1| dTMP kinase [Clostridium botulinum D str. 1873]
 gi|253562696|gb|EES92142.1| dTMP kinase [Clostridium botulinum D str. 1873]
          Length = 210

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 119/209 (56%), Gaps = 10/209 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+FI+ EG EG+GKTT + +++ +L+  N D   TREPGG   +E  R ++L     
Sbjct: 1   MKKGVFITLEGPEGSGKTTIVKMIEGYLKENNIDYISTREPGGINISEQIREIILDRKNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
           E  A  EA+++ A+R  H+   + PAL  GKI++CDRF+DSS AYQG    ++ + +D  
Sbjct: 61  EMDARTEALLYVASRRQHLSERVIPALKSGKIVICDRFIDSSLAYQG---YARGIGIDEV 117

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+ E ++   MP+ T+ LD+  +IGLKR+      RE   LD  E+ D   H+K R+ +
Sbjct: 118 MSINEFAIDGYMPNLTLYLDIDPEIGLKRISEN-DKREVNRLD-LEKLD--FHKKVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILN 206
             + +  P+R   +++      V  ++ N
Sbjct: 174 FKVLKKFPNRIKKINANQPIDKVFEDVKN 202


>gi|326202926|ref|ZP_08192793.1| thymidylate kinase [Clostridium papyrosolvens DSM 2782]
 gi|325987003|gb|EGD47832.1| thymidylate kinase [Clostridium papyrosolvens DSM 2782]
          Length = 206

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 119/212 (56%), Gaps = 6/212 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG +G+GKTT I L++ FL+    DV ++REPGGT  +E  R+++L  G  
Sbjct: 1   MCKGLFITVEGTDGSGKTTQIKLMEEFLKAAGNDVVLSREPGGTEISETIRNLILDPGNK 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E +++AAAR  HV  VIRP+L  GK ++CDRF+DSSYAYQG         +  +
Sbjct: 61  DISPLTEMLLYAAARAQHVFQVIRPSLESGKCVICDRFVDSSYAYQGCGRGVDLKTVADV 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +V  V+PD T  L++   + ++R        +S   D  E++ +  H +  + +  +
Sbjct: 121 NRAAVDGVVPDITFFLNIDPRLAIER------RIKSTGADRIEQEKMDFHMRVYEGYRKM 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A   PDR   +D++ S + ++  I   + E++
Sbjct: 175 ALLYPDRIKSIDASKSIEEISLQIKTYLKEIL 206


>gi|309378939|emb|CBX22392.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 208

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 119/199 (59%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++ +K + +R+   V  TREPGGT   EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAAIKVWFERRGLPVLFTREPGGTALGEALREILLNPAT-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P ++ + R+     +RE    D FE+++    ++ RQ++L  A  QP
Sbjct: 124 GGLKPDLTLLLDVPPEVSMARIGQ---MREK---DRFEQEEAGFFKRVRQVYLQRAGRQP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++D + S ++V   I
Sbjct: 178 ERYAVIDGSRSPEAVGHQI 196


>gi|226941613|ref|YP_002796687.1| thymidylate kinase [Laribacter hongkongensis HLHK9]
 gi|226716540|gb|ACO75678.1| KthY [Laribacter hongkongensis HLHK9]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 114/197 (57%), Gaps = 7/197 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++ EGI+GAGK+TH+  ++ +L  +  ++ VTREPGGTP  E+ R +LL     +  
Sbjct: 8   GLFLTLEGIDGAGKSTHVGFVRDYLTARGINLVVTREPGGTPVGESLRSLLLDV-QSQVS 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VIRPAL  G  +L DRF D++YA+QG         + +L+  
Sbjct: 67  LDTETLLMFAARQAHLDAVIRPALARGDWVLSDRFTDATYAFQGGGRGVPFARIATLENW 126

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
             Q + PDCT + D+P+     R+Q    +R+   LD FE++    H + R  +L  A +
Sbjct: 127 VQQGLQPDCTFLFDVPLATAQARMQG---VRQ---LDRFEQEASDFHARVRDAYLRRAAD 180

Query: 184 QPDRCHIVDSAHSFQSV 200
           +P R  ++D+  S  ++
Sbjct: 181 EPQRFCLLDARQSIGAL 197


>gi|308388855|gb|ADO31175.1| putative thymidylate kinase [Neisseria meningitidis alpha710]
 gi|325129800|gb|EGC52608.1| thymidylate kinase [Neisseria meningitidis OX99.30304]
 gi|325135738|gb|EGC58350.1| thymidylate kinase [Neisseria meningitidis M0579]
 gi|325197890|gb|ADY93346.1| thymidylate kinase [Neisseria meningitidis G2136]
 gi|325202534|gb|ADY97988.1| thymidylate kinase [Neisseria meningitidis M01-240149]
 gi|325207716|gb|ADZ03168.1| thymidylate kinase [Neisseria meningitidis NZ-05/33]
          Length = 206

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+       +S   D FE++      + R ++L+ A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIG------QSREKDRFEQEQADFFMRVRSVYLNRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  I+DS  S   V  NI  ++
Sbjct: 178 ERYAIIDSNRSLDEVRNNIEKVL 200


>gi|258542239|ref|YP_003187672.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633317|dbj|BAH99292.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636376|dbj|BAI02345.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639429|dbj|BAI05391.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642485|dbj|BAI08440.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645540|dbj|BAI11488.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648593|dbj|BAI14534.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651646|dbj|BAI17580.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654637|dbj|BAI20564.1| thymidylate kinase [Acetobacter pasteurianus IFO 3283-12]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 113/209 (54%), Gaps = 9/209 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+FI+ EG EG GK+T + LLK  L+ +   V  TREPGG+  AE  R +LL  G +
Sbjct: 1   MACGMFITLEGAEGVGKSTQLRLLKENLEAQGQKVLTTREPGGSAGAEDLRQLLL-FGKN 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDS 119
              A AE +   AAR DHV+ VI PAL  G+I+LCDRF DS+ AYQG  R +     L  
Sbjct: 60  PLSARAEILTHFAARYDHVDQVILPALKAGQIVLCDRFTDSTMAYQGYGRANGDPAILSL 119

Query: 120 LQEISVQ-EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           ++ +  Q  + PD T +L  P  I  +R+  R      A  D +E+ D   H +    F 
Sbjct: 120 IETLQKQLGLQPDVTFLLQAPRAISRQRLAAR-----GAPTDRYEQADEDFHARLADGFA 174

Query: 179 DIARNQPDRCHIVD-SAHSFQSVATNILN 206
            IA+ +P R  +VD S +S + V   IL 
Sbjct: 175 HIAKAEPQRVVVVDTSVYSAEQVNAQILK 203


>gi|46576522|sp|Q83E35|KTHY_COXBU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
          Length = 227

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 118/220 (53%), Gaps = 8/220 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGIEG GKTT ++ ++  L        VTREPGGTP AEA R VLLS   +   
Sbjct: 10  GRFISFEGIEGVGKTTALNWVREQLDAARIPYVVTREPGGTPIAEAIRDVLLSHSDEMMC 69

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  A R  ++ +V+ PAL  G+ +L DRF D+S+AYQG         ++ L   
Sbjct: 70  PDTELLLMFAGRAQNIAHVVLPALRRGQWVLSDRFTDASFAYQGGGRGIPVKHIEELAGW 129

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +  + PD T++LD PV +GL RV++R         D  E + +   ++ R+ +L +A  
Sbjct: 130 VLGNLKPDLTLLLDAPVSVGLCRVKSR------GAKDRIEAEGLEFFKRVRECYLALANQ 183

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
           +P R  ++ +     +V   I+  +  L+    SPL  +K
Sbjct: 184 EPARFRVIHTDQDLSNVKNQIMKAIKPLLT--ASPLPGEK 221


>gi|255327688|ref|ZP_05368754.1| dTMP kinase [Rothia mucilaginosa ATCC 25296]
 gi|255295362|gb|EET74713.1| dTMP kinase [Rothia mucilaginosa ATCC 25296]
          Length = 238

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 116/223 (52%), Gaps = 9/223 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI  EG +GAGKTT ++LL   L+ + Y V  TREPGGT   E  R ++L  G     
Sbjct: 22  GLFIVVEGGDGAGKTTQLALLDEALRGRGYRVITTREPGGTEIGEKLRALVLEAGQGTID 81

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQE 122
              EA++FAA+R  H   +IRPAL EG I+L DR++DSS AYQG  RD      +D L  
Sbjct: 82  DRTEALIFAASRAAHASQLIRPALAEGAIVLSDRYIDSSAAYQGVGRDLGVETIVD-LSR 140

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++PD T++L +P+    +R+  R        +D  E +      +    F  IAR
Sbjct: 141 WATANLVPDATLLLSVPLSAEQERMDQR------GTVDRIEAEGTAFKARIHGAFEQIAR 194

Query: 183 NQPDRCH-IVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKD 224
              +  H I+D   + + V   +L ++  L+  R    + K+D
Sbjct: 195 EDANGSHRIIDGVGTIEQVHARVLEVIEPLLALRELVRTGKED 237


>gi|319779570|ref|YP_004130483.1| Thymidylate kinase [Taylorella equigenitalis MCE9]
 gi|317109594|gb|ADU92340.1| Thymidylate kinase [Taylorella equigenitalis MCE9]
          Length = 204

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 116/198 (58%), Gaps = 11/198 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EGI+GAGK++HI  +  F +    +V VTREPGG   +EA R +LL+  ++   
Sbjct: 3   GYFITLEGIDGAGKSSHIEYIVDFFESLGREVVVTREPGGNALSEALRGILLTQPMNSL- 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGE-RDSSQHLFLDSLQE 122
              E ++  A+R + V  +I PAL EGKI++ DRF DS+ AYQG  RD S  + ++ L+ 
Sbjct: 62  --TEVLLMFASRSESVYGIILPALREGKIVISDRFTDSTLAYQGGGRDFSIDV-INDLKN 118

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I   ++ PD T++ D+P+++   R+ N  S+      D FE  D     + R  +L +A 
Sbjct: 119 IVHPDLTPDLTLLFDVPLEVARDRLSNGRSV------DKFEVLDEDFFNRVRNQYLSMAN 172

Query: 183 NQPDRCHIVDSAHSFQSV 200
            +PDR  I+DS+HS   V
Sbjct: 173 YEPDRIKIIDSSHSVTVV 190


>gi|84516820|ref|ZP_01004178.1| thymidylate kinase [Loktanella vestfoldensis SKA53]
 gi|84509288|gb|EAQ05747.1| thymidylate kinase [Loktanella vestfoldensis SKA53]
          Length = 202

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 6/204 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M    FI+FEGI+G+GK+T    L ++L  + +DV +TREPGG+  AE  R +LL+   D
Sbjct: 1   MTRPRFITFEGIDGSGKSTQARRLAQWLGDQGHDVILTREPGGSQGAEEIRQLLLTGDTD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + AE E ++F AAR DH+E  I PAL  GK ++ DRF DS+  YQG         +D+L
Sbjct: 61  RWSAETEILLFTAARRDHLEKTILPALAAGKTVVSDRFADSTRVYQGATRGDLRAKVDAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             + +    PD T ++D+     L+R   R S       D FE   +   E  R  FL +
Sbjct: 121 HALMIGR-EPDLTFVIDMDPATALERGLARRS-----GEDRFEDFGLPFQETLRHGFLAL 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           AR +  RC ++D   +   +A+++
Sbjct: 175 ARAEAQRCVLIDGNRTPDQIASDV 198


>gi|152980260|ref|YP_001353676.1| thymidylate kinase [Janthinobacterium sp. Marseille]
 gi|166221747|sp|A6SZH9|KTHY_JANMA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|151280337|gb|ABR88747.1| thymidylate kinase (dTMP kinase) [Janthinobacterium sp. Marseille]
          Length = 204

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 112/208 (53%), Gaps = 9/208 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FI+FEGI+GAGK+TH+S +   L  +   V VTREPGGT   E  R +LL    +
Sbjct: 1   MTTGKFITFEGIDGAGKSTHLSFVAELLCERKKTVVVTREPGGTSLGEELREILLH---E 57

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +   E EA++  AAR +H+  VI PAL  G  ++ DRF D+++AYQG         L++L
Sbjct: 58  KMHLETEALLMFAARREHIAQVIAPALERGDWVISDRFTDATFAYQGGGRKLDRAKLNAL 117

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++     + P  T++ D+P+D+       R  L  +  LD FE++        R  +L  
Sbjct: 118 EQWVHPHLQPHLTLLFDVPLDVA------RARLDATRTLDKFEQEKAEFFAATRAEYLRR 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P R H++DS  S  ++   +  IV
Sbjct: 172 AAEFPQRFHVIDSTRSIAAIQEQLRAIV 199


>gi|260551489|ref|ZP_05825673.1| thymidylate kinase [Acinetobacter sp. RUH2624]
 gi|260405483|gb|EEW98976.1| thymidylate kinase [Acinetobacter sp. RUH2624]
          Length = 199

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 116/207 (56%), Gaps = 12/207 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  + +   V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALASNKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           +++P+R   +D+  S + V    L  +
Sbjct: 172 KSEPERIKRLDATQSPEQVFEQALQYL 198


>gi|327182908|gb|AEA31355.1| thymidylate kinase [Lactobacillus amylovorus GRL 1118]
          Length = 212

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 114/207 (55%), Gaps = 11/207 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH----VTREPGGTPAAEAARHVLLSCG 58
           +G F+SFEG +GAGK+T   +LK  L +    +     VTREPGG+  AE  R ++L   
Sbjct: 2   TGYFVSFEGPDGAGKST---VLKEVLAKIGSQLKPQYLVTREPGGSKIAEKIRDIILDPA 58

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
            D+  A+ EA+++AAAR  HVE +I+PAL  GKI+  DRF+DSS AYQGE        + 
Sbjct: 59  NDKMDAKTEALLYAAARSQHVEEIIKPALTAGKIVFSDRFVDSSLAYQGEGRDLGIKEVK 118

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            + + +  ++ PD T  +D+  +IGL R+Q     +E    D  E++++  H K  Q FL
Sbjct: 119 QINDFATNKLDPDLTFFIDVAPEIGLSRIQKLRPGQE----DRLEQENLSFHTKVYQGFL 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNIL 205
            +    P+R   +D       V   ++
Sbjct: 175 KVRAMYPERFVTIDGTQPIDQVVDQVI 201


>gi|262047567|ref|ZP_06020522.1| thymidylate kinase [Lactobacillus crispatus MV-3A-US]
 gi|293379956|ref|ZP_06626057.1| thymidylate kinase [Lactobacillus crispatus 214-1]
 gi|312977918|ref|ZP_07789664.1| dTMP kinase [Lactobacillus crispatus CTV-05]
 gi|260572143|gb|EEX28708.1| thymidylate kinase [Lactobacillus crispatus MV-3A-US]
 gi|290923469|gb|EFE00371.1| thymidylate kinase [Lactobacillus crispatus 214-1]
 gi|310895225|gb|EFQ44293.1| dTMP kinase [Lactobacillus crispatus CTV-05]
          Length = 212

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 123/214 (57%), Gaps = 17/214 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH----VTREPGGTPAAEAARHVLLSCGV 59
           G F+SFEG +GAGK+T   +LK  L +   ++     VTREPGG+  AE  R ++L    
Sbjct: 3   GYFVSFEGPDGAGKST---VLKEVLNQIGSELETQYLVTREPGGSKIAEKIRDIILDPAN 59

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           D+   + EA+++AA+R  HVE +IRPAL EGK++  DR++DSS AYQG   + + L +  
Sbjct: 60  DKMDNKTEALLYAASRSQHVEEIIRPALKEGKVVFSDRYVDSSLAYQG---AGRDLGIQE 116

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +++I   +  ++ PD T  LDL  ++GLKR++     +E    D  E++++  H+K    
Sbjct: 117 VKQINDFATDKLDPDLTFFLDLAPEVGLKRIEKLRPGQE----DRLEQENLAFHKKVYAG 172

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           FL +    P+R   VD+      V   ++ I+ +
Sbjct: 173 FLKVKEMYPERFVTVDATQPIDQVVAQVIAILKQ 206


>gi|282889968|ref|ZP_06298503.1| hypothetical protein pah_c008o058 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500161|gb|EFB42445.1| hypothetical protein pah_c008o058 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 222

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 114/198 (57%), Gaps = 12/198 (6%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-EFGA 64
           FI+FEG EGAGKTT I  ++  L++  YDV  TREPGG+      R  LL          
Sbjct: 12  FITFEGGEGAGKTTLIQQVEADLKQLGYDVVSTREPGGSSLGNTIRQWLLQQNTKTSISI 71

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           +AE ++F AAR  H+E +I P+L +GKI+LCDRF DS+ AYQG    ++ L L+++Q + 
Sbjct: 72  KAELLLFLAARAQHIEELILPSLTKGKIVLCDRFNDSTIAYQG---VARGLGLEAVQNLC 128

Query: 125 ---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESA---CLDYFERKDVMIHEKRRQIFL 178
                 V+PD TI LD+   +GL R   R++ +E A    +D  E + +  HE  RQ F 
Sbjct: 129 KFVCGNVVPDLTIYLDIDPHVGLTR--TRHAAKEDAPMGSIDRIESEKLEFHEHVRQGFF 186

Query: 179 DIARNQPDRCHIVDSAHS 196
            +    P R H++D++ S
Sbjct: 187 KLIHQNPSRYHVIDASMS 204


>gi|227877632|ref|ZP_03995685.1| thymidylate kinase [Lactobacillus crispatus JV-V01]
 gi|256849085|ref|ZP_05554518.1| thymidylate kinase [Lactobacillus crispatus MV-1A-US]
 gi|227862780|gb|EEJ70246.1| thymidylate kinase [Lactobacillus crispatus JV-V01]
 gi|256713861|gb|EEU28849.1| thymidylate kinase [Lactobacillus crispatus MV-1A-US]
          Length = 216

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 122/212 (57%), Gaps = 17/212 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH----VTREPGGTPAAEAARHVLLSCGV 59
           G F+SFEG +GAGK+T   +LK  L +   ++     VTREPGG+  AE  R ++L    
Sbjct: 7   GYFVSFEGPDGAGKST---VLKEVLNQIGSELETQYLVTREPGGSKIAEKIRDIILDPAN 63

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           D+   + EA+++AA+R  HVE +IRPAL EGK++  DR++DSS AYQG   + + L +  
Sbjct: 64  DKMDNKTEALLYAASRSQHVEEIIRPALKEGKVVFSDRYVDSSLAYQG---AGRDLGIQE 120

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +++I   +  ++ PD T  LDL  ++GLKR++     +E    D  E++++  H+K    
Sbjct: 121 VKQINDFATDKLDPDLTFFLDLAPEVGLKRIEKLRPGQE----DRLEQENLAFHKKVYAG 176

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           FL +    P+R   VD+      V   ++ I+
Sbjct: 177 FLKVKEMYPERFVTVDATQPIDQVVAQVIAIL 208


>gi|210630412|ref|ZP_03296447.1| hypothetical protein COLSTE_00331 [Collinsella stercoris DSM 13279]
 gi|210160494|gb|EEA91465.1| hypothetical protein COLSTE_00331 [Collinsella stercoris DSM 13279]
          Length = 225

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 109/206 (52%), Gaps = 6/206 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EGI+G GK+T  +L++  L    YDV   REPGG   +E  R VLL    D
Sbjct: 1   MTKGHFITVEGIDGVGKSTQAALMEVLLDSAGYDVLRLREPGGVSISEQIRAVLLDPAND 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E G   E +++ AAR   V  VIRPAL  GK ++CDRF DS+ AYQ   D      +   
Sbjct: 61  EMGDMCELLLYEAARAQLVHQVIRPALTAGKTVICDRFYDSTTAYQSFADGLDRDMVFQA 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E++V    PD T++ DLPV+   +R  +R      +  D  E K     ++  + F  +
Sbjct: 121 NELAVDGCRPDLTLVFDLPVEDAHRRRSDR------SAEDRLELKGRDFQQRVSEGFRAV 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILN 206
           A ++PDR  +VD+  S   V + +++
Sbjct: 175 AADEPDRVRLVDAGGSIAEVFSIVVD 200


>gi|294787169|ref|ZP_06752422.1| dTMP kinase [Parascardovia denticolens F0305]
 gi|315227293|ref|ZP_07869080.1| thymidylate kinase [Parascardovia denticolens DSM 10105]
 gi|294484525|gb|EFG32160.1| dTMP kinase [Parascardovia denticolens F0305]
 gi|315119743|gb|EFT82876.1| thymidylate kinase [Parascardovia denticolens DSM 10105]
          Length = 226

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 115/218 (52%), Gaps = 10/218 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEG++G GK+T +  L+ +L  +   V VTREPGGTP  E  R +LL  G DE  
Sbjct: 3   GFFISFEGVDGVGKSTQVKRLEAYLLEQGRSVLVTREPGGTPLGERIRQILLH-GEDE-A 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA+++AA+R  HV   IRPAL  G +++ DR++DSS AYQ          +  L   
Sbjct: 61  PRTEALLYAASRAQHVAQKIRPALDSGALVISDRYIDSSLAYQAGGRELTLADVRRLNSW 120

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +  ++ PD T +LD+      +R+Q      ES+   +F+R         RQ FL +A  
Sbjct: 121 ATGDLWPDRTYLLDMSFQQSRQRLQGEPDRLESSGGAFFDRA--------RQAFLALAEG 172

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSS 221
           +PDR  ++D++     V   I      L+    SPL+S
Sbjct: 173 EPDRFRVIDASQPIDQVWQAIKTDADGLLAGLPSPLAS 210


>gi|300362307|ref|ZP_07058483.1| thymidylate kinase [Lactobacillus gasseri JV-V03]
 gi|300353298|gb|EFJ69170.1| thymidylate kinase [Lactobacillus gasseri JV-V03]
          Length = 213

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ L+K+  +       +TREPGG+  +E  R ++L     E 
Sbjct: 3   GYLITFEGPDGAGKTTVINELIKQLPKEIQKKTIITREPGGSKISENIRTIILDPANKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GKI+L DRF+DSS AYQG     + L ++++++
Sbjct: 63  DDRTEALLYAAQRSQHVSEVIRPALAAGKIVLSDRFIDSSLAYQG---VGRDLGVEAVKQ 119

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + PD TI LDL    GL R++   + +E    D  E++ +  H+K    ++D
Sbjct: 120 INDFGTGGLEPDLTIFLDLDPATGLARIEKERAGQE----DRLEQEKLAFHKKVYAGYID 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +  PDR   VD+    + VA N + I+
Sbjct: 176 LLKRYPDRIKKVDANLPIEEVAANSVKII 204


>gi|119478164|ref|ZP_01618220.1| thymidylate kinase [marine gamma proteobacterium HTCC2143]
 gi|119448673|gb|EAW29917.1| thymidylate kinase [marine gamma proteobacterium HTCC2143]
          Length = 211

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 109/207 (52%), Gaps = 6/207 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG EG GK+T+I+ +   L   N    VTREPGGTP AE  R +LLS   +    
Sbjct: 1   MFITIEGGEGVGKSTNIAYIADQLSDANITCIVTREPGGTPLAEDIRQLLLSDRDEAIAD 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E ++  A+R  H+  VI PAL  G  ++CDRF D++YAYQG         + +L++  
Sbjct: 61  NTELLLMFASRAQHIAGVIEPALARGDWVICDRFTDATYAYQGGGRGLSEAKIANLEQWV 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            +++ PD TI+ D P+ +G+ R   R        LD  ER+     E  R  +L +A   
Sbjct: 121 QEDLRPDITILFDAPITVGMSRAGQRGE------LDRIERERAAFFENVRNCYLMLAERH 174

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWEL 211
            DR   VD++ +   V  ++  I+ E+
Sbjct: 175 SDRFRTVDASETLGRVQASLQPIIAEM 201


>gi|299769149|ref|YP_003731175.1| thymidylate kinase [Acinetobacter sp. DR1]
 gi|298699237|gb|ADI89802.1| thymidylate kinase [Acinetobacter sp. DR1]
          Length = 199

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 112/195 (57%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + ++ + +   V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQYFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    + + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQC---TGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRIDATQS 186


>gi|262278188|ref|ZP_06055973.1| thymidylate kinase [Acinetobacter calcoaceticus RUH2202]
 gi|262258539|gb|EEY77272.1| thymidylate kinase [Acinetobacter calcoaceticus RUH2202]
          Length = 199

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 112/195 (57%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + ++ + +   V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQYFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRLDATRS 186


>gi|227496773|ref|ZP_03927046.1| thymidylate kinase [Actinomyces urogenitalis DSM 15434]
 gi|226833726|gb|EEH66109.1| thymidylate kinase [Actinomyces urogenitalis DSM 15434]
          Length = 265

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 111/215 (51%), Gaps = 8/215 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLF+SFEG +G GKTT I  L   L+    D  VTREPGGT      R +LL  G  E
Sbjct: 17  GPGLFLSFEGGDGVGKTTQIHRLSGLLEAAGVDCLVTREPGGTELGAEIRRLLLHGG--E 74

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A AEA+++AA R  HV+  +RPAL  G +++ DR+LDSS AYQG   S     +  L 
Sbjct: 75  VSARAEALLYAADRAHHVQTRVRPALARGGVVITDRYLDSSVAYQGAARSLGSQEVRDLS 134

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             + Q ++PD TI+LD    I            E A LD  ER+    H   R+ FL +A
Sbjct: 135 LWATQGLLPDLTILLDAEPGI------AARRAGERAALDRLEREPSSFHVALREEFLALA 188

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             +P R  ++D+    + VA  +   V  L++ R 
Sbjct: 189 AAEPGRFVVIDADRGVEEVAEQVTAAVVRLIRSRT 223


>gi|288554635|ref|YP_003426570.1| thymidylate kinase [Bacillus pseudofirmus OF4]
 gi|288545795|gb|ADC49678.1| thymidylate kinase [Bacillus pseudofirmus OF4]
          Length = 213

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 124/215 (57%), Gaps = 6/215 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +GLFI+ EG EGAGKTT +  +++ L+ +N  V  TREPGG   AE  R V+L     
Sbjct: 1   MKTGLFITVEGGEGAGKTTIVDKIEQDLRARNISVVRTREPGGIRIAERIREVILDVDHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E  A  EA+++AAAR  H+   + PAL EG +++CDRF+DSS AYQG         + ++
Sbjct: 61  EMDARTEALLYAAARRQHLIEKVLPALEEGNVVICDRFIDSSLAYQGHARGIGFNDVLAI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVM-IHEKRRQIFLD 179
            E +++   PD T+  ++  ++GL R++ R   RE   LD    ++V   HEK ++ +  
Sbjct: 121 NEFAIEGNYPDLTLFFNIEPEVGLARIK-RSGTREVNRLD----QEVFDFHEKVKEGYEK 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +    PDR  ++++     +V ++ + ++ + ++K
Sbjct: 176 VIAQYPDRMAVINADQEVDAVFSDAMAVINDFLKK 210


>gi|147676397|ref|YP_001210612.1| thymidylate kinase [Pelotomaculum thermopropionicum SI]
 gi|189030835|sp|A5D690|KTHY_PELTS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|146272494|dbj|BAF58243.1| thymidylate kinase [Pelotomaculum thermopropionicum SI]
          Length = 216

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 110/209 (52%), Gaps = 5/209 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI FEG++G+GKTT I LL   L+     V  TREPGGT   E  R +LL+    E  
Sbjct: 3   GKFIVFEGVDGSGKTTQIKLLGEKLESMGCPVVYTREPGGTRVGERIREILLNPLYGELV 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA+++AAAR  HV  VI PAL EGK++LCDRF DSS AYQG         L+ +   
Sbjct: 63  PWAEALLYAAARAQHVAQVILPALREGKVVLCDRFTDSSLAYQGYGRGVDIEMLEQVNRP 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   V+PD  ++LD       +  Q     R     D  ER+    + + R  +L +A  
Sbjct: 123 AAAGVVPDLVLVLDFD-----REGQTERMARSGRSADRIEREAQEFYRRVRSGYLALAAR 177

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            P R  ++D++ + + V  ++L    E++
Sbjct: 178 APRRYRVIDASRAEKLVHLDVLKAAEEVL 206


>gi|319654969|ref|ZP_08009043.1| thymidylate kinase [Bacillus sp. 2_A_57_CT2]
 gi|317393394|gb|EFV74158.1| thymidylate kinase [Bacillus sp. 2_A_57_CT2]
          Length = 208

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 118/203 (58%), Gaps = 10/203 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EGAGKTT I +L   L ++ Y V  TREPGG   AE  R V+L     
Sbjct: 1   MKKGKFITVEGPEGAGKTTIIDMLASNLAKEGYQVLQTREPGGIEIAEQIRSVILDKNNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
           +     EA+++AAAR  H+   ++PA+ +G I+LCDRF+DSS AYQG    ++ L +D  
Sbjct: 61  KMDPRTEALLYAAARRQHLAEKVKPAMDKGYIILCDRFIDSSLAYQG---YARGLGIDEV 117

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+   +++ +MP+ T+  D+  + GL R+ N++  RE   LD  E+ D   H K R+ +
Sbjct: 118 YSINSFAIEGMMPELTLYFDIEPEAGLDRI-NQHKGREVNRLD-LEKLD--FHHKVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSV 200
           L +    P+R   +D++ + + V
Sbjct: 174 LKLMELYPERIFKIDASGTLEEV 196


>gi|320451196|ref|YP_004203292.1| thymidylate kinase [Thermus scotoductus SA-01]
 gi|320151365|gb|ADW22743.1| thymidylate kinase [Thermus scotoductus SA-01]
          Length = 199

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 113/205 (55%), Gaps = 19/205 (9%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G F++ EG++G+GKTT   LL +FL+ K   V +TREPGG       R +LL    +  
Sbjct: 2   KGFFLTLEGLDGSGKTTQARLLAQFLEEKGIKVRLTREPGG--GLPGVRDLLLKG--EAL 57

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             EAE ++F+A R +HV  VI PAL EG  ++ DR+LDSS AYQG     Q L L  L+E
Sbjct: 58  SPEAEYLLFSADRAEHVRKVILPALEEGFWVISDRYLDSSLAYQG---YGQGLPLPWLKE 114

Query: 123 ISVQEVM---PDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           ++ +  +   PD T +LDLP +  LKRV         +  D  ER  +   ++ RQ +L 
Sbjct: 115 VAKEATLGLKPDLTFLLDLPPEEALKRV---------SAPDRLERMGLPFFQRVRQGYLK 165

Query: 180 IARNQPDRCHIVDSAHSFQSVATNI 204
           +A  +P+R  ++D+    + V   I
Sbjct: 166 LAAAEPERFRVLDATRPVEEVQAAI 190


>gi|317123732|ref|YP_004097844.1| thymidylate kinase [Intrasporangium calvum DSM 43043]
 gi|315587820|gb|ADU47117.1| thymidylate kinase [Intrasporangium calvum DSM 43043]
          Length = 223

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 106/190 (55%), Gaps = 10/190 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LF+ FEG +GAGK+T + LL   L+R    V VTR+PGGTP     R ++L    D    
Sbjct: 22  LFVCFEGGDGAGKSTQVRLLAAALERAGRQVLVTRQPGGTPLGAQIRELVLHG--DHVSP 79

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AEA++FAA +  HV+ +IRPAL  G++++ DR+ DSS AYQG         +  LQ  +
Sbjct: 80  RAEALLFAADKAHHVDELIRPALAGGRVVITDRYTDSSIAYQGAGRDLGADEIRQLQHWA 139

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           V  + PD T++LD+  D+G  R    +   ES   D+        H   RQ FLD+A  +
Sbjct: 140 VGGLFPDLTVLLDVSPDVGRSRRGEVHDRLESEADDF--------HAAVRQGFLDLAARE 191

Query: 185 PDRCHIVDSA 194
           PDR  +VD+ 
Sbjct: 192 PDRYLVVDAG 201


>gi|310639487|ref|YP_003944245.1| thymidylate kinase [Paenibacillus polymyxa SC2]
 gi|309244437|gb|ADO54004.1| Thymidylate kinase [Paenibacillus polymyxa SC2]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 123/216 (56%), Gaps = 9/216 (4%)

Query: 1   MN-SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           MN  G+FI+ EG +G+GKTT I  L ++++ + + V  TREPGG   +E  R ++L    
Sbjct: 1   MNRKGIFITLEGGDGSGKTTMIQRLAKYMEEEGHPVVTTREPGGIEISEKIRSIILDPAH 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               A  EA+++AAAR  H+   ++PA+ +G I+LCDRF+DSS  YQG         + S
Sbjct: 61  TSMDARTEALLYAAARRQHLVEKVKPAIEQGAIVLCDRFVDSSLVYQGFARGIGIEEVAS 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +   +V +  PD T  LD+  ++GL R+    +      +D  + + +  H K R+ +L+
Sbjct: 121 INRFAVDDWEPDATFYLDIEPELGLARI----NASRGEEMDRLDMESISFHHKVREAYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           +AR  P+R  IVD++ + + V      ++ +L++KR
Sbjct: 177 LARKFPERITIVDASPAPEQVE----QVLKDLLKKR 208


>gi|288941602|ref|YP_003443842.1| thymidylate kinase [Allochromatium vinosum DSM 180]
 gi|288896974|gb|ADC62810.1| thymidylate kinase [Allochromatium vinosum DSM 180]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EGIEGAGK+T I+ L   L+ +  +V  TREPGG+  AE  R +LL        
Sbjct: 5   GRFITLEGIEGAGKSTQIAPLAELLRARGLNVLTTREPGGSALAERLRALLLDPDNQGMS 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR DH++  IRPAL  G  +LCDRF D++YAYQG         +  L+++
Sbjct: 65  ETTELLLMFAARADHLDRCIRPALAAGGWVLCDRFTDATYAYQGGGRGIDPARIALLEDL 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T++ DLP ++GL R ++R     +   D FE +     E  R ++L+ AR 
Sbjct: 125 VQGDLRPDLTLVFDLPPELGLGRAKSR-----AGQTDRFESETRRFFETARAVYLERARA 179

Query: 184 QPDRCHIVDSAHSFQSV 200
            P+R  ++D+  S ++V
Sbjct: 180 NPERYRVIDATASLEAV 196


>gi|296128436|ref|YP_003635686.1| thymidylate kinase [Cellulomonas flavigena DSM 20109]
 gi|296020251|gb|ADG73487.1| thymidylate kinase [Cellulomonas flavigena DSM 20109]
          Length = 224

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 122/220 (55%), Gaps = 24/220 (10%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G+F+SFEG +G GK+T ++LL   L     +V VTREPGGTP     R  +L    DE 
Sbjct: 15  AGVFVSFEGGDGVGKSTQVALLGHHLAALGREVVVTREPGGTPLGIELRRAVLHG--DEL 72

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV +++RPAL  G ++L DR+LDSS AYQG   S + L  D ++ 
Sbjct: 73  DPRTEALLYAADRAHHVASLVRPALARGAVVLTDRYLDSSVAYQG---SGRGLGADEVER 129

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +S   V E++P  T++LDL   +GL R+       ESA  ++        H + R+ FL 
Sbjct: 130 LSLWAVDELLPHLTVLLDLDPVVGLARLTGDPDRLESAGDEF--------HRRTREAFLA 181

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
            A   P R  ++D++   + VA          V++R++PL
Sbjct: 182 RAAADPARWLVLDASQPAEDVAAQ--------VRERLAPL 213


>gi|283458750|ref|YP_003363389.1| thymidylate kinase [Rothia mucilaginosa DY-18]
 gi|283134804|dbj|BAI65569.1| thymidylate kinase [Rothia mucilaginosa DY-18]
          Length = 239

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 111/214 (51%), Gaps = 9/214 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI  EG +GAGKTT ++LL   L  + Y V  TREPGGT   E  R ++L  G     
Sbjct: 23  GLFIVVEGGDGAGKTTQLALLNEALSARGYRVITTREPGGTEIGEKLRALVLEAGQGTID 82

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQE 122
              EA++FAA+R  H   +IRPAL EG I+L DR++DSS AYQG  RD      +D L  
Sbjct: 83  DRTEALIFAASRAAHASQLIRPALAEGAIVLSDRYIDSSAAYQGVGRDLGIETIVD-LSR 141

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +  +++PD T++L +P+    +R+  R        +D  E +      +    F  IAR
Sbjct: 142 WATADLVPDATLLLSVPLSAEQERMDQR------GTVDRIEAEGAAFKARIHGAFEQIAR 195

Query: 183 NQPDRCH-IVDSAHSFQSVATNILNIVWELVQKR 215
              +  H I+D   +   V   +L ++  L+  R
Sbjct: 196 EDANGSHRIIDGVGTIDEVHARVLEVIEPLLAAR 229


>gi|116333253|ref|YP_794780.1| thymidylate kinase [Lactobacillus brevis ATCC 367]
 gi|122270059|sp|Q03SS3|KTHY_LACBA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|116098600|gb|ABJ63749.1| thymidylate kinase [Lactobacillus brevis ATCC 367]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 116/212 (54%), Gaps = 4/212 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGVDE 61
           SG FISFEG +GAGKT+ +  +   ++    D + +TREPGG P +E+ R ++L      
Sbjct: 2   SGTFISFEGPDGAGKTSALQAITTQIKPVLGDQLVITREPGGNPISESIRAIILDRANTA 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   I PAL   K++LCDR++DSS AYQG         +  + 
Sbjct: 62  MDYRTEALLYAAARRQHLAQTILPALAADKLVLCDRYVDSSVAYQGAGRQIGEDAVAQMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +   ++P  T+  D+P +IGL+R+Q   + R+   +D  + +    H++ R  +L + 
Sbjct: 122 TFATDGLLPAVTVYFDVPAEIGLRRIQ---AHRDPQKVDRLDVEQAAFHDRVRAAYLRLQ 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
              PDR  ++D+    ++V T  L ++ +  Q
Sbjct: 179 AAHPDRIKLIDATQKREAVVTTALTLIKQAAQ 210


>gi|23009766|ref|ZP_00050693.1| COG0125: Thymidylate kinase [Magnetospirillum magnetotacticum MS-1]
          Length = 137

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG EGAGK+T I+ L   LQ    +V  TREPGGT  AEA R  LL      FG
Sbjct: 8   GVFITFEGGEGAGKSTQIARLATALQGSGREVVTTREPGGTERAEALRAALLRGVAKPFG 67

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA++FAAAR+DH+E +IRPAL  G ++LCDRF DS+ AYQG         + SL+ +
Sbjct: 68  PFAEALMFAAARIDHIETLIRPALARGAVVLCDRFADSTRAYQGAAGGLDPGLIASLERV 127

Query: 124 SVQEVMPDCT 133
           +++ + PD T
Sbjct: 128 TLEGLRPDLT 137


>gi|289577348|ref|YP_003475975.1| thymidylate kinase [Thermoanaerobacter italicus Ab9]
 gi|289527061|gb|ADD01413.1| thymidylate kinase [Thermoanaerobacter italicus Ab9]
          Length = 204

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 111/206 (53%), Gaps = 8/206 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G FISFEGI+G GKTT I  LK +L +K Y++ V REPGGT   E  R +LL    +  
Sbjct: 2   KGKFISFEGIDGCGKTTQIKFLKEYLLKKGYNILVLREPGGTNVGEKVRDILLDK-YNFI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               E +++A++R   VE  I PA+ EGKI+L DRF+DSSY YQG         +  + E
Sbjct: 61  SPVTEMLLYASSRAQLVEEKILPAIEEGKIVLLDRFVDSSYVYQGYARGLGIEKVKIVNE 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I+   ++PD TI +D+  +  +KR   R +       D  ER+    H+K R+ ++ + +
Sbjct: 121 IATMGILPDVTIYIDITPEEAMKRRGKREA-------DRLERESWDFHKKVREGYIKLVK 173

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
             P R   ++       V  +I++ V
Sbjct: 174 EYPKRFVFINGMQEIVKVHQDIIDAV 199


>gi|238853621|ref|ZP_04643990.1| dTMP kinase [Lactobacillus gasseri 202-4]
 gi|238833765|gb|EEQ26033.1| dTMP kinase [Lactobacillus gasseri 202-4]
          Length = 213

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 11/210 (5%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            G  I+FEG +GAGKTT I+ L+K+  +       +TREPGG+  +E  R ++L     E
Sbjct: 2   KGYLITFEGPDGAGKTTVINELIKQLPKEIQKKTIITREPGGSKISENIRTIILDPANKE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AA R  HV  VIRPAL  GKI+L DRF+DSS AYQG     + L ++ ++
Sbjct: 62  MDDRTEALLYAAQRSQHVSEVIRPALAAGKIVLSDRFIDSSLAYQG---VGRDLGVEEVK 118

Query: 122 EIS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +I+      + PD TI LDL    GL R++   + +E    D  E++ +  H+K    ++
Sbjct: 119 QINDFGTGGLEPDLTIFLDLDPATGLARIEKERAGQE----DRLEQEKLAFHKKVYAGYI 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           D+ +  PDR   VD+    + VA N + I+
Sbjct: 175 DLLKRYPDRIKKVDANLPIEEVAANSVKII 204


>gi|282852748|ref|ZP_06262090.1| dTMP kinase [Lactobacillus gasseri 224-1]
 gi|282556490|gb|EFB62110.1| dTMP kinase [Lactobacillus gasseri 224-1]
          Length = 213

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ L+K+  +       +TREPGG+  +E  R ++L     E 
Sbjct: 3   GYLITFEGPDGAGKTTVINELIKQLPKEIQEKTIITREPGGSKISENIRTIILDPANKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GKI+L DRF+DSS AYQG     ++L ++++++
Sbjct: 63  DDRTEALLYAAQRSQHVSEVIRPALEAGKIVLSDRFIDSSLAYQG---VGRNLGVEAVKQ 119

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + PD TI LDL    GL R++   + +E    D  E++ +  H+K    + D
Sbjct: 120 INDFGTGGLEPDLTIFLDLDPATGLARIEKERAGQE----DRLEQEKLAFHQKVYAGYTD 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +  PDR   VD+    + VA N + I+
Sbjct: 176 LLKRYPDRIKKVDANLPIKEVAANSVKII 204


>gi|154508479|ref|ZP_02044121.1| hypothetical protein ACTODO_00979 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798113|gb|EDN80533.1| hypothetical protein ACTODO_00979 [Actinomyces odontolyticus ATCC
           17982]
          Length = 270

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 116/207 (56%), Gaps = 9/207 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG +G+GK+T I  ++ + + +  +V VTREPGGT      R  L+  G ++  
Sbjct: 5   GVFITFEGGDGSGKSTQIQSVRDWFESRGREVIVTREPGGTELGTEIRR-LVQNGPEDVD 63

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++AA R  HV  VI PAL  G ++L DR++DSS AYQG   S     + SL   
Sbjct: 64  ARTEALLYAADRAYHVATVIAPALERGAVVLADRYIDSSLAYQGAARSLGVDEIGSLSAW 123

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + + + P  T +LDLP ++G +R  +          D  ER+ +  HE+ R  +L +A  
Sbjct: 124 ATRGLYPSLTFLLDLPPEVGARRRTD--------APDRMERESMDFHERVRHEYLRLADA 175

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWE 210
           +PDR  ++D+  +   V + I  ++ E
Sbjct: 176 EPDRIVVIDAVGTVDEVFSEIRGVLVE 202


>gi|256844526|ref|ZP_05550012.1| thymidylate kinase [Lactobacillus crispatus 125-2-CHN]
 gi|256613604|gb|EEU18807.1| thymidylate kinase [Lactobacillus crispatus 125-2-CHN]
          Length = 212

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 120/209 (57%), Gaps = 17/209 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH----VTREPGGTPAAEAARHVLLSCGV 59
           G F+SFEG +GAGK+T   +LK  L +   ++     VTREPGG+  AE  R ++L    
Sbjct: 3   GYFVSFEGPDGAGKST---VLKEVLNQIGSELETQYLVTREPGGSKIAEKIRDIILDPAN 59

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           D+   + EA+++AA+R  HVE +IRPAL EGK++  DR++DSS AYQG   + + L +  
Sbjct: 60  DKMDNKTEALLYAASRSQHVEEIIRPALKEGKVVFSDRYVDSSLAYQG---AGRDLGIQE 116

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +++I   +  ++ PD T  LDL  ++GLKR++     +E    D  E++++  H+K    
Sbjct: 117 VKQINDFATDKLDPDLTFFLDLDPEVGLKRIEKLRPGQE----DRLEQENLAFHKKVYAG 172

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNIL 205
           FL +    P+R   VD+      V   ++
Sbjct: 173 FLKVKETYPERFVTVDATQPIDQVVAQVI 201


>gi|218885132|ref|YP_002434453.1| dTMP kinase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226732655|sp|B8DN41|KTHY_DESVM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|218756086|gb|ACL06985.1| dTMP kinase [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 118/216 (54%), Gaps = 3/216 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG+EG+GK+T ++ +++ L    + V +TREPGG+      R +LL    D+   
Sbjct: 1   MFITFEGMEGSGKSTALNRVQQVLLDAGHGVLLTREPGGSRLGRTLRSILLDLSNDDIVP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           EAE  ++ A R  HV  VIRPAL EG ++L DR+ DS+  YQG         L  L +++
Sbjct: 61  EAELFLYLADRAQHVGQVIRPALDEGVVVLSDRYADSTVVYQGYGRGLDPERLRELNDMA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLDIAR 182
           V  + PD T++ DLP + GL+R   R +LRE   +    FE + +  H + R+ +L  A 
Sbjct: 121 VGGLWPDLTLVFDLPPEEGLRRAMTR-NLREGTSVSEGRFEAEHLAFHARVREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSP 218
             P R  +VD+  +   V  +++  V  ++     P
Sbjct: 180 LHPARFRVVDATRTPDEVFEDVMRAVRSVLSAPARP 215


>gi|295692244|ref|YP_003600854.1| thymidylate kinase [Lactobacillus crispatus ST1]
 gi|295030350|emb|CBL49829.1| Thymidylate kinase [Lactobacillus crispatus ST1]
          Length = 212

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 120/209 (57%), Gaps = 17/209 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVH----VTREPGGTPAAEAARHVLLSCGV 59
           G F+SFEG +GAGK+T   +LK  L +   ++     VTREPGG+  AE  R ++L    
Sbjct: 3   GYFVSFEGPDGAGKST---VLKEVLNQIGSELKTQYLVTREPGGSKIAEKIRDIILDPAN 59

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           D+   + EA+++AA+R  HVE +IRPAL EGK++  DR++DSS AYQG   + + L +  
Sbjct: 60  DKMDNKTEALLYAASRSQHVEEIIRPALKEGKVVFSDRYVDSSLAYQG---AGRDLGIQE 116

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +++I   +  ++ PD T  LDL  ++GLKR++     +E    D  E++++  H+K    
Sbjct: 117 VKQINDFATDKLDPDLTFFLDLDPEVGLKRIEKLRPGQE----DRLEQENLAFHKKVYAG 172

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNIL 205
           FL +    P+R   VD+      V   ++
Sbjct: 173 FLKVKETYPERFVTVDATQPIDQVVAQVI 201


>gi|329113408|ref|ZP_08242189.1| Thymidylate kinase [Acetobacter pomorum DM001]
 gi|326697233|gb|EGE48893.1| Thymidylate kinase [Acetobacter pomorum DM001]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 114/209 (54%), Gaps = 9/209 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+FI+ EG EG GK+T + LLK  L+ +   V  TREPGG+  AE  R +LL  G +
Sbjct: 2   MACGMFITLEGAEGVGKSTQLRLLKEKLEAQGQKVLATREPGGSAGAEDLRQLLL-FGKN 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A AE +   AAR DHV+ VI PAL  G+I+LCDRF DS+ AYQG   ++    + SL
Sbjct: 61  PLSARAEILTHFAARYDHVDQVILPALKAGQIVLCDRFTDSTLAYQGYGRANGDPAILSL 120

Query: 121 QEISVQE--VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
             I  ++  + PD T +L  P  +  +R+  R      A  D +E+ D   H +    F 
Sbjct: 121 IAILQKQLGLQPDITFLLQAPRAVSRQRLAAR-----GAPTDRYEQADEAFHARLADGFA 175

Query: 179 DIARNQPDRCHIVD-SAHSFQSVATNILN 206
            IA+ +P R  +VD S +S + V   IL 
Sbjct: 176 HIAQAEPQRVVVVDTSVYSAEQVNAQILK 204


>gi|254670330|emb|CBA05726.1| Thymidylate kinase [Neisseria meningitidis alpha153]
          Length = 206

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRGVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  I+DS  S   V  +I  ++
Sbjct: 178 ERYAIIDSNRSLDEVRNSIEKVL 200


>gi|257454679|ref|ZP_05619935.1| thymidylate kinase [Enhydrobacter aerosaccus SK60]
 gi|257447989|gb|EEV22976.1| thymidylate kinase [Enhydrobacter aerosaccus SK60]
          Length = 213

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 109/204 (53%), Gaps = 10/204 (4%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FISFEG EG GK+T I+ L  +L  +  D   TREPGG+P AE  R +LL         +
Sbjct: 13  FISFEGTEGVGKSTLIANLAAYLTAQGIDFIQTREPGGSPFAEQLRAMLLDPATT-MTED 71

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQEIS 124
           +E ++  AAR DHV  VI PAL +G+ +LCDRF DS+ AYQG  R       L  ++ + 
Sbjct: 72  SELLLMFAARADHVAQVILPALAQGQWVLCDRFTDSTIAYQGFGRKQGDRAELSKIELLI 131

Query: 125 VQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
              V  MPD TI LDLPV  G+ R +NR        LD FE+  +   E+  Q F   A+
Sbjct: 132 RHFVAKMPDMTIWLDLPVTEGMSRAKNR------GKLDRFEQNQLAFFERVHQGFAYQAQ 185

Query: 183 NQPDRCHIVDSAHSFQSVATNILN 206
            +P R   +D+  +   V   +L 
Sbjct: 186 QEPQRVKRIDAQGTPDEVLAKVLT 209


>gi|271970386|ref|YP_003344582.1| dTMP kinase [Streptosporangium roseum DSM 43021]
 gi|270513561|gb|ACZ91839.1| dTMP kinase [Streptosporangium roseum DSM 43021]
          Length = 688

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 117/209 (55%), Gaps = 8/209 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG EG+GKTT   LL  +L+ + +DV  TREPG T      R +LL        
Sbjct: 468 GMFIAFEGGEGSGKTTQSRLLAIWLRDQGFDVVQTREPGSTKVGMRLRAILLDAVHQGLS 527

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A +EA+++AA R +HVE VIRPAL  G +++ DR++DSS AYQG   + +   +  +   
Sbjct: 528 ARSEALLYAADRAEHVEKVIRPALYRGSMVISDRYVDSSLAYQGAGRALEPGDVARINAW 587

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD T+++D P  +GL R+            D  E + +  HE+ R+ F  +A  
Sbjct: 588 ATGGLVPDLTVLIDTPPSVGLTRL--------GGAADRIESEPLEFHERVRREFRSLAAA 639

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            P+R  +VD   + + ++  I + V E++
Sbjct: 640 APERYLVVDGTLAQEQISLLIHDRVREVL 668


>gi|295425167|ref|ZP_06817871.1| thymidylate kinase [Lactobacillus amylolyticus DSM 11664]
 gi|295065143|gb|EFG56047.1| thymidylate kinase [Lactobacillus amylolyticus DSM 11664]
          Length = 216

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 115/209 (55%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FIS EG +GAGK++ +  +L     + N    VTREPGG+  AE  R ++L     + 
Sbjct: 7   GYFISLEGPDGAGKSSVLEQVLNEIGPQLNTQYLVTREPGGSRIAEKIRQIILDPANVKM 66

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  HVE ++RPAL  GK++  DRF+DSS AYQG   + + L +D +++
Sbjct: 67  DDRTEALLYAAARSQHVEEIVRPALAAGKVVFSDRFVDSSLAYQG---AGRDLGIDQVKQ 123

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +   + PD T+  DL   IGL R+Q     +E    D  E++ +  HEK    +  
Sbjct: 124 INEFATGGIEPDLTLFFDLDPKIGLARIQKLRPDQE----DRLEQEKLAFHEKVYAGYQK 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           IAR  PDR   +D++  F  V    + I+
Sbjct: 180 IARQNPDRIVKIDASQPFDQVEAETIAII 208


>gi|262373085|ref|ZP_06066364.1| thymidylate kinase [Acinetobacter junii SH205]
 gi|262313110|gb|EEY94195.1| thymidylate kinase [Acinetobacter junii SH205]
          Length = 199

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 114/194 (58%), Gaps = 10/194 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FISFEG EG GKTT I  + ++ +++  +V +TREPGGTP AE  R +LL+   DE  +
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQYFEQQGKEVVLTREPGGTPLAEQIRTLLLAVNHDELMS 60

Query: 65  -EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQE 122
            + E ++  AAR  H++ VI PAL  GKI+L DRF D+S+AYQ   R  SQ   L  L +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALAAGKIVLSDRFTDASFAYQCAGRGLSQEK-LQLLNQ 119

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
             V + MP+ T  LD P+++G+ R       RE   LD FE++ +    K R  +  + +
Sbjct: 120 TFVAK-MPNITFWLDAPIELGMTRA------RERGALDRFEQEKLSFFAKVRAGYKTLWQ 172

Query: 183 NQPDRCHIVDSAHS 196
            +P+R   +D+  +
Sbjct: 173 AEPERIKRLDATQN 186


>gi|182420064|ref|ZP_02951298.1| thymidylate kinase [Clostridium butyricum 5521]
 gi|237666856|ref|ZP_04526841.1| dTMP kinase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182376101|gb|EDT73688.1| thymidylate kinase [Clostridium butyricum 5521]
 gi|237658055|gb|EEP55610.1| dTMP kinase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 211

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 117/211 (55%), Gaps = 10/211 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI FEG EG GKTT I  +  ++Q K+     TREPGG   +E  R V+L     
Sbjct: 1   MKKGLFIVFEGGEGTGKTTAIESIYDWIQEKDLKCIKTREPGGIKISEEIRQVILDKDNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
           +     EA+++AAAR  H+   + PAL EG ++LCDRF+DSS AYQG    ++ L +D  
Sbjct: 61  KMDGRTEALLYAAARRQHLVEKVIPALNEGYVVLCDRFIDSSLAYQG---FARGLGIDEV 117

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+ + ++ E MPD +I+ DL   IGL+R+      RE   LD  E+ D   HEK R+ +
Sbjct: 118 MSINKFAIGEYMPDLSILFDLEPKIGLERISTS-GEREINRLD-LEKID--FHEKVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
             + R   DR   +++  S + V   I  I+
Sbjct: 174 NKVYRENRDRIVRINAEQSKEGVLKEIKKIL 204


>gi|116629043|ref|YP_814215.1| thymidylate kinase [Lactobacillus gasseri ATCC 33323]
 gi|311111161|ref|ZP_07712558.1| dTMP kinase [Lactobacillus gasseri MV-22]
 gi|116094625|gb|ABJ59777.1| thymidylate kinase [Lactobacillus gasseri ATCC 33323]
 gi|311066315|gb|EFQ46655.1| dTMP kinase [Lactobacillus gasseri MV-22]
          Length = 217

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ L+K+  +       +TREPGG+  +E  R ++L     E 
Sbjct: 7   GYLITFEGPDGAGKTTVINELIKQLPKEIQEKTIITREPGGSKISENIRTIILDPANKEM 66

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GKI+L DRF+DSS AYQG     ++L ++++++
Sbjct: 67  DDRTEALLYAAQRSQHVSEVIRPALEAGKIVLSDRFIDSSLAYQG---VGRNLGVEAVKQ 123

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + PD TI LDL    GL R++   + +E    D  E++ +  H+K    + D
Sbjct: 124 INDFGTGGLEPDLTIFLDLDPATGLARIEKERAGQE----DRLEQEKLAFHQKVYAGYTD 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +  PDR   VD+    + VA N + I+
Sbjct: 180 LLKRYPDRIKKVDANLPIKEVAANSVKII 208


>gi|311065067|ref|YP_003971793.1| thymidylate kinase [Bifidobacterium bifidum PRL2010]
 gi|310867387|gb|ADP36756.1| Tmk Thymidylate kinase [Bifidobacterium bifidum PRL2010]
          Length = 250

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 120/213 (56%), Gaps = 23/213 (10%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL------- 55
           +GLFISFEG++G GKTT +  L+ +L+    +V VTREPGGT    + R +LL       
Sbjct: 8   TGLFISFEGVDGVGKTTQVERLRDYLEAAGREVVVTREPGGTALGGSLRQLLLRELGDAA 67

Query: 56  -SCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQH 114
            + G D     AEA++FAA R  HV  V+RPAL  G +++ DR+LDSS AYQ      + 
Sbjct: 68  EADGTD-IAPRAEALIFAADRAQHVAEVVRPALERGAVVITDRYLDSSLAYQA---GGRE 123

Query: 115 LFLDSLQEISVQE---VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHE 171
           L  D ++ +S+     +MP  T +LD+      +R+Q+     ESA  ++ +R       
Sbjct: 124 LTADDVRGLSMWATGGLMPVRTYLLDMDPTAAHRRLQHDADRMESAGDEFQQRT------ 177

Query: 172 KRRQIFLDIARNQPDRCHIVDSAHSFQSVATNI 204
             RQ FLD+A ++P R  ++D+A   ++V  +I
Sbjct: 178 --RQAFLDLAGHEPGRFRVIDAAWPIEAVWEHI 208


>gi|309792153|ref|ZP_07686625.1| dTMP kinase [Oscillochloris trichoides DG6]
 gi|308225694|gb|EFO79450.1| dTMP kinase [Oscillochloris trichoides DG6]
          Length = 230

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 118/226 (52%), Gaps = 11/226 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFI+FEG EG+GK+T   LL   LQ   Y V +TREPGGT  +E  R +++     E   
Sbjct: 3   LFITFEGSEGSGKSTQARLLYERLQAVGYPVILTREPGGTRISELIRRIVMDLRHTEMAP 62

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E ++F+AAR   V  +IRP L  G I+LCDR+ DS++AYQG         L ++  ++
Sbjct: 63  TTETLLFSAARAQLVSELIRPYLGTGGIVLCDRYADSTFAYQGYGLGRDLEELQAITTVA 122

Query: 125 VQEVMPDCTIILDLPVDIGLKRV--------QNRYSLRESACLDY--FERKDVMIHEKRR 174
              + PD T  LDLPV+ GL+R         QN      S  +++   + +D+  H++  
Sbjct: 123 TGGLQPDLTFYLDLPVEEGLRRKHLAKERAEQNAPGTTLSTPVEWNRLDARDLAYHQRVA 182

Query: 175 QIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLS 220
             F D+ R +P R  I+ +      +A  I   V  L+ KRV+ L 
Sbjct: 183 AGFADLIRKEPQRWRIIPAEQPIPILAEQIAQEVAPLL-KRVARLG 227


>gi|269214814|ref|ZP_06158844.1| dTMP kinase [Neisseria lactamica ATCC 23970]
 gi|269208972|gb|EEZ75427.1| dTMP kinase [Neisseria lactamica ATCC 23970]
          Length = 210

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 118/199 (59%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++ +K + +R+   V  TREPGGT   EA R +LL+    + G  
Sbjct: 7   FITLDGIDGAGKSTNLAAIKVWFERRGLPVLFTREPGGTALGEALREILLNPAT-KAGLR 65

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 66  AETMMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 125

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P ++ + R+      RE    D FE+++    ++ RQ++L  A  QP
Sbjct: 126 GGLKPDLTLLLDVPPEVSMARIGQ---TREK---DRFEQEEAGFFKRVRQVYLQRAGRQP 179

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++D + S ++V   I
Sbjct: 180 ERYAVIDGSRSPEAVGHQI 198


>gi|224283541|ref|ZP_03646863.1| Thymidylate kinase [Bifidobacterium bifidum NCIMB 41171]
 gi|310288198|ref|YP_003939457.1| Thymidylate kinase [Bifidobacterium bifidum S17]
 gi|313140695|ref|ZP_07802888.1| thymidylate kinase [Bifidobacterium bifidum NCIMB 41171]
 gi|309252135|gb|ADO53883.1| Thymidylate kinase [Bifidobacterium bifidum S17]
 gi|313133205|gb|EFR50822.1| thymidylate kinase [Bifidobacterium bifidum NCIMB 41171]
          Length = 244

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 119/212 (56%), Gaps = 21/212 (9%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-- 60
           +GLFISFEG++G GKTT +  L+ +L+    +V VTREPGGT    + R +LL    D  
Sbjct: 2   TGLFISFEGVDGVGKTTQVERLRDYLEAAGREVVVTREPGGTALGGSLRQLLLREPGDAA 61

Query: 61  -----EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHL 115
                +    AEA++FAA R  HV  V+RPAL  G +++ DR+LDSS AYQ      + L
Sbjct: 62  EADGADIAPRAEALIFAADRAQHVAEVVRPALERGAVVITDRYLDSSLAYQA---GGREL 118

Query: 116 FLDSLQEISVQE---VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK 172
             D ++ +S+     +MP  T +LD+      +R+Q+     ESA  ++ +R        
Sbjct: 119 TADDVRGLSMWATGGLMPVRTYLLDMDPTAAHRRLQHDADRMESAGDEFQQRT------- 171

Query: 173 RRQIFLDIARNQPDRCHIVDSAHSFQSVATNI 204
            RQ FLD+A ++P R  ++D+A   ++V  +I
Sbjct: 172 -RQAFLDLAGHEPGRFRVIDAAWPIEAVWEHI 202


>gi|83644968|ref|YP_433403.1| thymidylate kinase [Hahella chejuensis KCTC 2396]
 gi|123533767|sp|Q2SK46|KTHY_HAHCH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|83633011|gb|ABC28978.1| thymidylate kinase [Hahella chejuensis KCTC 2396]
          Length = 208

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 111/204 (54%), Gaps = 6/204 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EGIEGAGKTT+++ ++  L+    +V +TREPGGTP AE  R +LL    +
Sbjct: 1   MKKGLFITVEGIEGAGKTTNLNFIRSILEESGEEVVMTREPGGTPMAEEVRELLLRPREE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              + AE ++  AAR  H+E  I+P +  G  +L DRF D++YAYQG         +  L
Sbjct: 61  AVSSTAELLLMFAARAQHLEQKIKPTIERGVHVLSDRFTDATYAYQGGGRGLSWAMIQDL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +++      PD T++L +  + G+ R + R        LD FER+ +  +   ++ ++  
Sbjct: 121 EKLVQAGFKPDLTLLLRIDPETGMARARKR------GALDRFEREKLEFYFCVQEGYMKR 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
               P+R  +VD+  S + V   I
Sbjct: 175 VAEDPERFLVVDAQQSLEEVQAAI 198


>gi|313668856|ref|YP_004049140.1| thymidylate kinase [Neisseria lactamica ST-640]
 gi|313006318|emb|CBN87781.1| putative thymidylate kinase [Neisseria lactamica 020-06]
          Length = 208

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 118/199 (59%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++ +K + +R+   V  TREPGGT   EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAAIKVWFERRGLPVLFTREPGGTALGEALREILLNPAT-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P ++ + R+      RE    D FE+++    ++ RQ++L  A  QP
Sbjct: 124 GGLKPDLTLLLDVPPEVSMARIGQ---TREK---DRFEQEEAGFFKRVRQVYLQRAGRQP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++D + S ++V   I
Sbjct: 178 ERYAVIDGSRSPEAVGHQI 196


>gi|52078523|ref|YP_077314.1| thymidylate kinase [Bacillus licheniformis ATCC 14580]
 gi|52783885|ref|YP_089714.1| thymidylate kinase [Bacillus licheniformis ATCC 14580]
 gi|319648552|ref|ZP_08002766.1| thymidylate kinase [Bacillus sp. BT1B_CT2]
 gi|81667281|sp|Q65PJ3|KTHY_BACLD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|52001734|gb|AAU21676.1| thymidylate kinase [Bacillus licheniformis ATCC 14580]
 gi|52346387|gb|AAU39021.1| Tmk [Bacillus licheniformis ATCC 14580]
 gi|317389319|gb|EFV70132.1| thymidylate kinase [Bacillus sp. BT1B_CT2]
          Length = 212

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 125/215 (58%), Gaps = 10/215 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+FEG EGAGKTT +      L +  + V  TREPGG   +E  R V+L+      
Sbjct: 2   NGLFITFEGPEGAGKTTILQAAADQLTKNGHSVLATREPGGIEISERIREVILNPSHTAM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---S 119
             + EA+++AAAR  H+   ++PAL EGKI+LCDRF+DSS AYQG    ++ L +D   S
Sbjct: 62  DPKTEALLYAAARRQHLVEKVKPALEEGKIVLCDRFIDSSLAYQG---YARGLGIDEVFS 118

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + ++  +MP+ TI  D+  + G+KR+ +    RE   LD    + +  H+  ++ + +
Sbjct: 119 VNQFAIGSLMPNVTIYFDIDPEEGIKRI-DLNDAREKNRLDL---EKLHFHQLVQKGYEE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +    P R  IVD++ S + V   + NI+ E +++
Sbjct: 175 VMNRFPGRFRIVDASQSVELVLKRVNNIIEEALKE 209


>gi|295094265|emb|CBK83356.1| thymidylate kinase [Coprococcus sp. ART55/1]
          Length = 207

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 106/172 (61%), Gaps = 12/172 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+ EG +GAGKTT   LLK +L++K YDV +TR+PGG P +EA R V+L+    E G
Sbjct: 3   GIFITIEGPDGAGKTTQRELLKEYLEKKGYDVLITRDPGGNPISEAIREVILNKDFTEMG 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS---L 120
              E +++A+AR   V+  I+PAL  G+ ++ DRF+DSS  YQG     + L +D+   +
Sbjct: 63  YMTELLLYASARAQLVKENIKPALDAGQAVIADRFVDSSAVYQG---IGRGLGVDTVYKV 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK 172
            E ++Q +MPD T ++DL    G+ R +N+      A LD  E + +  H+K
Sbjct: 120 NEFALQGIMPDMTFLMDLDAQEGISRKKNQ------AELDRMENEKMEFHQK 165


>gi|220911618|ref|YP_002486927.1| dTMP kinase [Arthrobacter chlorophenolicus A6]
 gi|219858496|gb|ACL38838.1| dTMP kinase [Arthrobacter chlorophenolicus A6]
          Length = 232

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 118/216 (54%), Gaps = 11/216 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           ++GLFI+FEG +GAGK+T  + L   L+ +   V  TREPGGTP  E  R ++L  G   
Sbjct: 5   SAGLFIAFEGGDGAGKSTQAARLAEALESRGLTVLRTREPGGTPIGEKLRSLVLDHGHGH 64

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD--- 118
             A  EA++FAA+R  H   VIRPAL  G I+L DR++DSS AYQG   + + L +D   
Sbjct: 65  IDAHTEALIFAASRAAHAGQVIRPALERGDIVLTDRYIDSSVAYQG---AGRDLGMDAVR 121

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           SL E +   + P  T++LD+  ++G  R          A  D  E +    H + R+ FL
Sbjct: 122 SLNEWATSGLQPHLTVLLDVEPEVGRTRRTA-----GDATEDRLESEADEFHARIREAFL 176

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           D+A  +P    ++ +      +A  IL+ V+ L++ 
Sbjct: 177 DLAAARPASYLVLPARLPVNDLAAMILDRVFGLLES 212


>gi|242279385|ref|YP_002991514.1| thymidylate kinase [Desulfovibrio salexigens DSM 2638]
 gi|259494265|sp|C6BUG6|KTHY_DESAD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|242122279|gb|ACS79975.1| thymidylate kinase [Desulfovibrio salexigens DSM 2638]
          Length = 217

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 109/194 (56%), Gaps = 3/194 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GKTT I  L  FL+   ++V VT EPGG+   +  R +LL+    +   
Sbjct: 1   MFITFEGIEGTGKTTQIKKLTAFLEESGHNVDVTLEPGGSRIGKELRKILLNMDSTDITG 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           E E  ++ A R  HV  VI+PA+  GKI++ DRF DS+  YQG         L  L +++
Sbjct: 61  ECELFLYLADRAQHVGQVIKPAVEAGKIIISDRFADSTIVYQGYGRGLDPKLLRELNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLDIAR 182
           V    PD TI+LD+  +IGLKR   R +L+E+   +   FE + +  H + R+ +L  A 
Sbjct: 121 VSGNWPDLTILLDIDPEIGLKRAMTR-NLQENKMQEEGRFEAESLEFHNRVREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHS 196
              DR  +V++  +
Sbjct: 180 LNNDRIVVVNADQT 193


>gi|159897030|ref|YP_001543277.1| dTMP kinase [Herpetosiphon aurantiacus ATCC 23779]
 gi|229621739|sp|A9AV71|KTHY_HERA2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|159890069|gb|ABX03149.1| dTMP kinase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 236

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 117/223 (52%), Gaps = 19/223 (8%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFI+FEG EG+GK+T    LK +LQ+  Y V +TREPGGTP ++A R ++L         
Sbjct: 3   LFITFEGPEGSGKSTQARYLKDYLQQAGYPVILTREPGGTPISDAVRRLVLDGQWTAMEP 62

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E ++FAAAR   V  VI P L  G I+LCDR+ DS++A+QG         L  +   +
Sbjct: 63  TTETLLFAAARAQLVGEVILPYLKLGGIVLCDRYADSTFAHQGYGLGRNLTELREITRFA 122

Query: 125 VQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACL---------------DYFER---K 165
              + PD T  LDLPV+ GL+R  + R   RES+ L               +++ R   +
Sbjct: 123 TGGLQPDLTFFLDLPVEQGLQRKRKQRDDFRESSQLALPLPHLPQPSPSQNEHWNRLDAR 182

Query: 166 DVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           ++  HE+ R  +L++    P R  + D+    +S+   +L  V
Sbjct: 183 EIAYHERVRSGYLEMIAADPQRWQVFDAGIERESLTEQLLLAV 225


>gi|121594087|ref|YP_985983.1| thymidylate kinase [Acidovorax sp. JS42]
 gi|171769451|sp|A1W6N2|KTHY_ACISJ RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|120606167|gb|ABM41907.1| thymidylate kinase [Acidovorax sp. JS42]
          Length = 217

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 119/216 (55%), Gaps = 17/216 (7%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FI+FEGI+GAGK++HI  L + L+   + V +TREPGGTP AE  R +LL    D
Sbjct: 1   MTNGAFITFEGIDGAGKSSHIDALAQALRAAGHTVALTREPGGTPLAEKLREMLLH---D 57

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGER---DSSQHLFL 117
              A  EA++  AAR DH+  VI PAL  G+++LCDRF D+++AYQG     D     ++
Sbjct: 58  SMDALTEALLVFAARRDHLRCVIEPALARGEVVLCDRFTDATFAYQGAGRGFDLEVLSYM 117

Query: 118 DSLQEISV---QEVM--PDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK 172
           + L +  V    ++M  PD T+  D+P ++  +R      L  +   D FE + V    +
Sbjct: 118 ERLAQTGVGLQPDLMRNPDLTLWFDVPPEVAAQR------LSAARAPDRFESQPVEFFTR 171

Query: 173 RRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
             + + D A   P R   +DS+   + VA  +  +V
Sbjct: 172 VARGYADRAAGAPQRFARIDSSQPREQVAAQLRAVV 207


>gi|116669282|ref|YP_830215.1| thymidylate kinase [Arthrobacter sp. FB24]
 gi|116609391|gb|ABK02115.1| thymidylate kinase [Arthrobacter sp. FB24]
          Length = 226

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 113/215 (52%), Gaps = 7/215 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N GLFI+FEG +GAGK+T  + L   L  +   V  TREPGGTP  E  R ++L  G   
Sbjct: 5   NPGLFIAFEGGDGAGKSTQAAALAGALDSRGIRVLRTREPGGTPIGEKLRSLVLDHGHGH 64

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA++FAA+R  H + VI PAL  G+I+L DR++DSS AYQG         +  L 
Sbjct: 65  IDARTEALIFAASRAAHADQVILPALERGEIVLTDRYIDSSVAYQGAGRDLGTAAVRDLN 124

Query: 122 EISVQEVMPDCTIILDLPVDIG-LKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E +   + PD T++LD+   +G L+R          A  D  E +    H K R  FLD+
Sbjct: 125 EWATSGLQPDLTVLLDVDPAVGRLRRTAG------DAAEDRMESEADEFHAKIRTAFLDL 178

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A ++P+   ++ +      +A  IL  V  L+  R
Sbjct: 179 AADRPEHYLVLPAHLPVAELAGLILARVDSLIGSR 213


>gi|282898411|ref|ZP_06306402.1| Thymidylate kinase [Raphidiopsis brookii D9]
 gi|281196942|gb|EFA71847.1| Thymidylate kinase [Raphidiopsis brookii D9]
          Length = 216

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 112/206 (54%), Gaps = 7/206 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-F 62
           G  I FEG+EG+GKTT + +L ++LQ       +TREPGGT   +  R +LL    ++  
Sbjct: 3   GKLIVFEGVEGSGKTTQMQMLAQWLQTLGISFLLTREPGGTDLGKNLRKLLLETSYEQPL 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AE +++ A R  HV ++I+P L  GK +LCDR+ +S+ AYQG         +D L +
Sbjct: 63  DEMAELLLYTADRSQHVSSIIKPNLATGKYILCDRYTNSTIAYQGYGRGLNMTIIDQLNQ 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I+   +  D TI LD+ V+IGL R       R  A LD  E++ +  H + ++ + +IA+
Sbjct: 123 IATGGLESDLTIWLDIDVEIGLSRK------RGQAELDRMEQETIEFHHRVQKGYNEIAK 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
           N P +   VD     + V  NI  I+
Sbjct: 177 NHPSKMIRVDGNGGQELVQENIRKIL 202


>gi|257790898|ref|YP_003181504.1| thymidylate kinase [Eggerthella lenta DSM 2243]
 gi|317488389|ref|ZP_07946944.1| thymidylate kinase [Eggerthella sp. 1_3_56FAA]
 gi|325830525|ref|ZP_08163978.1| dTMP kinase [Eggerthella sp. HGA1]
 gi|257474795|gb|ACV55115.1| thymidylate kinase [Eggerthella lenta DSM 2243]
 gi|316912509|gb|EFV34063.1| thymidylate kinase [Eggerthella sp. 1_3_56FAA]
 gi|325487434|gb|EGC89875.1| dTMP kinase [Eggerthella sp. HGA1]
          Length = 244

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 102/192 (53%), Gaps = 8/192 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG EGAGKTTHI  L   L+    +V   REPGGT   E  R V+L        
Sbjct: 14  GIFITFEGGEGAGKTTHIRFLSETLRAHGREVLCLREPGGTEVGEQLRAVVLDPANGGMS 73

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            EAE +++ AAR   +  VI PAL  G ++LCDRF DS+ AYQ        +F+D + E 
Sbjct: 74  DEAELLIYEAARAQLMAQVIAPALARGAVVLCDRFTDSTVAYQAYGRGLPRMFVDRVNEF 133

Query: 124 SVQEVMPDCTIILDL--PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + Q V PD TI++      ++GL R  +R         D  E+     H +  + FL+IA
Sbjct: 134 ACQGVHPDRTILMATGGEANVGLVRATHR------GAADRLEQAGEEFHARVNEAFLEIA 187

Query: 182 RNQPDRCHIVDS 193
           R  P+R  +V S
Sbjct: 188 RRDPERVRVVVS 199


>gi|228476228|ref|ZP_04060931.1| dTMP kinase [Staphylococcus hominis SK119]
 gi|228269713|gb|EEK11212.1| dTMP kinase [Staphylococcus hominis SK119]
          Length = 205

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 118/208 (56%), Gaps = 8/208 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT ++ + + L  +NY+V  TREPGG    E  R++LL    +     
Sbjct: 4   FITFEGPEGSGKTTVLNQINKLLS-ENYNVISTREPGGVSTGEEIRNILLDG--ENIDIR 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL   K++LCDR++DSS AYQG         +  + E ++
Sbjct: 61  TEALLFAASRREHLVEKVIPALKNNKVVLCDRYIDSSLAYQGYARGIGIEEVKKINEFAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI LD+  ++G +R+     L+     +  +++ +  H+K  + +  + +  P
Sbjct: 121 NGLYPDLTIYLDIDAEVGRERI-----LKNQRSQNRLDKETLTFHQKVIEGYKTLIKTNP 175

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +R  +VD+  S +SV +N   I+   ++
Sbjct: 176 ERFKVVDATQSIESVISNTYEIILSYLK 203


>gi|284048006|ref|YP_003398345.1| thymidylate kinase [Acidaminococcus fermentans DSM 20731]
 gi|283952227|gb|ADB47030.1| thymidylate kinase [Acidaminococcus fermentans DSM 20731]
          Length = 206

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLFI+ EG +G GKTT    L R+ +    +  +TREPGGT  AE+ R ++L   +D 
Sbjct: 3   QKGLFITLEGPDGGGKTTQAQQLARWFRLYGRETVITREPGGTATAESIRELVLDPALD- 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              E E ++  AAR DHV+ VIRPAL  GK+++CDRF DS+  YQG         L  L 
Sbjct: 62  LSPETETLLQLAARADHVDQVIRPALEAGKVVICDRFTDSTMVYQGILRDMDLAQLRKLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + + + + PD T++LD      +KR +NR        +D FE + +   ++ R  +L +A
Sbjct: 122 DFATRGLRPDVTLLLDGDPRELVKRRENR------GTVDKFELQGLAYQDRIRAGYLRLA 175

Query: 182 RNQPDRCHIVDSAHSFQSVATNIL 205
           + +P+R  +VD+    + V   I+
Sbjct: 176 QEEPERILVVDALREPEVVTEEII 199


>gi|326693439|ref|ZP_08230444.1| thymidylate kinase [Leuconostoc argentinum KCTC 3773]
          Length = 217

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 124/220 (56%), Gaps = 13/220 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPGGTPAAEAARHVLLSCGV 59
           M   LFI+FEG EGAGKT+ +  L   LQ +  +  VT REPGG P +EA R +L     
Sbjct: 1   MTKPLFITFEGPEGAGKTSVLQALVAELQPQLGEALVTTREPGGNPISEAIRAILQPAED 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +      EA+++ AAR  H+ +V+ PAL  GK+++ DR++DSS AYQG     + L ++ 
Sbjct: 61  NGMDDRTEALLYTAARRQHLVSVVLPALEAGKVVISDRYVDSSLAYQG---GGRGLGIEQ 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQ 175
           + +I   ++  +MPD TI  D+P ++GL RV  NR        +D  +++ +  H+  R+
Sbjct: 118 IWQINQFAIDGLMPDLTIYFDVPAEVGLARVMANRQD-----KIDRLDKESLAFHQAVRE 172

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +L + R+  DR  ++D+    + V      ++++++  R
Sbjct: 173 TYLALQRDFSDRIKLIDATQPLEQVIAETRTLLFDIIASR 212


>gi|296315027|ref|ZP_06864968.1| dTMP kinase [Neisseria polysaccharea ATCC 43768]
 gi|296838232|gb|EFH22170.1| dTMP kinase [Neisseria polysaccharea ATCC 43768]
          Length = 206

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+       +S   D FE++      + R ++L+ A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIG------QSREKDRFEQEQEDFFMRVRSVYLNRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS  S   V  NI  ++
Sbjct: 178 ERYAVIDSNRSLDEVRNNIERVL 200


>gi|293194284|ref|ZP_06609970.1| dTMP kinase [Actinomyces odontolyticus F0309]
 gi|292819731|gb|EFF78745.1| dTMP kinase [Actinomyces odontolyticus F0309]
          Length = 271

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 120/210 (57%), Gaps = 15/210 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+FI+FEG +G+GK+T I  ++ + + +  +V VTREPGGT      R  L+  G ++  
Sbjct: 5   GVFITFEGGDGSGKSTQIQSVRDWFESRGREVIVTREPGGTELGTEIRR-LVQNGPEDVD 63

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD---SL 120
           A  EA+++AA R  HV  VI PAL  G ++L DR++DSS AYQG   +++ L +D   SL
Sbjct: 64  ARTEALLYAADRAYHVATVIAPALERGAVVLGDRYIDSSLAYQG---AARSLGVDEIASL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              + + + P  T +LDLP ++GL R  +          D  ER+ +  HE+ R  +L +
Sbjct: 121 SAWATRGLYPSLTFLLDLPPEVGLHRHTD--------APDRMERESMDFHERVRHEYLRL 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A  +PDR  ++D+  +   V + I  ++ E
Sbjct: 173 ADAEPDRIVVIDAVGTVDEVFSEIRGVLVE 202


>gi|239501058|ref|ZP_04660368.1| thymidylate kinase [Acinetobacter baumannii AB900]
          Length = 199

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 111/195 (56%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  + +   V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALEANKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRIDATQS 186


>gi|88705148|ref|ZP_01102860.1| Thymidylate kinase [Congregibacter litoralis KT71]
 gi|88700843|gb|EAQ97950.1| Thymidylate kinase [Congregibacter litoralis KT71]
          Length = 209

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 115/213 (53%), Gaps = 5/213 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G  I  +G  GAGKTT I  ++  LQ  N +   TREPGGTP  E  R +LLS    
Sbjct: 1   MKKGRMIVVDGSNGAGKTTVIEAIRDHLQHVNRETVFTREPGGTPIGEKIREILLSPEAG 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     E ++FAAAR  HV   I PA+  GK+++ DRF  ++ ++Q          + +L
Sbjct: 61  EMADVTELMLFAAARAQHVREKIMPAVEAGKVVVSDRFDSATVSFQHYARGLPLELITTL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            EI+V  + PD TIILDL  + GL RV +R        LD  E++ +    K R  +L  
Sbjct: 121 NEIAVDGLKPDMTIILDLDPEAGLVRVGSR-----GDDLDRLEKEKLDFLHKARDGYLGQ 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A+  PD   ++D++ S  +V + +L++V ++++
Sbjct: 176 AKASPDNFVVIDASQSLDNVISEVLSVVDQVIE 208


>gi|194468114|ref|ZP_03074100.1| dTMP kinase [Lactobacillus reuteri 100-23]
 gi|194452967|gb|EDX41865.1| dTMP kinase [Lactobacillus reuteri 100-23]
          Length = 213

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 112/203 (55%), Gaps = 6/203 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFL--QRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           G FISFEG +GAGKT+ I  ++R L  Q     V  TREPGG   +E  R VL      +
Sbjct: 3   GKFISFEGPDGAGKTSVIQQIQRELEDQLGTEKVMYTREPGGNKISEQIRQVLFDGQNTD 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA++FAAAR  H+ + I P L  GK++LCDRF+DSS AYQG         +  + 
Sbjct: 63  MDGRTEALLFAAARRQHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQIN 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + ++  +MP  TI LD+  +IGLKR+    +   S  ++  + + +  H   RQ +L + 
Sbjct: 123 QFAIDGLMPALTIYLDIESEIGLKRI----AEHRSNQVNRLDEEKLEFHRTVRQSYLKLY 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
           +N P+R  ++D++   + V  ++
Sbjct: 179 QNYPERIKLIDASQPLKKVIEDV 201


>gi|294011646|ref|YP_003545106.1| dTMP kinase [Sphingobium japonicum UT26S]
 gi|292674976|dbj|BAI96494.1| dTMP kinase [Sphingobium japonicum UT26S]
          Length = 213

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 111/209 (53%), Gaps = 5/209 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FIS EG EGAGK+T +  L   L+ +  DV  TREPGG+  AEA R +LL+ G D + 
Sbjct: 9   GRFISLEGGEGAGKSTQLRALAAALRARGLDVVETREPGGSEGAEAIRALLLTGGADRWS 68

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA++FAAAR DHVE  IRPAL  G  +L DRFLDSS AYQG    +    L +L  I
Sbjct: 69  PRAEALLFAAARADHVEKTIRPALERGAWVLSDRFLDSSRAYQGMGALTDADIL-ALHRI 127

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
                +PD T+ L LP +    R ++    R+    D    +D   H      F   A  
Sbjct: 128 GSDGFLPDRTLFLTLPEEEASARARS----RDGDAADRIGGRDRDFHLAVSTAFHRFAAQ 183

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +P R   VD++    +V   ++  V +L+
Sbjct: 184 EPTRFLAVDASGEAGAVTARLIEAVRDLL 212


>gi|169632744|ref|YP_001706480.1| thymidylate kinase [Acinetobacter baumannii SDF]
 gi|184159124|ref|YP_001847463.1| thymidylate kinase [Acinetobacter baumannii ACICU]
 gi|260556574|ref|ZP_05828792.1| thymidylate kinase [Acinetobacter baumannii ATCC 19606]
 gi|294841418|ref|ZP_06786101.1| thymidylate kinase [Acinetobacter sp. 6014059]
 gi|229487548|sp|B2HWQ7|KTHY_ACIBC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229487549|sp|B0VTL6|KTHY_ACIBS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|169151536|emb|CAP00303.1| thymidylate kinase [Acinetobacter baumannii]
 gi|183210718|gb|ACC58116.1| Thymidylate kinase [Acinetobacter baumannii ACICU]
 gi|260409833|gb|EEX03133.1| thymidylate kinase [Acinetobacter baumannii ATCC 19606]
 gi|322509038|gb|ADX04492.1| tmk [Acinetobacter baumannii 1656-2]
 gi|323519020|gb|ADX93401.1| thymidylate kinase [Acinetobacter baumannii TCDC-AB0715]
          Length = 199

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 111/195 (56%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  + +   V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRLDATQS 186


>gi|59800692|ref|YP_207404.1| thymidylate kinase [Neisseria gonorrhoeae FA 1090]
 gi|194097952|ref|YP_002000998.1| thymidylate kinase [Neisseria gonorrhoeae NCCP11945]
 gi|240013551|ref|ZP_04720464.1| thymidylate kinase [Neisseria gonorrhoeae DGI18]
 gi|240015990|ref|ZP_04722530.1| thymidylate kinase [Neisseria gonorrhoeae FA6140]
 gi|240080130|ref|ZP_04724673.1| thymidylate kinase [Neisseria gonorrhoeae FA19]
 gi|240112344|ref|ZP_04726834.1| thymidylate kinase [Neisseria gonorrhoeae MS11]
 gi|240115084|ref|ZP_04729146.1| thymidylate kinase [Neisseria gonorrhoeae PID18]
 gi|240117368|ref|ZP_04731430.1| thymidylate kinase [Neisseria gonorrhoeae PID1]
 gi|240120623|ref|ZP_04733585.1| thymidylate kinase [Neisseria gonorrhoeae PID24-1]
 gi|240122923|ref|ZP_04735879.1| thymidylate kinase [Neisseria gonorrhoeae PID332]
 gi|240125177|ref|ZP_04738063.1| thymidylate kinase [Neisseria gonorrhoeae SK-92-679]
 gi|240127632|ref|ZP_04740293.1| thymidylate kinase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493144|ref|ZP_05106315.1| thymidylate kinase [Neisseria gonorrhoeae 1291]
 gi|260441100|ref|ZP_05794916.1| thymidylate kinase [Neisseria gonorrhoeae DGI2]
 gi|268596281|ref|ZP_06130448.1| thymidylate kinase [Neisseria gonorrhoeae FA19]
 gi|268598402|ref|ZP_06132569.1| thymidylate kinase [Neisseria gonorrhoeae MS11]
 gi|268600757|ref|ZP_06134924.1| thymidylate kinase [Neisseria gonorrhoeae PID18]
 gi|268603063|ref|ZP_06137230.1| thymidylate kinase [Neisseria gonorrhoeae PID1]
 gi|268681542|ref|ZP_06148404.1| thymidylate kinase [Neisseria gonorrhoeae PID332]
 gi|268683771|ref|ZP_06150633.1| thymidylate kinase [Neisseria gonorrhoeae SK-92-679]
 gi|268686011|ref|ZP_06152873.1| thymidylate kinase [Neisseria gonorrhoeae SK-93-1035]
 gi|291044433|ref|ZP_06570142.1| thymidylate kinase [Neisseria gonorrhoeae DGI2]
 gi|293399613|ref|ZP_06643766.1| thymidylate kinase [Neisseria gonorrhoeae F62]
 gi|73920825|sp|Q5F9Z5|KTHY_NEIG1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229621733|sp|B4RJR3|KTHY_NEIG2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|59717587|gb|AAW88992.1| putative thymidylate kinase [Neisseria gonorrhoeae FA 1090]
 gi|193933242|gb|ACF29066.1| thymidylate kinase [Neisseria gonorrhoeae NCCP11945]
 gi|226512184|gb|EEH61529.1| thymidylate kinase [Neisseria gonorrhoeae 1291]
 gi|268550069|gb|EEZ45088.1| thymidylate kinase [Neisseria gonorrhoeae FA19]
 gi|268582533|gb|EEZ47209.1| thymidylate kinase [Neisseria gonorrhoeae MS11]
 gi|268584888|gb|EEZ49564.1| thymidylate kinase [Neisseria gonorrhoeae PID18]
 gi|268587194|gb|EEZ51870.1| thymidylate kinase [Neisseria gonorrhoeae PID1]
 gi|268621826|gb|EEZ54226.1| thymidylate kinase [Neisseria gonorrhoeae PID332]
 gi|268624055|gb|EEZ56455.1| thymidylate kinase [Neisseria gonorrhoeae SK-92-679]
 gi|268626295|gb|EEZ58695.1| thymidylate kinase [Neisseria gonorrhoeae SK-93-1035]
 gi|291011327|gb|EFE03323.1| thymidylate kinase [Neisseria gonorrhoeae DGI2]
 gi|291610182|gb|EFF39304.1| thymidylate kinase [Neisseria gonorrhoeae F62]
          Length = 206

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---AREK---DRFEQEQADFFMRVRGVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS  S   V  +I  ++
Sbjct: 178 ERYAVIDSNRSLDEVRNSIEKVL 200


>gi|227824456|ref|ZP_03989288.1| thymidylate kinase [Acidaminococcus sp. D21]
 gi|226904955|gb|EEH90873.1| thymidylate kinase [Acidaminococcus sp. D21]
          Length = 205

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 118/215 (54%), Gaps = 13/215 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG +G+GKTT    LK +L+ K  +V +TREPGGT  AE  R + LS  + 
Sbjct: 1   MKKGLFITLEGPDGSGKTTQAKRLKAYLETKGREVVLTREPGGTGLAETLRSLALSPEI- 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 E+++  AAR DHV+ VIRPAL  GK+++CDRF DS+  YQG       + LD L
Sbjct: 60  TMSKRVESLLHVAARADHVDKVIRPALEAGKVVICDRFSDSTLIYQGILGG---MDLDEL 116

Query: 121 QEISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           + +S+   + + PD T ++D    + L R + R         D FE + ++  EK RQ +
Sbjct: 117 ERLSLFGSKGLSPDVTFLIDGNPRVLLSRREAR------GVTDKFEAQGLLFQEKIRQGY 170

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           L +    P+R  ++D   +  SV   ++  V + +
Sbjct: 171 LTLLDRYPERMILIDGEGTPDSVTDALIKKVEKFL 205


>gi|261392957|emb|CAX50542.1| thymidylate kinase (dTMP kinase) [Neisseria meningitidis 8013]
 gi|325141921|gb|EGC64362.1| thymidylate kinase [Neisseria meningitidis 961-5945]
          Length = 206

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRSVYLNRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  I+DS  S   V  +I  ++
Sbjct: 178 ERYAIIDSNRSLDEVRNSIEKVL 200


>gi|226952159|ref|ZP_03822623.1| thymidylate kinase [Acinetobacter sp. ATCC 27244]
 gi|226837095|gb|EEH69478.1| thymidylate kinase [Acinetobacter sp. ATCC 27244]
          Length = 201

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 120/210 (57%), Gaps = 12/210 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + ++ +++  +V +TREPGGTP AE  R +LL+   +E   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQYFEQQGKEVVLTREPGGTPLAEQIRSLLLAVNHEEQMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL  GKI+L DRF D+S+AYQ    S + L  + LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALEAGKIVLSDRFTDASFAYQC---SGRGLSQEKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R  +  + 
Sbjct: 118 NQTFVAKMPNITFWLDAPIELGMTRA------RERGALDRFEQEKLSFFAKVRAGYETLW 171

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
           + +P+R   +++  +   V    LN + +L
Sbjct: 172 QAEPERIKRLNATQNADLVFEEALNYIKQL 201


>gi|295702267|ref|YP_003595342.1| thymidylate kinase [Bacillus megaterium DSM 319]
 gi|294799926|gb|ADF36992.1| thymidylate kinase [Bacillus megaterium DSM 319]
          Length = 208

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 116/198 (58%), Gaps = 4/198 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EGAGKTT I ++++ L ++ Y++ +TREPGG   AE  R ++L+    E 
Sbjct: 2   SGTFITFEGPEGAGKTTIIHMVQQKLIQEGYNIVLTREPGGIRIAEQIREIILNPSNTEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + P L +G I+LCDRF+DSS AYQG         + ++ +
Sbjct: 62  DARTEALLYAAARRQHLVEKVIPELNKGNIVLCDRFIDSSLAYQGNARGIGVEDIFAINQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++++ MP  T+  D+  ++GL+R+ N+    E   LD    + +  H K R  +L +  
Sbjct: 122 FAIEQTMPQATLYFDIEPEVGLERI-NKGRKDEINRLDL---ESLDFHYKVRDGYLSLLS 177

Query: 183 NQPDRCHIVDSAHSFQSV 200
             P+R   +D+  S + V
Sbjct: 178 EFPERIRRIDANQSVEKV 195


>gi|302873019|ref|YP_003841652.1| thymidylate kinase [Clostridium cellulovorans 743B]
 gi|307688812|ref|ZP_07631258.1| thymidylate kinase [Clostridium cellulovorans 743B]
 gi|302575876|gb|ADL49888.1| thymidylate kinase [Clostridium cellulovorans 743B]
          Length = 212

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 118/211 (55%), Gaps = 9/211 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N G  I+ EG +G+GK+T I LLK++   + Y+V  TREPGGT  +E  R ++L    +E
Sbjct: 8   NRGYLITIEGPDGSGKSTQIELLKKYFNDRGYEVVTTREPGGTKISEKIRELILDNDNEE 67

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSL 120
                EA+++AA+R   VE V++PA+ EGKI+LCDRF+ SS  YQG  R+   +  L+ +
Sbjct: 68  MNGICEALLYAASRAQLVEQVLKPAIYEGKIVLCDRFVHSSLVYQGYARELGVNQVLN-I 126

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E ++  +  D TI++D+P ++G++R       R+   LD  E      H K    +  I
Sbjct: 127 NEFALNGLKADLTIMIDIPYELGIERK------RKQKKLDRLENGGDEFHNKVFNGYQQI 180

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
            +   +   I+D   + + +  +I+  + EL
Sbjct: 181 VKTMKNVV-IIDGTKAVEEIHKDIVKTIAEL 210


>gi|146277283|ref|YP_001167442.1| dTMP kinase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555524|gb|ABP70137.1| thymidylate kinase [Rhodobacter sphaeroides ATCC 17025]
          Length = 217

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 112/206 (54%), Gaps = 5/206 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLF++ EGI+G+GK+  +  L   L+    +V VTREPGGTP  EA R ++L+   + 
Sbjct: 4   QGGLFLAVEGIDGSGKSGIVQHLAARLRAHGREVVVTREPGGTPEGEAIRGLVLAGADEA 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +   AE ++  AAR+ HV  VI PAL  G ++L DR+  S+ AYQG        F+ +L 
Sbjct: 64  WDPMAELLLMTAARVQHVRRVIAPALEAGSVVLSDRYAGSTLAYQGTGRGLSESFIRALH 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLD 179
             +  ++ PD T+ILDL    GL R + R +    + +D   FE  D+  HE+ RQ F  
Sbjct: 124 AEATGDLWPDLTLILDLDAATGLARSRRRLT---GSAIDEGRFESLDLAFHERIRQSFRA 180

Query: 180 IARNQPDRCHIVDSAHSFQSVATNIL 205
            A   P R  ++D++ + + V    L
Sbjct: 181 QAARDPARHAVIDASGTPEQVQARAL 206


>gi|284989206|ref|YP_003407760.1| thymidylate kinase [Geodermatophilus obscurus DSM 43160]
 gi|284062451|gb|ADB73389.1| thymidylate kinase [Geodermatophilus obscurus DSM 43160]
          Length = 225

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 117/216 (54%), Gaps = 12/216 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+FEG EGAGK+T + LL  +L  +      T EPGGTPA  A R ++L        
Sbjct: 19  GLFIAFEGGEGAGKSTQVRLLCEWLTAQGRPARATFEPGGTPAGAAVRAIVLDRAHTGLS 78

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA+++AA R  H   V+RPAL  G++++ DR++DSS AYQG   + + + LD +  I
Sbjct: 79  PRAEALLYAADRAQHAHAVLRPALEAGEVVVTDRYVDSSLAYQG---AGRTIGLDDVAAI 135

Query: 124 SVQEVM---PDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           S    +   PD T++LDLP + GL R +        A  D  E + +  H++ R  F  +
Sbjct: 136 SRWATLGLRPDLTVLLDLPPETGLARARG------RAAADRLESESLEFHQRVRDTFRTL 189

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           A  +P R  ++D+      +A ++   V  L+ +R 
Sbjct: 190 AAAEPGRYLVLDATRGVDELAADVRARVGALLGERA 225


>gi|258591911|emb|CBE68216.1| thymidylate kinase [NC10 bacterium 'Dutch sediment']
          Length = 243

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 111/213 (52%), Gaps = 11/213 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+F++FEG EG+GKTT + LL   ++    +V  T +PGGT   +  R +LL  G     
Sbjct: 20  GIFVTFEGGEGSGKTTQLKLLANRIRASGKEVIETHDPGGTAIGKEIRTLLLDPGSAPIA 79

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           +  E +++ A+R   V  +I P L +G ++LCDRF DS+ AYQG   S     +  L   
Sbjct: 80  STTELLLYEASRAQLVRELIAPTLRQGVVVLCDRFTDSTLAYQGFGRSLDLDLIQRLNRC 139

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSL-------RESACLDYFERKDVMIHEKRRQI 176
           +   V+PD TI+ DL  +IGL R +   SL        E AC D  E + +  H + R+ 
Sbjct: 140 ATDGVVPDLTILFDLDPEIGLTRCRRDTSLDAVTGSGAEPACWDRIEAEPLEFHRRIREG 199

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVW 209
           +L +AR   DR  ++D+        T I  IVW
Sbjct: 200 YLALARENRDRMIVIDAGVGV----TEIETIVW 228


>gi|229816418|ref|ZP_04446719.1| hypothetical protein COLINT_03471 [Collinsella intestinalis DSM
           13280]
 gi|229807960|gb|EEP43761.1| hypothetical protein COLINT_03471 [Collinsella intestinalis DSM
           13280]
          Length = 226

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 105/201 (52%), Gaps = 6/201 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+ EGI+G GK+T   L+   L+   +DV   REPGG   +E  R +LL     E G
Sbjct: 5   GLFITVEGIDGCGKSTQARLIAAALEAAGHDVLRLREPGGVKISEQIREILLDPANVEMG 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++ AAR   V  VIRPAL  GK ++CDRF DS+ AYQ   D      +    E+
Sbjct: 65  DVCELLLYEAARAQLVHQVIRPALAAGKTVVCDRFYDSTTAYQAFADGLDRNMVSQANEL 124

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +V    PD T++ DLPV+  L+R   R +       D  E K +   E+    F  +A +
Sbjct: 125 AVDGCRPDLTLVFDLPVEDALRRRSGREA------EDRLELKGLEFQERVAAGFRAVAVD 178

Query: 184 QPDRCHIVDSAHSFQSVATNI 204
           +PDR  ++D+  S   V + +
Sbjct: 179 EPDRVKLIDAGGSIAEVFSGV 199


>gi|114762660|ref|ZP_01442094.1| thymidylate kinase [Pelagibaca bermudensis HTCC2601]
 gi|114544570|gb|EAU47576.1| thymidylate kinase [Roseovarius sp. HTCC2601]
          Length = 208

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 115/203 (56%), Gaps = 6/203 (2%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLFISFEGI+G+GK+T   LL   L+    +V +TREPGG+P AE  R ++L    + 
Sbjct: 4   GTGLFISFEGIDGSGKSTQARLLAEHLRSTGREVVLTREPGGSPGAEEIRALVLQGDPER 63

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           + AE E ++F AAR DH+E  IRPAL  G  ++CDRF DS+  YQG         +D+L 
Sbjct: 64  WSAETELLLFTAARRDHLERTIRPALARGATVICDRFADSTRMYQGLSRGDLRGAVDTLH 123

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + +  V PD T+++D+  +  L R + R +  E      FE   + + +K R  FL +A
Sbjct: 124 ALMIG-VEPDLTLLIDMDPEAALARAKARATAEE-----RFEDFGLPLQQKMRAGFLALA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
                R  IVD   + ++VA ++
Sbjct: 178 AEFSGRFRIVDGNRAPEAVAQDV 200


>gi|294496900|ref|YP_003560600.1| thymidylate kinase [Bacillus megaterium QM B1551]
 gi|294346837|gb|ADE67166.1| thymidylate kinase [Bacillus megaterium QM B1551]
          Length = 208

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 114/198 (57%), Gaps = 4/198 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EGAGKTT I ++++ L ++ Y + +TREPGG   AE  R ++L+    E 
Sbjct: 2   SGTFITFEGPEGAGKTTIIHMVQQKLIQEGYTIVLTREPGGIRIAEQIREIILNPSNTEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + P L +G I+LCDRF+DSS AYQG         + ++ +
Sbjct: 62  DARTEALLYAAARRQHLVEKVIPELNKGNIVLCDRFIDSSLAYQGNARGIGVEDIFAINQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++++ MP  T+  D+  ++GL+R+ N         ++  + + +  H K R  +L +  
Sbjct: 122 FAIEQTMPQATLYFDIEPEVGLERINN----GRKDEINRLDLESLDFHYKVRDGYLSLLS 177

Query: 183 NQPDRCHIVDSAHSFQSV 200
             P+R   +D+  S + V
Sbjct: 178 EFPERIRRIDANQSVEKV 195


>gi|315644344|ref|ZP_07897484.1| thymidylate kinase [Paenibacillus vortex V453]
 gi|315280221|gb|EFU43513.1| thymidylate kinase [Paenibacillus vortex V453]
          Length = 214

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 107/192 (55%), Gaps = 4/192 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFI+ EG EG+GKTT +  L  F+Q  +    +TREPGG   AE  R ++L        A
Sbjct: 7   LFITLEGGEGSGKTTMMGRLAAFMQNHSIPYLITREPGGIEIAEKIRSIILDPEHTAMDA 66

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA+++AAAR  H+   + PAL +G  +LCDRF+DSS  YQG         + S+ + +
Sbjct: 67  RTEALLYAAARRQHLVEKVEPALRQGLTVLCDRFVDSSLVYQGYARGLGMEEVWSINQFA 126

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++ D+   IGL R+      RE   LD    +++  HEK R+ +L +A   
Sbjct: 127 IDTRMPDLTLLFDIEPKIGLSRIAANAE-REWNRLDM---ENLTFHEKVREGYLLVAERN 182

Query: 185 PDRCHIVDSAHS 196
           PDR  IVD++ +
Sbjct: 183 PDRIRIVDASKT 194


>gi|199599031|ref|ZP_03212438.1| Thymidylate kinase [Lactobacillus rhamnosus HN001]
 gi|258509257|ref|YP_003172008.1| thymidylate kinase [Lactobacillus rhamnosus GG]
 gi|199590067|gb|EDY98166.1| Thymidylate kinase [Lactobacillus rhamnosus HN001]
 gi|257149184|emb|CAR88157.1| Thymidylate kinase [Lactobacillus rhamnosus GG]
 gi|259650539|dbj|BAI42701.1| thymidylate kinase [Lactobacillus rhamnosus GG]
          Length = 215

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 112/209 (53%), Gaps = 4/209 (1%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ + +L+ +        VH+TREPGG   +E  R V+L      
Sbjct: 2   TGTFITFEGPDGAGKTSVLNTLIPKLKACSVTSVHLTREPGGAKISETIRDVILDPKNTA 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA+++AA+R  H+  VI+PAL  G I++CDRF+DSS AYQG         +  + 
Sbjct: 62  MDARTEALLYAASRRQHLVEVIQPALAHGDIVVCDRFVDSSVAYQGGGRQIGTQAVLQMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +   + PD T+ LD+PV +GL R+      R+    D  +++ +  HE+    ++ + 
Sbjct: 122 QFATAGLEPDLTVYLDVPVQVGLDRIMAHQGERQ---YDRLDQESLAFHERVHAAYMKLV 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
            + P R   VD+     +V T     + E
Sbjct: 179 ADNPKRIVTVDATQPLAAVVTAAFMTITE 207


>gi|254804548|ref|YP_003082769.1| Thymidylate kinase [Neisseria meningitidis alpha14]
 gi|254668090|emb|CBA04608.1| Thymidylate kinase [Neisseria meningitidis alpha14]
 gi|325127822|gb|EGC50730.1| thymidylate kinase [Neisseria meningitidis N1568]
          Length = 206

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRGVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS  +   V  +I  ++
Sbjct: 178 ERYAVIDSNRNLDEVRNSIEKVL 200


>gi|50085662|ref|YP_047172.1| thymidylate kinase [Acinetobacter sp. ADP1]
 gi|59798252|sp|Q6F9B5|KTHY_ACIAD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|49531638|emb|CAG69350.1| thymidylate kinase [Acinetobacter sp. ADP1]
          Length = 202

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 113/209 (54%), Gaps = 8/209 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  L    +     V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKLYEHFEASGKQVVLTREPGGTPLAEQIRSLLLAVNHDEPMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           ++ E ++  AAR  H++ VI PAL + K++L DRF D+SYAYQ          L++L + 
Sbjct: 61  SDTELLLMYAARAQHLQQVIVPALADEKLVLSDRFTDASYAYQCVGRGLSKDKLNTLNQT 120

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            V   MPD T  LD P+++G+ R       RE   LD FE++ V   ++ RQ +  +   
Sbjct: 121 FVSH-MPDITFWLDAPIELGMSRA------RERGALDRFEQEKVEFFQRVRQGYQQLHEL 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
            P+R   +D+  + + V    L  +  LV
Sbjct: 174 YPERIKRLDATQAPEIVFQEALEHIQALV 202


>gi|328478590|gb|EGF48257.1| thymidylate kinase [Lactobacillus rhamnosus MTCC 5462]
          Length = 226

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 112/209 (53%), Gaps = 4/209 (1%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ + +L+ +        VH+TREPGG   +E  R V+L      
Sbjct: 13  TGTFITFEGPDGAGKTSVLNTLIPKLKACSVTSVHLTREPGGAKISETIRDVILDPKNTA 72

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA+++AA+R  H+  VI+PAL  G I++CDRF+DSS AYQG         +  + 
Sbjct: 73  MDARTEALLYAASRRQHLVEVIQPALAHGDIVVCDRFVDSSVAYQGGGRQIGTQAVLQMN 132

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +   + PD T+ LD+PV +GL R+      R+    D  +++ +  HE+    ++ + 
Sbjct: 133 QFATAGLEPDLTVYLDVPVQVGLDRIMAHQGERQ---YDRLDQESLAFHERVHAAYMKLV 189

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
            + P R   VD+     +V T     + E
Sbjct: 190 ADNPKRIVTVDATQPLAAVVTAAFMTITE 218


>gi|229487554|sp|A3M7Q1|KTHY_ACIBT RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|193078024|gb|ABO12945.2| thymidylate kinase [Acinetobacter baumannii ATCC 17978]
          Length = 199

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 111/195 (56%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  + +   V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KVEPERIKRLDATQS 186


>gi|78187170|ref|YP_375213.1| thymidylate kinase [Chlorobium luteolum DSM 273]
 gi|123582911|sp|Q3B3B1|KTHY_PELLD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|78167072|gb|ABB24170.1| thymidylate kinase [Chlorobium luteolum DSM 273]
          Length = 214

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 113/209 (54%), Gaps = 4/209 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           + I+FEGI+GAGK+T I  L  +L+++  +V   REPGGT  AE  RH+LL    D    
Sbjct: 1   MLITFEGIDGAGKSTQIQKLAAYLKQEGREVLTLREPGGTEVAEKIRHILLESRHD-ITP 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E ++F+A+R + V  V+RPAL EGK ++ DRF DS+ AYQG         L +L  IS
Sbjct: 60  VGELLLFSASRAELVSEVVRPALAEGKTVILDRFFDSTTAYQGYGRGLDLNMLRTLIAIS 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLR---ESACLDYFERKDVMIHEKRRQIFLDIA 181
              + PD T  LD+  +  L R  +  SL    E+  LD  ER  +  +   RQ +LDI 
Sbjct: 120 TGALTPDITFYLDILPEEALIRKFSEKSLPLAFENEELDRMERSGLEFYRNVRQGYLDII 179

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
             +P R   +++ H  Q +   I+  + E
Sbjct: 180 EAEPGRFKSINARHGVQEIHAIIVKTLNE 208


>gi|282901980|ref|ZP_06309878.1| Thymidylate kinase [Cylindrospermopsis raciborskii CS-505]
 gi|281193067|gb|EFA68066.1| Thymidylate kinase [Cylindrospermopsis raciborskii CS-505]
          Length = 216

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 112/206 (54%), Gaps = 7/206 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-F 62
           G  I FEG+EG+GKTT + +L ++LQ       +TREPGGT   +  R +LL    ++  
Sbjct: 3   GKLIVFEGVEGSGKTTQMQMLAQWLQTLGISFLLTREPGGTHLGQNLRKLLLETFYEQPL 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AE +++ A R  HV ++I+P L  GK +LCDR+ +S+ AYQG       + +D L +
Sbjct: 63  DEMAELLLYTADRSQHVSSIIKPNLATGKYILCDRYTNSTVAYQGYGRGLNMIIIDQLNQ 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           I+   +  D TI LD+ V+IGL R       R  A LD  E++ +  H + ++ +  IA+
Sbjct: 123 IATGGLESDLTIWLDIDVEIGLSRK------RGQAELDRMEQETIEFHHRVQEGYNKIAK 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
           N P +   VD     + V  NI  I+
Sbjct: 177 NHPSKIIRVDGNREPELVQENIRKIL 202


>gi|239908616|ref|YP_002955358.1| thymidylate kinase [Desulfovibrio magneticus RS-1]
 gi|259494267|sp|C4XNX1|KTHY_DESMR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|239798483|dbj|BAH77472.1| thymidylate kinase [Desulfovibrio magneticus RS-1]
          Length = 209

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 119/212 (56%), Gaps = 7/212 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS---CGVDE 61
           +F++FEG+EG+GK+T ++ L   L+     V  TR+PGG    +  R +LLS    G+D+
Sbjct: 1   MFVTFEGVEGSGKSTQMTRLCAALEAAGRTVCRTRQPGGCFLGQTLRAILLSQKTAGLDD 60

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AE  ++ A R  HV  VIRPAL  G++++CDR+ DS+ AYQG         L +L 
Sbjct: 61  ---RAELFLYLADRAQHVAEVIRPALAAGQVVVCDRYTDSTVAYQGYGRGLDTTLLQNLN 117

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNR-YSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            ++   V+PD T++LDL   IGL R  +R  +   +     FE + +  H++ R  +  +
Sbjct: 118 AVAAAGVVPDLTVLLDLDPAIGLTRATSRNAAAGTAEAEGRFEAERLEFHQRVRAGYRAL 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           A  +P R  ++D+A S  +VA  +  +V +L+
Sbjct: 178 AAAEPARFAVIDAAPSPDAVAEAVWGVVGKLL 209


>gi|294651029|ref|ZP_06728369.1| thymidylate kinase [Acinetobacter haemolyticus ATCC 19194]
 gi|292823130|gb|EFF81993.1| thymidylate kinase [Acinetobacter haemolyticus ATCC 19194]
          Length = 199

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 114/195 (58%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + ++ +++  +V +TREPGGTP AE  R +LL+   +E   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQYFEQQGKEVVLTREPGGTPLAEQIRSLLLAVNHEEQMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL  GKI+L DRF D+S+AYQ    S + L  + LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALAAGKIVLSDRFTDASFAYQC---SGRGLSQEKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R  +  + 
Sbjct: 118 NQTFVAKMPNITFWLDAPIELGMTRA------RERGALDRFEQEKLSFFAKVRAGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  +
Sbjct: 172 QAEPERIKRLDATQN 186


>gi|15676568|ref|NP_273712.1| thymidylate kinase [Neisseria meningitidis MC58]
 gi|14285516|sp|Q9K0D9|KTHY_NEIMB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|7225896|gb|AAF41088.1| thymidylate kinase [Neisseria meningitidis MC58]
 gi|316983637|gb|EFV62618.1| thymidylate kinase [Neisseria meningitidis H44/76]
 gi|325139881|gb|EGC62412.1| thymidylate kinase [Neisseria meningitidis CU385]
 gi|325200644|gb|ADY96099.1| thymidylate kinase [Neisseria meningitidis H44/76]
          Length = 206

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLKPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRGVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS  +   V  +I  ++
Sbjct: 178 ERYAVIDSNRNLDEVRNSIEKVL 200


>gi|322420736|ref|YP_004199959.1| thymidylate kinase [Geobacter sp. M18]
 gi|320127123|gb|ADW14683.1| thymidylate kinase [Geobacter sp. M18]
          Length = 223

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 107/191 (56%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG+EG GKTT + LLK  L+     V  TREPGG P A+  R +LL        
Sbjct: 2   GFFITFEGVEGCGKTTQLRLLKERLESAGEQVVATREPGGCPIADQMRAILLDAKNSAIT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AE +++AAAR  HV+ VI PAL  G+ +LCDRF D++ AYQG         +  L  +
Sbjct: 62  PLAELLLYAAARAQHVQEVIVPALERGETVLCDRFTDATVAYQGHGRELDLDVIRQLNAL 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   V P  T+++D PV+IGL R  +R      A  + FE + V  HE+ R  +L +A+ 
Sbjct: 122 ATGGVEPAVTVLIDCPVEIGLSRALSRIEATSGAREERFELESVRFHERVRAGYLSLAKA 181

Query: 184 QPDRCHIVDSA 194
            P R  +VD +
Sbjct: 182 FPRRFVVVDGS 192


>gi|293609834|ref|ZP_06692136.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828286|gb|EFF86649.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 199

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 110/195 (56%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  +     V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEHGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALEANKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRIDATQS 186


>gi|325123060|gb|ADY82583.1| thymidylate kinase [Acinetobacter calcoaceticus PHEA-2]
          Length = 199

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 110/195 (56%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  +     V +TREPGGTP AE  R +LL+   DE   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEHGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALEANKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSRMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRIDATQS 186


>gi|309775015|ref|ZP_07670030.1| dTMP kinase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308917233|gb|EFP62958.1| dTMP kinase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 210

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 113/216 (52%), Gaps = 6/216 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN GLFI+FEG +G+GKTT   L    L+   Y V  TREPGG   AE  R V+L     
Sbjct: 1   MNKGLFITFEGNDGSGKTTISKLAYERLKEMGYPVIYTREPGGIDIAEQIRKVILDPANT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AA+R  H+   + PAL EG I+LCDRF+DSS  YQG         + ++
Sbjct: 61  AMDERCEALLYAASRRQHLVEKVLPALNEGSIVLCDRFVDSSLVYQGIARGIGMEEVYAI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +++  +PD TI L +  + GL RV +R         D  + + +  H+   Q +  I
Sbjct: 121 NQFAIEGHLPDATIFLSVDFETGLSRVTSR------GNKDRLDNESMEFHKLVAQGYELI 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
                DR HIVD+     +V  N ++ + E+++  V
Sbjct: 175 KEKFKDRMHIVDANADVDTVLNNTVSCIMEIIKNHV 210


>gi|294676800|ref|YP_003577415.1| thymidylate kinase [Rhodobacter capsulatus SB 1003]
 gi|294475620|gb|ADE85008.1| thymidylate kinase [Rhodobacter capsulatus SB 1003]
          Length = 206

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 112/212 (52%), Gaps = 6/212 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGI+G+GK+T   LL   L     DV  TREPGG+P AE  R ++L    D + A
Sbjct: 1   MFITFEGIDGSGKSTQARLLAEALAGLGRDVIRTREPGGSPGAEEIRALVLQGDPDRWSA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           + E ++F AAR DH+E  I PAL  G++++CDRF DS+  YQG         +D L  + 
Sbjct: 61  KTEILLFTAARRDHLERTIAPALAAGQVVICDRFADSTRMYQGLSRGDLRGLVDDLHRLM 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +    PD T ++D+   +GL R + R    E      FE   + +  + R  FL +++  
Sbjct: 121 IGR-EPDLTFLIDIDPAVGLARAKGRQGHEE-----RFEDMGLAMQVRMRAGFLALSQEF 174

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             R  +++      +VA  +L++    ++ R 
Sbjct: 175 SSRFKVIEGDRRPDAVAAEVLDVTLAALRARA 206


>gi|222111179|ref|YP_002553443.1| thymidylate kinase [Acidovorax ebreus TPSY]
 gi|221730623|gb|ACM33443.1| thymidylate kinase [Acidovorax ebreus TPSY]
          Length = 217

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 118/216 (54%), Gaps = 17/216 (7%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FI+FEGI+GAGK++HI  L + L+   + V +TREPGGTP AE  R +LL    D
Sbjct: 1   MTNGAFITFEGIDGAGKSSHIDALAQALRAAGHTVTLTREPGGTPLAEKLREMLLH---D 57

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGER---DSSQHLFL 117
              A  E ++  AAR DH+  VI PAL  G+++LCDRF D+++AYQG     D     ++
Sbjct: 58  SMDALTETLLVFAARRDHLRCVIEPALARGEVVLCDRFTDATFAYQGAGRGFDLEVLSYM 117

Query: 118 DSLQEISV---QEVM--PDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK 172
           + L +  V    ++M  PD T+  D+P ++  +R      L  +   D FE + V    +
Sbjct: 118 ERLAQTGVGLQPDLMRNPDLTLWFDVPPEVAAQR------LSAARAPDRFESQPVEFFTR 171

Query: 173 RRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
             + + D A   P R   +DS+   + VA  +  +V
Sbjct: 172 VARGYADRAAGAPQRFARIDSSQPREQVAAQLRAVV 207


>gi|312142724|ref|YP_003994170.1| thymidylate kinase [Halanaerobium sp. 'sapolanicus']
 gi|311903375|gb|ADQ13816.1| thymidylate kinase [Halanaerobium sp. 'sapolanicus']
          Length = 208

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 117/209 (55%), Gaps = 7/209 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEGIEG+GK+T I LL  +L+++  +V +TREPGGT   +  R +LL    +
Sbjct: 1   MGEGFFITFEGIEGSGKSTQIKLLGDYLKKEGKEVVITREPGGTELGKKIRQLLLDPAHE 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E +++ A R  H ++VI+PAL  GK+++ DRF DS+ AYQ       +  +  +
Sbjct: 61  DMDYRTEILLYTADRAQHFKDVIKPALKAGKVVISDRFADSNLAYQAAGRGLDYELVYKI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
            +  +    PD T +LD+ +  GLKR + + + L      D  ER+    H++ R+ +L+
Sbjct: 121 NDWVIDSRWPDLTFVLDVAIAEGLKRARASSFDLNG----DRLEREADSFHQRVRKAYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +   DR  +VD   + + V   + NI+
Sbjct: 177 MVKR--DRFALVDGNLAEEEVHQEVKNII 203


>gi|285017427|ref|YP_003375138.1| thymidylate kinase (dtmp kinase) protein [Xanthomonas albilineans
           GPE PC73]
 gi|283472645|emb|CBA15150.1| probable thymidylate kinase (dtmp kinase) protein [Xanthomonas
           albilineans]
          Length = 223

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 109/197 (55%), Gaps = 16/197 (8%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL----SCGVDE 61
           F+S EG EGAGKTT I+ ++ +LQ + ++V +TREPGGTP AE  R +LL    S   + 
Sbjct: 11  FVSLEGGEGAGKTTAINAIRDWLQAQGHEVVLTREPGGTPLAERIRGLLLDTAPSSSAEP 70

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             AE E ++  AAR  HV  VIRPAL  G  ++ DRF DSSYAYQGE       ++  L+
Sbjct: 71  LSAETELLLVFAARAQHVREVIRPALQRGAYVVSDRFTDSSYAYQGEGRGLDRAWIADLE 130

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNR--YSLR-ESACLDYFERKDVMIHEKRRQIFL 178
             +V  + P  T++LDL V IG  R   R  +  R ES   D+F+R         R  F 
Sbjct: 131 RRAVG-LQPGLTLLLDLDVQIGRARTSGRDLWPDRIESEQDDFFQRV--------RAGFR 181

Query: 179 DIARNQPDRCHIVDSAH 195
             A   P R  ++D++ 
Sbjct: 182 QRATQDPQRFRVIDASQ 198


>gi|58038509|ref|YP_190473.1| thymidylate kinase [Gluconobacter oxydans 621H]
 gi|81557238|sp|Q5FUU6|KTHY_GLUOX RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|58000923|gb|AAW59817.1| Thymidylate kinase [Gluconobacter oxydans 621H]
          Length = 214

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 120/213 (56%), Gaps = 12/213 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLFI+ EG EGAGK+T   LL   L+ + + V +TREPGGTP AE  R++LL   VD 
Sbjct: 3   GKGLFITLEGGEGAGKSTQARLLAEALRAEGHKVLLTREPGGTPGAEEIRNLLLFGKVD- 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG---ERDSSQHL-FL 117
               AE ++  AAR DH++N I PAL  G+I++CDRF DS+ AYQG    + + + L FL
Sbjct: 62  LSWRAEILMHMAARSDHLDNAILPALERGEIVVCDRFHDSTLAYQGYGIGQGAPEVLAFL 121

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           +  +++   +  PD T++L+LP    L R++ R         D +E +    HE+    F
Sbjct: 122 NGARKLV--DFEPDLTLMLELPRPQALARLKAR-----GGQTDRYEAQAEAFHERVLAGF 174

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
             IA   P R   VD+  + ++V+  +L  V E
Sbjct: 175 DAIASADPVRVKRVDAGQTPEAVSAALLQAVHE 207


>gi|325133815|gb|EGC56471.1| thymidylate kinase [Neisseria meningitidis M13399]
 gi|325143942|gb|EGC66252.1| thymidylate kinase [Neisseria meningitidis M01-240013]
 gi|325206485|gb|ADZ01938.1| thymidylate kinase [Neisseria meningitidis M04-240196]
          Length = 206

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRSVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS      V  +I  ++
Sbjct: 178 ERYAVIDSNLGLDEVRNSIEKVL 200


>gi|229552948|ref|ZP_04441673.1| dTMP kinase [Lactobacillus rhamnosus LMS2-1]
 gi|229313692|gb|EEN79665.1| dTMP kinase [Lactobacillus rhamnosus LMS2-1]
          Length = 226

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 112/209 (53%), Gaps = 4/209 (1%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ + +L+ +        VH+TREPGG   +E  R V+L      
Sbjct: 13  TGTFITFEGPDGAGKTSVLNTLIPKLKACSVTSVHLTREPGGAKISEMIRDVILDPKNTA 72

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA+++AA+R  H+  VI+PAL  G I++CDRF+DSS AYQG         +  + 
Sbjct: 73  MDARTEALLYAASRRQHLVEVIQPALAHGDIVVCDRFVDSSVAYQGGGRQIGTQAVLQMN 132

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +   + PD T+ LD+PV +GL R+      R+    D  +++ +  HE+    ++ + 
Sbjct: 133 QFATAGLEPDLTVYLDVPVQVGLDRIMAHQGERQ---YDRLDQESLAFHERVHAAYMKLV 189

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
            + P R   VD+     +V T     + E
Sbjct: 190 ADNPKRIVTVDATQPLAAVVTAAFMTITE 218


>gi|169351616|ref|ZP_02868554.1| hypothetical protein CLOSPI_02396 [Clostridium spiroforme DSM 1552]
 gi|169291838|gb|EDS73971.1| hypothetical protein CLOSPI_02396 [Clostridium spiroforme DSM 1552]
          Length = 206

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 124/212 (58%), Gaps = 11/212 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG +G+GKTT   ++   L  + Y V +TREPGG   AE  R ++L        
Sbjct: 3   GKFITLEGPDGSGKTTISKIVFDQLMAEGYKVLLTREPGGIDIAEQIRAIILDKKNIAME 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++AAAR  H+   I PAL +G +++CDRF+DSS  YQG    ++++ +D + +I
Sbjct: 63  ARTEALLYAAARRQHLIEKIEPALNDGYLVICDRFIDSSLVYQG---VARNIGIDEVYQI 119

Query: 124 ---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              ++ +V PD TI  D+P +IGL+R+   +  R++  LD  E  D   H+K  + ++ I
Sbjct: 120 NLFAIGDVFPDTTIFFDIPYEIGLERINKNH--RDTDRLD-LESND--FHKKVYEGYMSI 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
                DR   +D++ S   VA+ +++I+ +++
Sbjct: 175 CEKYADRITKIDASKSIDEVASQVIDIIKKII 206


>gi|319891435|ref|YP_004148310.1| Thymidylate kinase [Staphylococcus pseudintermedius HKU10-03]
 gi|317161131|gb|ADV04674.1| Thymidylate kinase [Staphylococcus pseudintermedius HKU10-03]
 gi|323465395|gb|ADX77548.1| thymidylate kinase [Staphylococcus pseudintermedius ED99]
          Length = 205

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 119/208 (57%), Gaps = 8/208 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFI+ EG EG+GKTT +  +   L  ++YDV  TREPGG   AEA R +LL    +   A
Sbjct: 3   LFITIEGPEGSGKTTVVQAVSEQLA-QHYDVMTTREPGGVQTAEAIRQILLDG--ETMDA 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAA+R +H+   + PAL +G++++CDRF+DSS AYQG         + ++ + +
Sbjct: 60  RTEALLFAASRREHLVAKVLPALSQGRLVICDRFIDSSLAYQGYARKIGVKEVQAINDFA 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           ++   PD TI LD+P ++G  R+++    +     +  +++ V  HE+  + +  +    
Sbjct: 120 IEGRYPDLTIYLDIPAEVGRTRIESNRRAQ-----NRLDKESVAFHERVVEGYQQLIAQD 174

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELV 212
           P R  ++++  S + V T  L ++ + +
Sbjct: 175 PKRFAVINANQSIEQVVTAALQVILQKI 202


>gi|120612065|ref|YP_971743.1| thymidylate kinase [Acidovorax citrulli AAC00-1]
 gi|166221717|sp|A1TSN1|KTHY_ACIAC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|120590529|gb|ABM33969.1| thymidylate kinase [Acidovorax citrulli AAC00-1]
          Length = 221

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 117/213 (54%), Gaps = 17/213 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGI+GAGK++HI  +   L+R+   V VTREPGGTP AE  R +LL+  +D   
Sbjct: 5   GWFITFEGIDGAGKSSHIEAVAEALRREGRTVTVTREPGGTPLAETLRSLLLNEAMD--- 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  E++V  A R DH+ +VI PAL+ G+++LCDRF D+++AYQG         L  L+ I
Sbjct: 62  ALTESLVVFAGRRDHLRSVIAPALVRGEVVLCDRFTDATFAYQGAGRGFDRAVLAQLERI 121

Query: 124 S---VQE-----VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ 175
           +   +QE     + P  T+  DL  D+   R++       +   D FE + V    +  Q
Sbjct: 122 TQSGLQEGTDAVLHPHLTLWFDLAPDVAAARLEG------ARAPDRFEAQPVEFFRRVAQ 175

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
            + D A   P R   +D+    ++V   ++ I+
Sbjct: 176 GYADRAAADPGRFARLDADQPREAVRAQLMEIL 208


>gi|134094620|ref|YP_001099695.1| thymidylate kinase [Herminiimonas arsenicoxydans]
 gi|166221746|sp|A4G4Y1|KTHY_HERAR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|133738523|emb|CAL61568.1| thymidylate kinase (dTMP kinase) [Herminiimonas arsenicoxydans]
          Length = 204

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 111/208 (53%), Gaps = 9/208 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M    FI+FEGI+GAGK+TH+S +   L+    +V VTREPGGT   EA R +LL    +
Sbjct: 1   MTKAKFITFEGIDGAGKSTHLSFVADLLRASKKNVVVTREPGGTSLGEALRTILLH---E 57

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +   E EA++  AAR +H+  +I PAL  G  ++ DRF D+++AYQG         L  L
Sbjct: 58  KMHLETEALLMFAARREHIAQLIEPALARGDWVISDRFTDATFAYQGGGRKLDRQKLSVL 117

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++     + PD T++ D+P+D+       R  L  +  LD FE++        R  +L  
Sbjct: 118 EQWVHPHLQPDLTLLFDVPLDVA------RARLDATRTLDKFEQEQADFFAATRAEYLRR 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P R  I+DS  +  ++   + +I+
Sbjct: 172 AAEFPQRFRIIDSTQAIATIQEQLRDII 199


>gi|114565616|ref|YP_752770.1| dTMP kinase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114336551|gb|ABI67399.1| thymidylate kinase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 210

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 115/211 (54%), Gaps = 12/211 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N GLFIS EGI+G GKT+    L ++  +  + V   REPGGT  +E  R +LL     E
Sbjct: 3   NKGLFISLEGIDGCGKTSVKEGLLQYFSK--FPVLSIREPGGTLISEKIREILLDEKNQE 60

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA ++AAAR   VE +IRPAL++GKI+L DR+LDS+ AYQG        FL +L 
Sbjct: 61  ITARTEAFLYAAARSQLVEELIRPALLQGKIVLADRYLDSTIAYQGYGRGLDLGFLTTLN 120

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++    + P  T++LD+    G +R       ++    D  E++ +    + R+ +L IA
Sbjct: 121 QLCTSGLKPHLTLLLDIDPAEGQRR-------KKKDIPDRLEKEGIEFQSRVREGYLKIA 173

Query: 182 RNQPDRCHIVDSAHSFQSV---ATNILNIVW 209
           R + +R  ++D+   F+ V   A   +  +W
Sbjct: 174 RQESERIKLLDAGKDFKEVLQEAIEYIEDIW 204


>gi|237746052|ref|ZP_04576532.1| thymidylate kinase [Oxalobacter formigenes HOxBLS]
 gi|229377403|gb|EEO27494.1| thymidylate kinase [Oxalobacter formigenes HOxBLS]
          Length = 210

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 112/208 (53%), Gaps = 9/208 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGI+GAGK+THI  +   L+ KN  V +TREPGGT   E  R +LL    D+  
Sbjct: 11  GRFITFEGIDGAGKSTHIDYVTGLLKAKNRQVVLTREPGGTGLGEKLREILLH---DKMT 67

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E EA++  AAR +H+ ++I PAL  G+ +L DRF D+S+AYQG         L  L+  
Sbjct: 68  PETEALLMFAARREHLADIIEPALRRGEWVLSDRFTDASFAYQGGGRGLAREKLRQLETW 127

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               + PD T + D+  DI   R++       +   D FER+      + R  +L  A+ 
Sbjct: 128 VHPHLQPDLTFLFDVSPDIAQTRLEA------ARSPDKFEREKADFFNRVRGEYLRRAKE 181

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWEL 211
            P+R  I+DS+    ++   +  ++ +L
Sbjct: 182 FPERFRIIDSSRPIAAIRETLKTLIGKL 209


>gi|169795088|ref|YP_001712881.1| thymidylate kinase [Acinetobacter baumannii AYE]
 gi|213158250|ref|YP_002320301.1| thymidylate kinase [Acinetobacter baumannii AB0057]
 gi|215482638|ref|YP_002324830.1| thymidylate kinase [Acinetobacter baumannii AB307-0294]
 gi|294836647|ref|ZP_06781330.1| thymidylate kinase [Acinetobacter sp. 6013113]
 gi|294860782|ref|ZP_06798551.1| thymidylate kinase [Acinetobacter sp. 6013150]
 gi|301345832|ref|ZP_07226573.1| thymidylate kinase [Acinetobacter baumannii AB056]
 gi|301512395|ref|ZP_07237632.1| thymidylate kinase [Acinetobacter baumannii AB058]
 gi|301594756|ref|ZP_07239764.1| thymidylate kinase [Acinetobacter baumannii AB059]
 gi|226732648|sp|B7GYE0|KTHY_ACIB3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|226732649|sp|B7I585|KTHY_ACIB5 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229487546|sp|B0VCV4|KTHY_ACIBY RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|169148015|emb|CAM85878.1| thymidylate kinase [Acinetobacter baumannii AYE]
 gi|213057410|gb|ACJ42312.1| thymidylate kinase [Acinetobacter baumannii AB0057]
 gi|213987116|gb|ACJ57415.1| thymidylate kinase [Acinetobacter baumannii AB307-0294]
          Length = 199

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 111/195 (56%), Gaps = 12/195 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FISFEG EG GKTT I  + +  + +   V +TREPGGTP AE  R +LL+   +E   
Sbjct: 1   MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHNENMS 60

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H++ VI PAL   KI+L DRF D+S+AYQ    S + L  D LQ +
Sbjct: 61  HDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQC---SGRGLSQDKLQLL 117

Query: 124 SVQEV--MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   V  MP+ T  LD P+++G+ R       RE   LD FE++ +    K R+ +  + 
Sbjct: 118 NQNFVSSMPEVTFWLDAPIELGMNRA------RERGALDRFEQEKLSFFTKVREGYETLW 171

Query: 182 RNQPDRCHIVDSAHS 196
           + +P+R   +D+  S
Sbjct: 172 KAEPERIKRLDATQS 186


>gi|269217490|ref|ZP_06161344.1| dTMP kinase [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269213111|gb|EEZ79451.1| dTMP kinase [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 210

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 116/212 (54%), Gaps = 16/212 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG +G+GKTT + LL  +L+ + +DV  TR+PGGT      R +LL  G  +   
Sbjct: 1   MFITFEGGDGSGKTTQMQLLAEWLRGRGFDVVTTRDPGGTELGRHIRKLLLHGG--DVSP 58

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AEA+++AA R  +V  V+RPAL  G I+L DR++DSS AYQG   + + L  D ++ +S
Sbjct: 59  RAEALLYAADRAHNVATVVRPALERGAIVLADRYIDSSAAYQG---AGRTLGEDEVRGLS 115

Query: 125 V---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   + +MPD T+ LDLP +          + R     D  E      HE  R+ +L  A
Sbjct: 116 LWGTEGLMPDLTVFLDLPAEA--------LASRLGGSFDRIEAAGARFHEDVRRAYLRFA 167

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
             +P+R   VD+    + +A  +   V E ++
Sbjct: 168 AAEPERWFTVDATVPRERIAETVRARVAEALE 199


>gi|320334977|ref|YP_004171688.1| Thymidylate kinase [Deinococcus maricopensis DSM 21211]
 gi|319756266|gb|ADV68023.1| Thymidylate kinase [Deinococcus maricopensis DSM 21211]
          Length = 209

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 111/206 (53%), Gaps = 11/206 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL--SCG 58
           M++GLFI+FEG EGAGK+T +  L   L        +TREPGGTP     R VLL  +  
Sbjct: 1   MSAGLFITFEGPEGAGKSTQVRALTAHLAALGVPHTLTREPGGTPFGTRVRDVLLDPTLQ 60

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
           +D      E ++++A+R   V +VIRPAL  G++++CDR+ DSS AYQG         L 
Sbjct: 61  IDPL---PEFLLYSASRAQLVTDVIRPALARGEVVICDRYFDSSLAYQGGGRGLSSELLR 117

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            +   +   + P  T +LDL   +GL RV  R         D  ER D+  H + R  FL
Sbjct: 118 RITHEATGGLTPHLTFLLDLDPSVGLGRVAAR------GQPDRLERADLDFHTRVRARFL 171

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNI 204
           D+A  +P R  ++D+    ++++ +I
Sbjct: 172 DLAAAEPARFEVLDATRPQEALSAHI 197


>gi|229542305|ref|ZP_04431365.1| thymidylate kinase [Bacillus coagulans 36D1]
 gi|229326725|gb|EEN92400.1| thymidylate kinase [Bacillus coagulans 36D1]
          Length = 217

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 115/210 (54%), Gaps = 4/210 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G+FI+ EG EGAGKTT   ++   L+   Y V +TREPGG   AE  RH++L+    E 
Sbjct: 2   KGIFITAEGPEGAGKTTITGMIAAHLKENGYPVVLTREPGGIKIAEQIRHIILNPENTEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AA+R  H+   + PAL +G+I+LCDRF+DSS AYQG         +  + +
Sbjct: 62  DARTEALLYAASRRQHLAEKVLPALEQGRIVLCDRFIDSSLAYQGYARGIGIEEVYRINQ 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++PD T+  D+  + GL R+   ++ RE   LD    + +  H K R+ F  + +
Sbjct: 122 FATGGLLPDLTLYFDVEAETGLSRIAKNHN-REVNRLDL---EAIDFHRKVREGFQILLK 177

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             P+R H +D+    + +    L  V + +
Sbjct: 178 RFPERIHAIDANKEVEYIYHTALQKVLDAI 207


>gi|262375534|ref|ZP_06068767.1| thymidylate kinase [Acinetobacter lwoffii SH145]
 gi|262309788|gb|EEY90918.1| thymidylate kinase [Acinetobacter lwoffii SH145]
          Length = 199

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 111/205 (54%), Gaps = 8/205 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FISFEG EG GKTT I  +      +  DV +TREPGGTP AE  R +LL+   +E  A
Sbjct: 1   MFISFEGTEGVGKTTLIRSIYEDFIAQGKDVILTREPGGTPMAEQIRSLLLAVNHEEAMA 60

Query: 65  -EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            + E ++  AAR  H+  VI PAL  GKI+LCDRF D+S+AYQ          L  L + 
Sbjct: 61  HDTELLLMYAARAQHLAQVILPALEAGKIVLCDRFSDASFAYQCAGRGLSETKLQLLNDH 120

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            V   MPD T  L+ P+++G+ R       RE   LD FE++ V   EK R  +  + + 
Sbjct: 121 FVAR-MPDITFWLEAPIELGMNRA------RERGALDRFEQEKVTFFEKVRAGYETLWQR 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P+R   +D+  + + V    L+ +
Sbjct: 174 HPERIKRLDATQTPEQVFEQALSYL 198


>gi|148244374|ref|YP_001219068.1| thymidylate kinase [Candidatus Vesicomyosocius okutanii HA]
 gi|166223127|sp|A5CXH6|KTHY_VESOH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|146326201|dbj|BAF61344.1| thymidylate kinase [Candidatus Vesicomyosocius okutanii HA]
          Length = 205

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 116/207 (56%), Gaps = 12/207 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ +G+EGAGK+T I  +  +L +KN +V +TREPGGT   E  R +LLS    
Sbjct: 1   MQRGKFITIDGVEGAGKSTQIDFICSYLAKKNINVVLTREPGGTKLGEKIRALLLSIDTQ 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               + E ++  AAR +H++  I PAL  G  +L DRF D+SYAYQG         +  L
Sbjct: 61  LMDNDTELLLIFAARNEHIKTKIIPALNRGDWVLSDRFTDASYAYQGGGRGLSIERIALL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACL---DYFERKDVMIHEKRRQIF 177
           ++  +Q+  PD T++LD+PV +G+ R+++R S ++   L   D+F R         R  +
Sbjct: 121 EQWVLQDFSPDVTLLLDVPVALGMLRIKSR-SRKDRIELETNDFFNRV--------RDSY 171

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNI 204
           +  ++  P+R  ++D++ + +     I
Sbjct: 172 IKRSKQFPERIKLIDASQTLKETTQQI 198


>gi|59798343|sp|Q73FS2|KTHY_WOLPM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
          Length = 196

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 111/189 (58%), Gaps = 15/189 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQ--RKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKTT   LL    +  R   +V +TREPGGT  AE  R VLL+  +D  
Sbjct: 1   MFITFEGIDGSGKTTQSKLLANHFKQIRGENNVVLTREPGGTNFAEKVRGVLLTNNIDSI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +H++ +I PAL EGKI++CDRF+DS+ AYQG         +  L +
Sbjct: 61  ---SELLLLISMRREHMKKLILPALAEGKIVICDRFIDSTIAYQGYGFGVDLRLIRDLHK 117

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V +GL R +++         + +E  DV  + K R+ F +IA 
Sbjct: 118 L-VEIKYPDITFILDIDVKVGLNRAKDK---------NKYEEMDVNFYNKVRKGFQEIAI 167

Query: 183 NQPDRCHIV 191
            +P RC ++
Sbjct: 168 KEPVRCSVI 176


>gi|224369769|ref|YP_002603933.1| Tmk [Desulfobacterium autotrophicum HRM2]
 gi|259494266|sp|C0QI33|KTHY_DESAH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|223692486|gb|ACN15769.1| Tmk [Desulfobacterium autotrophicum HRM2]
          Length = 227

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 110/204 (53%), Gaps = 3/204 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EGIEG+GKTT I  L   L +  Y+  VTREPG T   +  R +LL  G      
Sbjct: 1   MFITLEGIEGSGKTTQIKPLVDCLGQNGYEAVVTREPGATVIGKKIRAILLDPGNSGMSD 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E  ++ A R  H+  VI PAL  GK ++CDRF D++  YQG         +D +  + 
Sbjct: 61  LCELFLYGADRAQHLSEVIIPALGAGKTVVCDRFTDATTVYQGAARGISKELIDIIHSVV 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLDIAR 182
           V+++ PD TI+ DL  + GL R     +  E   LD   FER+ +  HE+ RQ +L +A 
Sbjct: 121 VKDLCPDLTILFDLDPETGLARTVKALTDGERT-LDESRFERETLEFHERVRQGYLALAA 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILN 206
            + DR  +VD+  + + V T I++
Sbjct: 180 AEQDRFLVVDARGTQEQVFTEIVS 203


>gi|58584408|ref|YP_197981.1| thymidylate kinase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|75498064|sp|Q5GTD5|KTHY_WOLTR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|58418724|gb|AAW70739.1| Thymidylate kinase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 205

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 111/189 (58%), Gaps = 15/189 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKT    LL  + ++     ++ +TREPGGT  AE  R +LL   +D  
Sbjct: 1   MFITFEGIDGSGKTIQSELLANYFKQIHGENNMVLTREPGGTDFAEKVRGILLKDSIDPV 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +HV+ VI PAL +GKI++CDRF+DS+ AYQG         +  L +
Sbjct: 61  ---SELLLLISMRYEHVKKVILPALKKGKIVICDRFIDSTIAYQGYGLGVDLELIRDLHK 117

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V IGL R  ++         + +E  ++  + K R+ F +IA 
Sbjct: 118 L-VKIKYPDTTFILDIDVQIGLSRAMDK---------NKYEEMNISFYNKVRKGFQEIAI 167

Query: 183 NQPDRCHIV 191
           N+PDRC I+
Sbjct: 168 NEPDRCSII 176


>gi|99034767|ref|ZP_01314692.1| hypothetical protein Wendoof_01000490 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 196

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 112/194 (57%), Gaps = 15/194 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQ--RKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKTT   LL    +  R   +V +TREPGGT  AE  R VLL+  +D  
Sbjct: 1   MFITFEGIDGSGKTTQSKLLANHFKQIRGENNVVLTREPGGTNFAEKVRGVLLTNNIDSI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +H++ +I PAL EGKI++CDRF+DS+ AYQG         +  L +
Sbjct: 61  ---SELLLLISMRREHMKKLILPALAEGKIVICDRFIDSTIAYQGYGFGVDLGLIRDLHK 117

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V +GL R +++         + +E  DV  + K R+ F +IA 
Sbjct: 118 L-VEIKYPDITFILDIDVKVGLNRAKDK---------NKYEEMDVNFYNKVRKGFQEIAI 167

Query: 183 NQPDRCHIVDSAHS 196
            +P RC ++    +
Sbjct: 168 KEPVRCSVITGIET 181


>gi|307265699|ref|ZP_07547252.1| thymidylate kinase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919343|gb|EFN49564.1| thymidylate kinase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 203

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGI+G GKTT I  L+ +L ++ Y++ V REPGGT   E  R +LL    +   
Sbjct: 3   GKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKVGEKVRDILLDKN-NFIS 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++A++R   VE  I PAL +G+I++ DRF+DSSY YQG         +  + EI
Sbjct: 62  PVTEMLLYASSRAQLVEEKILPALEKGQIVILDRFVDSSYVYQGYARGLGIEKVKLVNEI 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD TI +D+  +  +KR   R +       D  E++    H+K R+ ++ + + 
Sbjct: 122 ATMGILPDVTIYIDITPEEAMKRRGKREA-------DRLEKESWEFHKKVREGYIKLVKE 174

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P R   +D       V  +I+++V
Sbjct: 175 FPKRFVFIDGMQELMKVHQDIIDVV 199


>gi|326389200|ref|ZP_08210768.1| thymidylate kinase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994563|gb|EGD52987.1| thymidylate kinase [Thermoanaerobacter ethanolicus JW 200]
          Length = 203

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGI+G GKTT I  L+ +L ++ Y++ V REPGGT   E  R +LL    +   
Sbjct: 3   GKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKVGEKVRDILLDKN-NFIS 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E +++A++R   VE  I PAL +G+I++ DRF+DSSY YQG         +  + EI
Sbjct: 62  PVTEMLLYASSRAQLVEEKILPALEKGQIVILDRFVDSSYVYQGYARGLGIEKVKLVNEI 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD TI +D+  +  +KR   R +       D  E++    H+K R+ ++ + + 
Sbjct: 122 ATMGILPDVTIYIDITPEEAMKRRGKREA-------DRLEKESWGFHKKVREGYIKLVKE 174

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P R   +D       V  +I+++V
Sbjct: 175 FPKRFVFIDGMQELMKVHQDIIDVV 199


>gi|170017863|ref|YP_001728782.1| thymidylate kinase [Leuconostoc citreum KM20]
 gi|238688934|sp|B1MVT4|KTHY_LEUCK RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|169804720|gb|ACA83338.1| Thymidylate kinase [Leuconostoc citreum KM20]
          Length = 214

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 122/220 (55%), Gaps = 13/220 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPGGTPAAEAARHVLLSCGV 59
           M   LFI+FEG EGAGKT+ +  L   L+    D  VT REPGG P +EA R +L     
Sbjct: 1   MTRPLFITFEGPEGAGKTSVLEALVSELKPILGDQLVTTREPGGNPISEAIRQILQPEDD 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +      EA+++AAAR  H+   I PAL  GK+L+ DR++DSS AYQG     + L +D+
Sbjct: 61  NGMDDRTEALLYAAARRQHIVETILPALSAGKVLISDRYVDSSLAYQG---GGRDLGVDN 117

Query: 120 LQEI---SVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQ 175
           + +I   ++  ++PD TI  D+P ++GL RV  NR        +D  +++ +  H++ R 
Sbjct: 118 IWQINQFAIDGLLPDLTIYFDVPSELGLSRVMANR-----QGKIDRLDKESLSFHQRVRT 172

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
            +L++  +  DR  I+D+      V ++   ++ E +  R
Sbjct: 173 TYLELQHDFSDRIKIIDATQPLTDVISDTRALLQEALNSR 212


>gi|42521048|ref|NP_966963.1| thymidylate kinase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410789|gb|AAS14897.1| thymidylate kinase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 212

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 112/194 (57%), Gaps = 15/194 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQ--RKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKTT   LL    +  R   +V +TREPGGT  AE  R VLL+  +D  
Sbjct: 17  MFITFEGIDGSGKTTQSKLLANHFKQIRGENNVVLTREPGGTNFAEKVRGVLLTNNIDSI 76

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +H++ +I PAL EGKI++CDRF+DS+ AYQG         +  L +
Sbjct: 77  ---SELLLLISMRREHMKKLILPALAEGKIVICDRFIDSTIAYQGYGFGVDLRLIRDLHK 133

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V +GL R +++         + +E  DV  + K R+ F +IA 
Sbjct: 134 L-VEIKYPDITFILDIDVKVGLNRAKDK---------NKYEEMDVNFYNKVRKGFQEIAI 183

Query: 183 NQPDRCHIVDSAHS 196
            +P RC ++    +
Sbjct: 184 KEPVRCSVITGIET 197


>gi|326316632|ref|YP_004234304.1| thymidylate kinase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373468|gb|ADX45737.1| thymidylate kinase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 221

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 117/213 (54%), Gaps = 17/213 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGI+GAGK++HI  +   L+R    V VTREPGGTP AE  R +LL+  +D   
Sbjct: 5   GWFITFEGIDGAGKSSHIEAVAEALRRGGRTVTVTREPGGTPLAETLRALLLNEAMD--- 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  E++V  A R DH+ +VI PAL+ G+++LCDRF D+++AYQG         L  L+ I
Sbjct: 62  ALTESLVVFAGRRDHLRSVIAPALVRGEVVLCDRFTDATFAYQGAGRGFDRAVLAQLERI 121

Query: 124 S---VQE-----VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ 175
           +   +QE     + P  T+  DL  D+   R++       +   D FE + V    +  Q
Sbjct: 122 TQSGLQEGSDAILHPHLTLWFDLAPDVAAARLEG------ARAPDRFEAQPVEFFRRVAQ 175

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
            + D A   P R   +D+    ++V   +++I+
Sbjct: 176 GYADRAAADPGRFARLDADQPREAVRAQLMDIL 208


>gi|257091001|ref|ZP_05585362.1| thymidylate kinase [Enterococcus faecalis CH188]
 gi|312902587|ref|ZP_07761793.1| thymidylate kinase [Enterococcus faecalis TX0635]
 gi|256999813|gb|EEU86333.1| thymidylate kinase [Enterococcus faecalis CH188]
 gi|310634257|gb|EFQ17540.1| thymidylate kinase [Enterococcus faecalis TX0635]
 gi|315162072|gb|EFU06089.1| thymidylate kinase [Enterococcus faecalis TX0645]
 gi|315579603|gb|EFU91794.1| thymidylate kinase [Enterococcus faecalis TX0630]
          Length = 212

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG +GAGKT+ +  + +R  +     +  TREPGG P AE  R V+L    D  
Sbjct: 3   GIFITFEGPDGAGKTSVLKEVSERLAKESKRKIVTTREPGGIPIAEKIRTVILDPRNDRM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF+DSS AYQG       + + S+  
Sbjct: 63  DERTEALLYAAARRQHLVEKILPALEAGHLVLCDRFVDSSLAYQGAGRRIGIVPIASINA 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + + V PD TI LD+  D GL+R+Q NR     +  +D  + + +  H++ R  +L +A
Sbjct: 123 FATEGVSPDFTIYLDVDSDTGLRRIQENR-----TQQIDRLDSEGLEFHQRVRHEYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              P R   +D+  S + V       + E
Sbjct: 178 EENPQRIKKIDARMSLELVVEATYQAIIE 206


>gi|20806623|ref|NP_621794.1| thymidylate kinase [Thermoanaerobacter tengcongensis MB4]
 gi|23821773|sp|Q8RDE6|KTHY_THETN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|20515069|gb|AAM23398.1| Thymidylate kinase [Thermoanaerobacter tengcongensis MB4]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 123/213 (57%), Gaps = 14/213 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGI+G GKTT + LL+  L+++ YD+ V REPGGT   E  R +LL      F 
Sbjct: 3   GKFISFEGIDGCGKTTQVKLLEEHLKKEGYDLLVLREPGGTRVGEKVREILLDRENLIFP 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ-- 121
              E +++A++R   VE  I PAL +G++++ DRF+DSSY YQG    ++ L L+ ++  
Sbjct: 63  V-TEMLLYASSRAQLVEEKILPALSKGQMVIVDRFIDSSYVYQG---YARGLGLEKVKIV 118

Query: 122 -EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            EI+ + + PD T+ +D+  +  +KR Q + +       D  E +D   H+K R+ +L +
Sbjct: 119 NEIATKGLFPDITVYIDITPEEAIKRRQGKKA-------DRLEGEDYEFHKKVREGYLRL 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            ++ P+R  ++D      +V   ++  V E ++
Sbjct: 172 VKDFPERFILIDGMQEVLAVHKMVVKAVEEYLK 204


>gi|225677081|ref|ZP_03788085.1| thymidylate kinase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590877|gb|EEH12100.1| thymidylate kinase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 212

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 112/194 (57%), Gaps = 15/194 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQ--RKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKTT   LL    +  R   +V +TREPGGT  AE  R VLL+  +D  
Sbjct: 17  MFITFEGIDGSGKTTQSKLLANHFKQIRGENNVVLTREPGGTNFAEKVRGVLLTNNIDSI 76

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +H++ +I PAL EGKI++CDRF+DS+ AYQG         +  L +
Sbjct: 77  ---SELLLLISMRREHMKKLILPALAEGKIVICDRFIDSTIAYQGYGFGVDLGLIGDLHK 133

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V +GL R +++         + +E  DV  + K R+ F +IA 
Sbjct: 134 L-VEIECPDITFILDIDVKVGLNRAKDK---------NKYEEMDVNFYNKVRKGFQEIAI 183

Query: 183 NQPDRCHIVDSAHS 196
            +P RC ++    +
Sbjct: 184 KEPVRCSVITGIET 197


>gi|162446997|ref|YP_001620129.1| thymidylate kinase [Acholeplasma laidlawii PG-8A]
 gi|189028826|sp|A9NEH3|KTHY_ACHLI RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|161985104|gb|ABX80753.1| thymidylate kinase [Acholeplasma laidlawii PG-8A]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/206 (39%), Positives = 118/206 (57%), Gaps = 13/206 (6%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EG+GKTT I  LK  L  K YDV  TREPGG+  AE  R VLL     E  A
Sbjct: 1   MFITFEGGEGSGKTTLIEKLKHTLLEKKYDVLTTREPGGSKVAEKIRSVLLDNKNTEITA 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAA+R  H++ VI P L   K++LCDR++DSSYAYQ    +    F+ S+   +
Sbjct: 61  HTEALLFAASRAQHLDEVIIPNL--DKVILCDRYIDSSYAYQAFGRNLGMEFVQSINSYA 118

Query: 125 VQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++  +PD T  +DL    G+ RV +NR  L ++  LD   +     H+K R+ ++ I+  
Sbjct: 119 LK-YLPDLTFYIDLDPKTGIDRVKKNR--LHKTDRLDMEVQ---TFHQKVREGYIRISEM 172

Query: 184 QPDRCHIVDSAHS----FQSVATNIL 205
             +R  ++D   S    +Q +  NIL
Sbjct: 173 FKERIVVIDGNQSIDAIYQIIMDNIL 198


>gi|254462931|ref|ZP_05076347.1| thymidylate kinase [Rhodobacterales bacterium HTCC2083]
 gi|206679520|gb|EDZ44007.1| thymidylate kinase [Rhodobacteraceae bacterium HTCC2083]
          Length = 209

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FISFEGI+G+GK+T    L   L+   ++V +TREPGG+  AE  R ++L    D +
Sbjct: 5   TGRFISFEGIDGSGKSTQAKRLAAALEADGFEVVLTREPGGSAGAEEIRALVLQGEPDRW 64

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE E ++F AAR DH+E  I PAL  GK+++CDRF DS+  YQG         +D L  
Sbjct: 65  SAETEILLFTAARRDHMERTILPALAAGKVVICDRFADSTRMYQGLSRGDLRALVDQLHA 124

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + +    PD T++ D+  D+   R   R S+        FE     + +  R  FL++A 
Sbjct: 125 LMIGR-EPDLTLLFDMDPDVSHARAVERDSIDS-----RFENFGASLQKAMRSGFLELAA 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
             P R  IV++A    ++A + L+++
Sbjct: 179 AAPKRFRIVNAARDIDAIAADTLSVI 204


>gi|261403890|ref|YP_003240131.1| thymidylate kinase [Paenibacillus sp. Y412MC10]
 gi|261280353|gb|ACX62324.1| thymidylate kinase [Paenibacillus sp. Y412MC10]
          Length = 214

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 107/192 (55%), Gaps = 4/192 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFI+ EG EG+GKTT +  L  F+Q  +    +TREPGG   AE  R ++L        A
Sbjct: 7   LFITVEGGEGSGKTTMMGRLAAFMQNHSIPYLITREPGGIDIAEKIRSIILDPEHTAMDA 66

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA+++AAAR  H+   + PAL +G  +LCDRF+DSS  YQG         + S+ + +
Sbjct: 67  RTEALLYAAARRQHLVEKVEPALRQGLTVLCDRFVDSSLVYQGYARGLGMEEVWSINQFA 126

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++ D+   IGL R+      RE   LD    +++  HEK R+ +L +A   
Sbjct: 127 IDTRMPDLTLLFDIEPRIGLSRIAANAE-REWNRLDM---ENLTFHEKVREGYLLVAERN 182

Query: 185 PDRCHIVDSAHS 196
           PDR  IVD++ +
Sbjct: 183 PDRIRIVDASKT 194


>gi|32034665|ref|ZP_00134803.1| COG0125: Thymidylate kinase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209279|ref|YP_001054504.1| thymidylate kinase [Actinobacillus pleuropneumoniae L20]
 gi|165977254|ref|YP_001652847.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|190151172|ref|YP_001969697.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|303252694|ref|ZP_07338856.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307246746|ref|ZP_07528815.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307248888|ref|ZP_07530899.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|307255731|ref|ZP_07537534.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307257916|ref|ZP_07539670.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|307260183|ref|ZP_07541892.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|307262310|ref|ZP_07543958.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|307264521|ref|ZP_07546105.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|229487547|sp|A3N3B3|KTHY_ACTP2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|238687523|sp|B0BSY9|KTHY_ACTPJ RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|238692362|sp|B3GZ69|KTHY_ACTP7 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|126098071|gb|ABN74899.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
 gi|165877355|gb|ABY70403.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|189916303|gb|ACE62555.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|302648433|gb|EFL78627.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306852352|gb|EFM84588.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306854583|gb|EFM86775.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|306861291|gb|EFM93282.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306863563|gb|EFM95492.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306865728|gb|EFM97607.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|306867973|gb|EFM99801.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306870120|gb|EFN01880.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/208 (39%), Positives = 118/208 (56%), Gaps = 13/208 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI  EG+EGAGKTT   ++   L++   +V  TREPGGTP AE  RH++     +   
Sbjct: 3   GKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTPLAEKLRHLIKHETEEAVS 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQE 122
            +AE ++  AAR+  VENVI+PAL EGK +L DR   SS AYQ G R   +HL L++L+E
Sbjct: 63  DKAELLMLYAARIQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHL-LETLKE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR--ESACLDYFERKDVMIHEKRRQIFLDI 180
             +    PD TI LD+   +GL R + R  L   E   LD+F R         RQ +L++
Sbjct: 122 TVLGNFEPDLTIYLDIDPAVGLARARGRGELDRIEQQSLDFFYRT--------RQRYLEL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
            +N  ++  I+++  S + VA +I   V
Sbjct: 174 TQNN-EKAVIINAEQSIEQVAADIQQAV 200


>gi|320526760|ref|ZP_08027950.1| thymidylate kinase [Solobacterium moorei F0204]
 gi|320132728|gb|EFW25268.1| thymidylate kinase [Solobacterium moorei F0204]
          Length = 211

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 117/215 (54%), Gaps = 11/215 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +GLFI+FEG +G+GKTT  + +   L+   Y V  TREPGG+  AE  RHV+L     
Sbjct: 1   MKTGLFITFEGPDGSGKTTVSTAVTNMLEADGYQVRYTREPGGSNIAEQIRHVILDPKNT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E  A  EA+++AA+R  H+ + + P L +G  ++ DRF+DSS AYQG     + + +D +
Sbjct: 61  EMDARTEALLYAASRRQHLIDKVLPVLEQGVHVISDRFVDSSLAYQG---CGREIGMDEV 117

Query: 121 QEI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            EI   +++  MPD TI L +  + GLKR+      +    LD  +++ V  H++  + +
Sbjct: 118 YEINQFAIENHMPDKTIFLQIDAETGLKRIH-----KGREVLDRLDQESVEFHQRVHEGY 172

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
             +     DR  IVD+     +V      IV  L+
Sbjct: 173 QKVIEKYADRMIIVDATADVDTVIQKSYEIVKGLL 207


>gi|254479299|ref|ZP_05092640.1| thymidylate kinase [Carboxydibrachium pacificum DSM 12653]
 gi|214034774|gb|EEB75507.1| thymidylate kinase [Carboxydibrachium pacificum DSM 12653]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 123/213 (57%), Gaps = 14/213 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEGI+G GKTT + LL+  L+++ YD+ V REPGGT   E  R +LL      F 
Sbjct: 3   GKFISFEGIDGCGKTTQVKLLEEHLKKEGYDLLVLREPGGTRVGEKVREILLDRENLIFP 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ-- 121
              E +++A++R   VE  I PAL +G++++ DRF+DSSY YQG    ++ L L+ ++  
Sbjct: 63  V-TEMLLYASSRAQLVEEKILPALSKGQMVIVDRFVDSSYVYQG---YARGLGLEKVKIV 118

Query: 122 -EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            EI+ + + PD T+ +D+  +  +KR Q + +       D  E +D   H+K R+ +L +
Sbjct: 119 NEIATKGLFPDITVYIDITPEEAIKRRQGKKA-------DRLEGEDYEFHKKVREGYLRL 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            ++ P+R  ++D      +V   ++  V E ++
Sbjct: 172 VKDFPERFVLIDGMQEVLAVHKMVVKAVEEYLK 204


>gi|11991874|gb|AAG42374.1|AF294440_6 thymidylate kinase [Xanthomonas albilineans]
          Length = 226

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (54%), Gaps = 19/200 (9%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-------SCG 58
           F+S EG EGAGKTT I+ ++ +LQ + ++V +TREPGGTP AE  R +LL          
Sbjct: 11  FVSLEGGEGAGKTTAINAIRDWLQAQGHEVVLTREPGGTPLAERIRGLLLDMAPSSPETA 70

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
           V+   AE E ++  AAR  HV  VIRPAL  G  ++ DRF DSSYAYQGE       ++ 
Sbjct: 71  VERLSAETELLLVFAARAQHVREVIRPALQRGAYVVSDRFTDSSYAYQGEGRGLDRAWIA 130

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNR--YSLR-ESACLDYFERKDVMIHEKRRQ 175
            L+  +V  + P  T++LDL V IG  R   R  +  R ES   D+F+R         R 
Sbjct: 131 DLERRAVG-LQPGLTLLLDLDVQIGRARTSGRDLWPDRIESEQDDFFQRV--------RA 181

Query: 176 IFLDIARNQPDRCHIVDSAH 195
            F   A   P R  ++D++ 
Sbjct: 182 GFRQRATQDPQRFRVIDASQ 201


>gi|296116333|ref|ZP_06834949.1| dTMP kinase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977152|gb|EFG83914.1| dTMP kinase [Gluconacetobacter hansenii ATCC 23769]
          Length = 224

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 118/218 (54%), Gaps = 17/218 (7%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +GLFI+FEG EGAGK+T + LL+  L     +  +  TREPGGTP AEA R  LL  G  
Sbjct: 10  TGLFITFEGGEGAGKSTQVRLLQEHLATIMPSDRIVRTREPGGTPGAEAVRDFLL-FGEH 68

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDS 119
           +    AE ++   AR DHV+ +IRPAL  GK+++ DRF DS+ AYQG  R       LD 
Sbjct: 69  DLSLRAETLMHFGARYDHVDRLIRPALEAGKVVISDRFTDSTAAYQGYGRGMGDPAILDL 128

Query: 120 LQEISVQE-VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +  +  Q    PD T ILD+P  +  +R++ R +       D +E      H +  + F 
Sbjct: 129 IASLRQQTGARPDMTFILDVPRAMARERLRARGNR-----PDRYETAAEAFHARVAEGFA 183

Query: 179 DIARNQPDRCHIVDSAHS----FQSVATNI---LNIVW 209
            IAR +P RC  +D+A       Q+VA ++   L + W
Sbjct: 184 AIARQEPGRCITLDAAQPPDIVAQAVARHVATRLPMSW 221


>gi|239998426|ref|ZP_04718350.1| thymidylate kinase [Neisseria gonorrhoeae 35/02]
 gi|268594287|ref|ZP_06128454.1| thymidylate kinase [Neisseria gonorrhoeae 35/02]
 gi|268547676|gb|EEZ43094.1| thymidylate kinase [Neisseria gonorrhoeae 35/02]
 gi|317163711|gb|ADV07252.1| thymidylate kinase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 206

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 118/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+G GK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGVGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---AREK---DRFEQEQADFFMRVRGVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS  S   V  +I  ++
Sbjct: 178 ERYAVIDSNRSLDEVRNSIEKVL 200


>gi|157956091|gb|ABW06433.1| thymidylate kinase [Wheat blue dwarf phytoplasma]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 123/210 (58%), Gaps = 7/210 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FISFEG EGAGKTTH   L   L +K Y   +T+EPGGT   E  R++LL     +   
Sbjct: 1   MFISFEGCEGAGKTTHSRYLFEKLSKK-YSCVLTKEPGGTLFNEVIRNILLHSSNKQIDF 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAA R +H+  +I PAL + KI++CDR+LDS+ AYQG        F+ ++   +
Sbjct: 60  HTEALLFAADRAEHLSKLIIPALQQNKIVICDRYLDSTIAYQGYARGLSQDFVLNINNFA 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD-IARN 183
           +   MP+ T  LDL   IG++RV+ ++  +E   ++ F+ + +  H+K R+ +LD + ++
Sbjct: 120 I-NYMPNITFYLDLDPKIGIQRVK-QFRPKE---INSFDLQKLSFHKKVRKGYLDLLQKD 174

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           Q  R  ++D++   + +   I   + E+ Q
Sbjct: 175 QQKRIFLIDASKRLEVIYNIIEQKLKEVFQ 204


>gi|118444724|ref|YP_879227.1| thymidylate kinase [Clostridium novyi NT]
 gi|171472994|sp|A0Q3M5|KTHY_CLONN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|118135180|gb|ABK62224.1| thymidylate kinase [Clostridium novyi NT]
          Length = 205

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 118/203 (58%), Gaps = 10/203 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN G FI+ EG EG+GKTT + +++++L   N +   TREPGG   +E  R V+L+    
Sbjct: 1   MNKGAFITLEGPEGSGKTTIVKMIEKYLSENNIEYISTREPGGINISEQIRDVILNKDNV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
              A  EA+++ A+R  H+   + PA+ EGK+++CDRF+DSS AYQG    ++ + +D  
Sbjct: 61  AMDARTEALLYVASRRQHLAERVIPAIKEGKVVICDRFIDSSLAYQG---YARGIGIDEV 117

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            ++ E ++   MPD T+ LD+  ++GLKR+ ++ + RE   LD  E  D   H+K R+ +
Sbjct: 118 MAINEFAIDGYMPDLTLYLDIEPEVGLKRI-SKNNEREVNRLD-LEALD--FHKKVREGY 173

Query: 178 LDIARNQPDRCHIVDSAHSFQSV 200
             +    P+R   +++      V
Sbjct: 174 FKLLEKYPNRIKKINANQPVDKV 196


>gi|325203757|gb|ADY99210.1| thymidylate kinase [Neisseria meningitidis M01-240355]
          Length = 206

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  E  R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGETLREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++LD A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRGVYLDRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS  +   V  +I  ++
Sbjct: 178 ERYAVIDSNRNLDEVRNSIEKVL 200


>gi|295698602|ref|YP_003603257.1| thymidylate kinase [Candidatus Riesia pediculicola USDA]
 gi|291157415|gb|ADD79860.1| thymidylate kinase [Candidatus Riesia pediculicola USDA]
          Length = 217

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 115/200 (57%), Gaps = 6/200 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           N G +I  EG+EG+GKTT I  +K+ L ++ +D+   REPGGTP +E  R ++     +E
Sbjct: 6   NFGRYIVVEGLEGSGKTTMIGFVKKMLIKEGFDILTVREPGGTPISEKIRKLIKKNFPEE 65

Query: 62  -FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            F  + E  +F AAR+  +EN+I P L  GK ++ DR   SSYAYQG +   +   +D +
Sbjct: 66  KFLVKTELFMFYAARIQLMENIILPNLKSGKWVIGDRNFLSSYAYQGGKYGVKDDEIDKI 125

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +I++ +  PD  I LD+  +IG+ R+      R+S+ LD  E++ +    + R  +L+I
Sbjct: 126 NKIAIGKFQPDLIIYLDVFPEIGISRIHE----RKSSKLDRIEKRSLDFFHQVRNRYLNI 181

Query: 181 ARNQPDRCHIVDSAHSFQSV 200
            +NQ +   I+D+     SV
Sbjct: 182 IKNQKE-FMIIDANQDLSSV 200


>gi|170780642|ref|YP_001708974.1| thymidylate kinase [Clavibacter michiganensis subsp. sepedonicus]
 gi|189028830|sp|B0RAE3|KTHY_CLAMS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|169155210|emb|CAQ00311.1| thymidylate kinase [Clavibacter michiganensis subsp. sepedonicus]
          Length = 211

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 116/205 (56%), Gaps = 12/205 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G+FI+ EG +G GK+T  +LL+ +L+ + ++V VTREPGG+   +  R ++L       
Sbjct: 2   TGVFITLEGGDGVGKSTQSALLREWLEEQGHEVVVTREPGGSDLGQEIREIVLHR-RGHI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R  HVE V+RPAL  G ++L DR+LDSS AYQG         +  L  
Sbjct: 61  APRAEALLYAADRAHHVETVVRPALERGAVVLQDRYLDSSVAYQGAGRVLDAAEIRDLSL 120

Query: 123 ISVQEVMPDCTIILDL---PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
            + Q ++PD T++LDL      I L   + R+   E+      ER D   HE+ RQ FL 
Sbjct: 121 WAAQGLLPDLTVLLDLDQAAARIRLDAARTRFDRLEA------ERAD--FHERVRQAFLG 172

Query: 180 IARNQPDRCHIVDSAHSFQSVATNI 204
           +A  +P+R  +VD+    + +A  I
Sbjct: 173 LAAAEPERFLVVDAGWPREVIAAEI 197


>gi|212716794|ref|ZP_03324922.1| hypothetical protein BIFCAT_01733 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660498|gb|EEB21073.1| hypothetical protein BIFCAT_01733 [Bifidobacterium catenulatum DSM
           16992]
          Length = 217

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 124/220 (56%), Gaps = 19/220 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD--- 60
           G+FISFEGI+G GKTT +  L+ +++ +  +  VTREPGGT    A R +LL  GV+   
Sbjct: 3   GIFISFEGIDGVGKTTQVERLRAYVEAQGRECVVTREPGGTVLGVAIRKLLLG-GVEGSD 61

Query: 61  -EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            +    AEA++FAA R  HV  VIRPAL  G +++ DR+LDSS AYQ      + L    
Sbjct: 62  ADIAPRAEALLFAADRAQHVAEVIRPALERGAVVITDRYLDSSLAYQA---GGRELTAGE 118

Query: 120 LQEISVQ---EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           ++++S+    E++P+ T +LDL       R+Q+     ESA  D+  R         RQ 
Sbjct: 119 IRDLSMWATCELLPNRTYLLDLDPVQSHARLQHDEDRMESAGNDFQRRT--------RQA 170

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           FLD+A+ +  R  ++D++ S   V ++I +   ++ Q + 
Sbjct: 171 FLDLAKAESQRFRVIDASQSIDEVWSHIQDDFAQISQTKT 210


>gi|88856427|ref|ZP_01131085.1| thymidylate kinase [marine actinobacterium PHSC20C1]
 gi|88814294|gb|EAR24158.1| thymidylate kinase [marine actinobacterium PHSC20C1]
          Length = 209

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 116/207 (56%), Gaps = 18/207 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLFI+ EG +GAGKTT   LL  +L+   + V VTREPGGT      R ++L    D   
Sbjct: 3   GLFITLEGGDGAGKTTQSKLLVHWLEEAGHTVVVTREPGGTDLGVELREIVLHRRGD-MD 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             AEA+++AA R  H+  V+RPAL  G I++ DR++DSS AYQG   + + L  + ++++
Sbjct: 62  PRAEALIYAADRAHHIATVVRPALERGDIVVQDRYIDSSEAYQG---AGRVLGAEEVRDL 118

Query: 124 SV---QEVMPDCTIILDLPVDIGLKRV---QNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           S+   Q ++PD T++LDL    G KR+   + RY        D  E +    H + R  F
Sbjct: 119 SLWATQSLLPDVTVLLDLDPTDGRKRLDSARTRY--------DRLEAEKQEFHTRVRDAF 170

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNI 204
           L+ A  +PDR  +VD+A     +A  I
Sbjct: 171 LERAAKEPDRILVVDAARDVAEIAAAI 197


>gi|256833407|ref|YP_003162134.1| thymidylate kinase [Jonesia denitrificans DSM 20603]
 gi|256686938|gb|ACV09831.1| thymidylate kinase [Jonesia denitrificans DSM 20603]
          Length = 221

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 117/217 (53%), Gaps = 11/217 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           ++GLF++FEG +G+GKTT   L  ++L     +D  +TREPGGT   +  R +LL    D
Sbjct: 8   HAGLFLTFEGGDGSGKTTQARLAAQWLSDTYAHDALLTREPGGTELGQHIRQLLLHG--D 65

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           + G  AEA+++AA R  HV  VIRPAL  G+ ++CDR+ DSS AYQG   +     +  L
Sbjct: 66  DMGPRAEALLYAADRSHHVHTVIRPALSLGRTVVCDRYFDSSIAYQGGGRTLTPKTIRDL 125

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +V  ++PD T+++D+P  +G  R       RE    D  ER     H+     +  +
Sbjct: 126 SLWAVDGLIPDLTVLIDVPARVGAAR-------REGEP-DRLERAGDDFHDTTHATYRHL 177

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
           A  +P+R  IVD   +   VA  +   + + +  RV+
Sbjct: 178 AEQEPERWVIVDGIGTIDEVAGRVRAALVDRLGARVT 214


>gi|163847788|ref|YP_001635832.1| dTMP kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222525656|ref|YP_002570127.1| dTMP kinase [Chloroflexus sp. Y-400-fl]
 gi|163669077|gb|ABY35443.1| dTMP kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222449535|gb|ACM53801.1| dTMP kinase [Chloroflexus sp. Y-400-fl]
          Length = 226

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 121/230 (52%), Gaps = 12/230 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEG EGAGK+T    L   LQ   Y   +TREPGGT  +E  R +L+     
Sbjct: 1   MKQGFFITFEGPEGAGKSTQARRLYERLQSIGYPTILTREPGGTRISELIRRILVDLRHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     E ++F+AAR   V  +IRP L  G I++CDR+ DS++AYQG         L ++
Sbjct: 61  EMAPTTEILLFSAARAQLVSELIRPYLATGGIVVCDRYADSTFAYQGYGLGRDLEELRTI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACL-----DYFERKDVMIHEKRRQ 175
            +I+   + PD T+ L + V++GL+R +      E   +     +  + +D+  H++  Q
Sbjct: 121 TDIATGGLKPDLTLYLRIDVEVGLQRKRASRERIEPGSVQPPEWNRLDARDLAYHQRVAQ 180

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR---VSPLSSK 222
            F ++   +P+R + +D+      +A  I    W++V  R   V PL+++
Sbjct: 181 GFNELMAQEPERWYALDADQPVDELAEQI----WQVVMARLAQVMPLAAQ 226


>gi|323140332|ref|ZP_08075264.1| dTMP kinase [Phascolarctobacterium sp. YIT 12067]
 gi|322415190|gb|EFY05977.1| dTMP kinase [Phascolarctobacterium sp. YIT 12067]
          Length = 211

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 117/213 (54%), Gaps = 12/213 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGI+GAGKTT   L  + L+ + YDV  +REPGGT  AE  R ++L   +    
Sbjct: 3   GFFITFEGIDGAGKTTQQHLAAQALREQGYDVLESREPGGTQLAEKVRALVLDPELP-LT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG---ERDSSQHLFLDSL 120
              + +++ AAR +HV+ ++RPAL  GKI++CDRF DS+  YQG    +   +   L  L
Sbjct: 62  TATQTLLYLAARSEHVDKLLRPALEAGKIIICDRFNDSTLVYQGLAQGKAPEEIAQLRRL 121

Query: 121 QEISVQEVMPDCTIILDL-PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
              +   + PD T++ D  P ++ L R Q R         D +E++ +   ++ R  FL 
Sbjct: 122 GAFATGGLEPDLTLVFDADPAEL-LARRQQR------GVQDRYEQQGLEFQQRLRAGFLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +A  +P R  ++D+  + Q V   +L ++  ++
Sbjct: 175 LAEAEPQRLQVIDALGTQQEVTAKVLQVIGRVI 207


>gi|29840268|ref|NP_829374.1| thymidylate kinase [Chlamydophila caviae GPIC]
 gi|34222665|sp|Q823B7|KTHY_CHLCV RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|29834616|gb|AAP05252.1| thymidylate kinase [Chlamydophila caviae GPIC]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 107/209 (51%), Gaps = 8/209 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI  EG EG+GK++   LLK  L  +   V  TREPGG+P  E  R ++L         
Sbjct: 1   MFIVIEGCEGSGKSSLTELLKDRLIAEGKAVVATREPGGSPLGERVRDLILEPSTPSISP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL--QE 122
             E  +F AAR +H+   I PAL  G I++CDRF DS+  YQG  +     ++ SL    
Sbjct: 61  YTELFLFLAARAEHITKKIFPALESGNIVICDRFHDSTIVYQGIAEGLGKEYVTSLCHHV 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           +  ++ +PD T +LD+P D GL+R Q + S      LD FE K +  H K R+ FL +A 
Sbjct: 121 VGEKKFLPDLTCLLDIPADEGLRRKQQQKS------LDKFEDKPLAYHTKIREGFLSLAE 174

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWEL 211
             P+   I+D     +     ++    EL
Sbjct: 175 AHPNSYLILDGRQPLEESLNKVMTAYTEL 203


>gi|254361189|ref|ZP_04977333.1| dTMP kinase [Mannheimia haemolytica PHL213]
 gi|261492947|ref|ZP_05989492.1| dTMP kinase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495090|ref|ZP_05991556.1| dTMP kinase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153092680|gb|EDN73729.1| dTMP kinase [Mannheimia haemolytica PHL213]
 gi|261309256|gb|EEY10493.1| dTMP kinase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311399|gb|EEY12557.1| dTMP kinase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 206

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 119/209 (56%), Gaps = 14/209 (6%)

Query: 4   GLFISFEGIEGAGKTT-HISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FI  EG+EGAGKTT H  +LK   Q    DV +TREPGGTP AE  RH++     +  
Sbjct: 3   GKFIVIEGLEGAGKTTAHQVILKELEQAGINDVVMTREPGGTPLAEKLRHLIKHETEEAI 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQ 121
             +AE ++  AAR+  VENVI+PAL EGK +L DR   SS AYQ G R   +HL L++L+
Sbjct: 63  NDKAELLMLYAARVQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRKLDRHL-LETLK 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR--ESACLDYFERKDVMIHEKRRQIFLD 179
           E  +    PD TI LDL   IGL+R + R  L   E   LD+F R         R+ +L+
Sbjct: 122 ESVLGTFEPDLTIYLDLDPVIGLERARGRGELDRIEQQSLDFFYRT--------RERYLE 173

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + ++  D+  I+++    + V  +I  ++
Sbjct: 174 LTQHN-DKAVIINAEQPIEQVTADIQQVI 201


>gi|330444525|ref|YP_004377511.1| thymidylate kinase [Chlamydophila pecorum E58]
 gi|328807635|gb|AEB41808.1| thymidylate kinase [Chlamydophila pecorum E58]
          Length = 206

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (51%), Gaps = 10/205 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI  EG EGAGKT+   +L + L  +   + +TREPGG P  E  R ++L     +   
Sbjct: 1   MFIVLEGGEGAGKTSLAEMLHQKLVSEGRSIVMTREPGGCPLGERIRELILQASETKVSQ 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL--QE 122
             E  +F A R  H++  I PAL  G I+LC+RF DS+  YQG  +     F+  L  Q 
Sbjct: 61  YTELFLFLATRAQHIQETIIPALERGDIVLCERFHDSTIVYQGIAEGLGMSFVSDLCYQA 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKR-VQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           I  +  +PD  ++LD+P +IGL R VQ +        LD FE+  +  HE  R  FL +A
Sbjct: 121 IGPKPFLPDLVVLLDVPAEIGLSRKVQQK-------TLDKFEKNPLSYHEAIRSGFLALA 173

Query: 182 RNQPDRCHIVDSAHSFQSVATNILN 206
              PDR  I+D+  S +     +L 
Sbjct: 174 NANPDRYLILDARQSLEESVKKVLQ 198


>gi|29377238|ref|NP_816392.1| thymidylate kinase [Enterococcus faecalis V583]
 gi|227554247|ref|ZP_03984294.1| thymidylate kinase [Enterococcus faecalis HH22]
 gi|229549121|ref|ZP_04437846.1| thymidylate kinase [Enterococcus faecalis ATCC 29200]
 gi|255971839|ref|ZP_05422425.1| thymidylate kinase [Enterococcus faecalis T1]
 gi|255974836|ref|ZP_05425422.1| thymidylate kinase [Enterococcus faecalis T2]
 gi|256763385|ref|ZP_05503965.1| thymidylate kinase [Enterococcus faecalis T3]
 gi|256854059|ref|ZP_05559424.1| thymidylate kinase [Enterococcus faecalis T8]
 gi|256957990|ref|ZP_05562161.1| thymidylate kinase [Enterococcus faecalis DS5]
 gi|256960991|ref|ZP_05565162.1| thymidylate kinase [Enterococcus faecalis Merz96]
 gi|256963867|ref|ZP_05568038.1| thymidylate kinase [Enterococcus faecalis HIP11704]
 gi|257079927|ref|ZP_05574288.1| thymidylate kinase [Enterococcus faecalis JH1]
 gi|257081675|ref|ZP_05576036.1| thymidylate kinase [Enterococcus faecalis E1Sol]
 gi|257084272|ref|ZP_05578633.1| thymidylate kinase [Enterococcus faecalis Fly1]
 gi|257087729|ref|ZP_05582090.1| thymidylate kinase [Enterococcus faecalis D6]
 gi|257416932|ref|ZP_05593926.1| thymidylate kinase [Enterococcus faecalis AR01/DG]
 gi|257420151|ref|ZP_05597145.1| thymidylate kinase [Enterococcus faecalis T11]
 gi|257421627|ref|ZP_05598617.1| thymidylate kinase [Enterococcus faecalis X98]
 gi|293384623|ref|ZP_06630488.1| dTMP kinase [Enterococcus faecalis R712]
 gi|293386762|ref|ZP_06631333.1| dTMP kinase [Enterococcus faecalis S613]
 gi|294779714|ref|ZP_06745102.1| dTMP kinase [Enterococcus faecalis PC1.1]
 gi|300860317|ref|ZP_07106404.1| dTMP kinase [Enterococcus faecalis TUSoD Ef11]
 gi|307269207|ref|ZP_07550561.1| thymidylate kinase [Enterococcus faecalis TX4248]
 gi|307271815|ref|ZP_07553086.1| thymidylate kinase [Enterococcus faecalis TX0855]
 gi|307277000|ref|ZP_07558110.1| thymidylate kinase [Enterococcus faecalis TX2134]
 gi|307278693|ref|ZP_07559761.1| thymidylate kinase [Enterococcus faecalis TX0860]
 gi|307290232|ref|ZP_07570148.1| thymidylate kinase [Enterococcus faecalis TX0411]
 gi|312900123|ref|ZP_07759439.1| thymidylate kinase [Enterococcus faecalis TX0470]
 gi|312906447|ref|ZP_07765455.1| thymidylate kinase [Enterococcus faecalis DAPTO 512]
 gi|312951938|ref|ZP_07770826.1| thymidylate kinase [Enterococcus faecalis TX0102]
 gi|312979395|ref|ZP_07791083.1| thymidylate kinase [Enterococcus faecalis DAPTO 516]
 gi|46576515|sp|Q830L6|KTHY_ENTFA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|29344704|gb|AAO82462.1| thymidylate kinase [Enterococcus faecalis V583]
 gi|227176607|gb|EEI57579.1| thymidylate kinase [Enterococcus faecalis HH22]
 gi|229305746|gb|EEN71742.1| thymidylate kinase [Enterococcus faecalis ATCC 29200]
 gi|255962857|gb|EET95333.1| thymidylate kinase [Enterococcus faecalis T1]
 gi|255967708|gb|EET98330.1| thymidylate kinase [Enterococcus faecalis T2]
 gi|256684636|gb|EEU24331.1| thymidylate kinase [Enterococcus faecalis T3]
 gi|256711002|gb|EEU26045.1| thymidylate kinase [Enterococcus faecalis T8]
 gi|256948486|gb|EEU65118.1| thymidylate kinase [Enterococcus faecalis DS5]
 gi|256951487|gb|EEU68119.1| thymidylate kinase [Enterococcus faecalis Merz96]
 gi|256954363|gb|EEU70995.1| thymidylate kinase [Enterococcus faecalis HIP11704]
 gi|256987957|gb|EEU75259.1| thymidylate kinase [Enterococcus faecalis JH1]
 gi|256989705|gb|EEU77007.1| thymidylate kinase [Enterococcus faecalis E1Sol]
 gi|256992302|gb|EEU79604.1| thymidylate kinase [Enterococcus faecalis Fly1]
 gi|256995759|gb|EEU83061.1| thymidylate kinase [Enterococcus faecalis D6]
 gi|257158760|gb|EEU88720.1| thymidylate kinase [Enterococcus faecalis ARO1/DG]
 gi|257161979|gb|EEU91939.1| thymidylate kinase [Enterococcus faecalis T11]
 gi|257163451|gb|EEU93411.1| thymidylate kinase [Enterococcus faecalis X98]
 gi|291078081|gb|EFE15445.1| dTMP kinase [Enterococcus faecalis R712]
 gi|291083765|gb|EFE20728.1| dTMP kinase [Enterococcus faecalis S613]
 gi|294453205|gb|EFG21619.1| dTMP kinase [Enterococcus faecalis PC1.1]
 gi|300849356|gb|EFK77106.1| dTMP kinase [Enterococcus faecalis TUSoD Ef11]
 gi|306498653|gb|EFM68154.1| thymidylate kinase [Enterococcus faecalis TX0411]
 gi|306504633|gb|EFM73835.1| thymidylate kinase [Enterococcus faecalis TX0860]
 gi|306506423|gb|EFM75583.1| thymidylate kinase [Enterococcus faecalis TX2134]
 gi|306511693|gb|EFM80692.1| thymidylate kinase [Enterococcus faecalis TX0855]
 gi|306514426|gb|EFM82987.1| thymidylate kinase [Enterococcus faecalis TX4248]
 gi|310627601|gb|EFQ10884.1| thymidylate kinase [Enterococcus faecalis DAPTO 512]
 gi|310630127|gb|EFQ13410.1| thymidylate kinase [Enterococcus faecalis TX0102]
 gi|311287766|gb|EFQ66322.1| thymidylate kinase [Enterococcus faecalis DAPTO 516]
 gi|311292758|gb|EFQ71314.1| thymidylate kinase [Enterococcus faecalis TX0470]
 gi|315025470|gb|EFT37402.1| thymidylate kinase [Enterococcus faecalis TX2137]
 gi|315030416|gb|EFT42348.1| thymidylate kinase [Enterococcus faecalis TX4000]
 gi|315035135|gb|EFT47067.1| thymidylate kinase [Enterococcus faecalis TX0027]
 gi|315148725|gb|EFT92741.1| thymidylate kinase [Enterococcus faecalis TX4244]
 gi|315151798|gb|EFT95814.1| thymidylate kinase [Enterococcus faecalis TX0012]
 gi|315154273|gb|EFT98289.1| thymidylate kinase [Enterococcus faecalis TX0031]
 gi|315155624|gb|EFT99640.1| thymidylate kinase [Enterococcus faecalis TX0043]
 gi|315159635|gb|EFU03652.1| thymidylate kinase [Enterococcus faecalis TX0312]
 gi|315168745|gb|EFU12762.1| thymidylate kinase [Enterococcus faecalis TX1341]
 gi|315170439|gb|EFU14456.1| thymidylate kinase [Enterococcus faecalis TX1342]
 gi|315173504|gb|EFU17521.1| thymidylate kinase [Enterococcus faecalis TX1346]
 gi|315573802|gb|EFU85993.1| thymidylate kinase [Enterococcus faecalis TX0309B]
 gi|315580314|gb|EFU92505.1| thymidylate kinase [Enterococcus faecalis TX0309A]
 gi|323481685|gb|ADX81124.1| thymidylate kinase [Enterococcus faecalis 62]
 gi|327535978|gb|AEA94812.1| thymidylate kinase [Enterococcus faecalis OG1RF]
 gi|329572901|gb|EGG54522.1| dTMP kinase [Enterococcus faecalis TX1467]
          Length = 212

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 112/209 (53%), Gaps = 7/209 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG +GAGKT+ +  + +R  +     +  TREPGG P AE  R V+L    D  
Sbjct: 3   GIFITFEGPDGAGKTSVLKEVSERLAKESKRKIVTTREPGGIPIAEKIRTVILDPRNDRM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF+DSS AYQG         + S+  
Sbjct: 63  DERTEALLYAAARRQHLVEKILPALEAGHLVLCDRFVDSSLAYQGAGRRIGIAPIASINA 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + + V PD TI LD+  D GL+R+Q NR     +  +D  + + +  H++ R  +L +A
Sbjct: 123 FATEGVSPDFTIYLDVDSDTGLRRIQENR-----TQQIDRLDSEGLEFHQRVRHEYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              P R   +D+  S + V       + E
Sbjct: 178 EENPQRIKKIDARMSLELVVEATYQAIIE 206


>gi|314937311|ref|ZP_07844653.1| dTMP kinase [Staphylococcus hominis subsp. hominis C80]
 gi|313654607|gb|EFS18357.1| dTMP kinase [Staphylococcus hominis subsp. hominis C80]
          Length = 205

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 118/208 (56%), Gaps = 8/208 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT ++ + + L  +NY+V  TREPGG    E  R++LL    +     
Sbjct: 4   FITFEGPEGSGKTTVLNQINKLLS-ENYNVISTREPGGVSTGEEIRNILLDG--ENIDIR 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL   K++LCDR++DSS AYQG         +  + E ++
Sbjct: 61  TEALLFAASRREHLVEKVIPALKNDKVVLCDRYIDSSLAYQGYARGIGIEEVKKINEFAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI LD+  ++G +R+     L+     +  +++ +  H+K  + +  + +  P
Sbjct: 121 NGLYPDLTIYLDIDAEVGRERI-----LKNQRSQNRLDKETLTFHQKVIEGYKTLIKTNP 175

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +R  +VD+  S +SV ++   I+   ++
Sbjct: 176 ERFKVVDATQSIESVISDTYEIILSYLK 203


>gi|298369193|ref|ZP_06980511.1| dTMP kinase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283196|gb|EFI24683.1| dTMP kinase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 211

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 115/199 (57%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K++ + +   V  TREPGGTP  EA R +LL+      G  
Sbjct: 5   FITLDGIDGAGKSTNLAVMKQWFEARRLPVLFTREPGGTPTGEALREILLNPETKA-GLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            E ++  AAR  H+E+VI PAL  G  ++ DRF D+++AYQG         +++L+    
Sbjct: 64  TETLLMFAARQQHLEDVILPALKNGIHVVSDRFTDATFAYQGGGRGVPLQDIETLENWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
               PD T++LD+P+++ L+R+     +RE    D FER+      + R  +   A   P
Sbjct: 124 GSFRPDLTLLLDVPLEVSLERIGR---VREK---DRFEREQADFFTRVRNAYFSRAAANP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++D   S ++V T+I
Sbjct: 178 ERYAVIDGNRSPEAVRTSI 196


>gi|329942859|ref|ZP_08291638.1| thymidylate kinase [Chlamydophila psittaci Cal10]
 gi|313848031|emb|CBY17029.1| thymidylate kinase [Chlamydophila psittaci RD1]
 gi|325507234|gb|ADZ18872.1| thymidylate kinase [Chlamydophila psittaci 6BC]
 gi|328815119|gb|EGF85108.1| thymidylate kinase [Chlamydophila psittaci Cal10]
 gi|328914700|gb|AEB55533.1| thymidylate kinase [Chlamydophila psittaci 6BC]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 108/209 (51%), Gaps = 8/209 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI  EG EG+GK++   LLK  L  +  +V  TREPGG+   E  R  +L     E   
Sbjct: 1   MFIVIEGCEGSGKSSLTQLLKDKLMAEGKEVVATREPGGSSLGERVRDWILDPSTTEISP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E  +F AAR  H+   I PAL  GKI++CDRF DS+  YQG        ++ +L    
Sbjct: 61  YTELFLFLAARAQHITEKILPALELGKIVVCDRFHDSTIVYQGIVGGLGKEYVTNLCHSV 120

Query: 125 VQE--VMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           V E  ++P+ T +LD+P D GLKR Q + S       D FE K +  H K R+ FL +A 
Sbjct: 121 VGEKKILPNLTCLLDIPADEGLKRKQQQKS------FDKFENKSLAYHTKIREGFLSLAE 174

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWEL 211
           ++PD   ++D+    +     ++    EL
Sbjct: 175 SRPDSYLVLDARQPIEESLNKVMTAYTEL 203


>gi|227545157|ref|ZP_03975206.1| dTMP kinase [Lactobacillus reuteri CF48-3A]
 gi|300909170|ref|ZP_07126631.1| thymidylate kinase [Lactobacillus reuteri SD2112]
 gi|227184889|gb|EEI64960.1| dTMP kinase [Lactobacillus reuteri CF48-3A]
 gi|300893035|gb|EFK86394.1| thymidylate kinase [Lactobacillus reuteri SD2112]
          Length = 213

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 113/203 (55%), Gaps = 6/203 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFL--QRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           G FISFEG +GAGKT+ I  +++ L  Q     V  TREPGG   +E  R VL      +
Sbjct: 3   GKFISFEGPDGAGKTSVIQQIQQQLEDQLGTEKVMYTREPGGNKISEQIRQVLFDGQNTD 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA++FAAAR  H+ + I P L  GK++LCDRF+DSS AYQG         +  + 
Sbjct: 63  MDGRTEALLFAAARRQHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQIN 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + ++  +MP  TI LD+  +IGL+R+        S  ++  +++ +  H+  RQ +L + 
Sbjct: 123 QFAIDGLMPSLTIYLDIESEIGLRRIAE----HRSNQINRLDKEKLAFHQTVRQSYLKLY 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
           +N P+R  ++D++   + V  ++
Sbjct: 179 KNYPERIKLIDASQPLEKVIEDV 201


>gi|311106019|ref|YP_003978872.1| thymidylate kinase [Achromobacter xylosoxidans A8]
 gi|310760708|gb|ADP16157.1| thymidylate kinase [Achromobacter xylosoxidans A8]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 108/199 (54%), Gaps = 10/199 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             G FI+ EG++GAGK+TH   +  FL+ +  DV  TREPGGTP  E  R +LL+   D 
Sbjct: 3   TRGRFITLEGVDGAGKSTHTVWIADFLRAQGLDVVSTREPGGTPLGEKLRGLLLT---DP 59

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G + E ++  AAR +H+  VI PAL  G  ++CDR+ D++YAYQG         + +L+
Sbjct: 60  MGLDTETLLMFAARCEHLHQVIEPALARGAWVVCDRYTDATYAYQGGGRGLGASRVAALE 119

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +  +Q   PD T + D+P+++   R+ +    RE    D FER+     E+ R+ +   A
Sbjct: 120 DW-MQAGQPDRTWLFDVPLEVARARLAD---AREP---DRFEREGAAFFERTREAYHARA 172

Query: 182 RNQPDRCHIVDSAHSFQSV 200
                R  IVDS  S   +
Sbjct: 173 ATDQKRIRIVDSTQSIAQI 191


>gi|104774437|ref|YP_619417.1| thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ATCC 11842]
 gi|116514536|ref|YP_813442.1| thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ATCC BAA-365]
 gi|122274732|sp|Q048W8|KTHY_LACDB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|123378380|sp|Q1G923|KTHY_LACDA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|103423518|emb|CAI98420.1| Thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ATCC 11842]
 gi|116093851|gb|ABJ59004.1| thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ATCC BAA-365]
 gi|325126247|gb|ADY85577.1| Thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 212

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 118/209 (56%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FI+FEG +GAGKTT I+ + + +Q +   ++ VTREPGG+  AE  R ++L     E 
Sbjct: 3   GYFITFEGPDGAGKTTVINEVVKAIQGQCKREILVTREPGGSKIAEKIRDIILDPANTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AA+R  HV  +I PAL  G +++ DRF+DSS AYQG+    + L +D + +
Sbjct: 63  NAKTEALLYAASRSQHVSEIINPALKRGDLVMSDRFVDSSLAYQGQ---GRGLGIDEVAQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +   + PD TI LDL    GL R+    S  E    D  E++ +  HE+  + +  
Sbjct: 120 INAFATGHLEPDLTIFLDLDPAQGLARIAKVRSGSE----DRLEQEKLAFHEEVYRGYQK 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +  PDR  +VD++     V    + +V
Sbjct: 176 VNQAHPDRVKVVDASQDLPQVVAASVKLV 204


>gi|332042231|gb|EGI78557.1| thymidylate kinase [Hylemonella gracilis ATCC 19624]
          Length = 211

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 115/212 (54%), Gaps = 15/212 (7%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG F+SFEGI+GAGK+THI  L + L+ + + V +TREPGGTP AE  R ++L+  +D  
Sbjct: 2   SGFFVSFEGIDGAGKSTHIERLAQVLREQGHMVTLTREPGGTPLAERLRALVLAEKMD-- 59

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA++  AAR DH++ VI PAL  G  +LCDR+ D+SYAYQG         L +L+ 
Sbjct: 60  -ALTEALLVFAARRDHLQTVIEPALARGDAVLCDRYTDASYAYQGGGRGLDVSVLATLER 118

Query: 123 I------SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
                  +     PD T+  DL  ++  +R+        +   D FE + V    +  + 
Sbjct: 119 WVQAKPGAAGLRQPDLTLWFDLAPELAAERLSG------ARAPDKFEAEPVAFFRRVAEG 172

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +   A   P R   +D+A S ++V   +L +V
Sbjct: 173 YARRAAEDPGRFARLDAAQSREAVWDELLRVV 204


>gi|229015433|ref|ZP_04172435.1| Thymidylate kinase [Bacillus cereus AH1273]
 gi|229021638|ref|ZP_04178225.1| Thymidylate kinase [Bacillus cereus AH1272]
 gi|228739641|gb|EEL90050.1| Thymidylate kinase [Bacillus cereus AH1272]
 gi|228745852|gb|EEL95852.1| Thymidylate kinase [Bacillus cereus AH1273]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALEENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDIAFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +VD+    + +   ++ IV
Sbjct: 175 VVERFSDRIVVVDADQPMEKLIEEVIQIV 203


>gi|303251157|ref|ZP_07337341.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307251422|ref|ZP_07533336.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
 gi|307253501|ref|ZP_07535371.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|302650008|gb|EFL80180.1| thymidylate kinase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306856506|gb|EFM88648.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
 gi|306859002|gb|EFM91045.1| Thymidylate kinase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/208 (39%), Positives = 117/208 (56%), Gaps = 13/208 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI  EG+EGAGKTT   ++   L++    V  TREPGGTP AE  RH++     +   
Sbjct: 3   GKFIVLEGLEGAGKTTAHQVILAQLEKAGKSVVQTREPGGTPLAEKLRHLIKHETEEAVS 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQE 122
            +AE ++  AAR+  VENVI+PAL EGK +L DR   SS AYQ G R   +HL L++L+E
Sbjct: 63  DKAELLMLYAARIQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHL-LETLKE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR--ESACLDYFERKDVMIHEKRRQIFLDI 180
             +    PD TI LD+   +GL R + R  L   E   LD+F R         RQ +L++
Sbjct: 122 TVLGNFEPDLTIYLDIDPAVGLARARGRGELDRIEQQSLDFFYRT--------RQRYLEL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
            +N  ++  I+++  S + VA +I   V
Sbjct: 174 TQNN-EKAVIINAEQSIEQVAADIQQAV 200


>gi|238855359|ref|ZP_04645671.1| dTMP kinase [Lactobacillus jensenii 269-3]
 gi|260664925|ref|ZP_05865776.1| thymidylate kinase [Lactobacillus jensenii SJ-7A-US]
 gi|282934589|ref|ZP_06339836.1| dTMP kinase [Lactobacillus jensenii 208-1]
 gi|313472529|ref|ZP_07813019.1| dTMP kinase [Lactobacillus jensenii 1153]
 gi|238832020|gb|EEQ24345.1| dTMP kinase [Lactobacillus jensenii 269-3]
 gi|239529963|gb|EEQ68964.1| dTMP kinase [Lactobacillus jensenii 1153]
 gi|260561408|gb|EEX27381.1| thymidylate kinase [Lactobacillus jensenii SJ-7A-US]
 gi|281301341|gb|EFA93638.1| dTMP kinase [Lactobacillus jensenii 208-1]
          Length = 215

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 120/210 (57%), Gaps = 11/210 (5%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKTT +  L+++  ++   ++ VTREPGG+  AEA R ++L     E
Sbjct: 2   AGYFITFEGPDGAGKTTVLEKLIEKIKEQVTCEILVTREPGGSKIAEAIREIILDPENTE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+  V+ PAL  GK++  DRF+DSS AYQG     ++L +D + 
Sbjct: 62  MDDRTEALLYAAARSQHMAEVVFPALEAGKLVFSDRFVDSSLAYQG---MGRNLGIDKVA 118

Query: 122 EI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           EI   +   + PD T+ LD+  + GL R+      +E    D  E++ +  H+K    + 
Sbjct: 119 EINQFATDGLNPDLTLFLDIKPEDGLARIAKVRPDKE----DRLEKEKLSFHKKVYTGYQ 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +I +  P+R  +VD++     V  + L I+
Sbjct: 175 EIVKKYPERIKVVDASQDVDYVVADCLTIL 204


>gi|313124284|ref|YP_004034543.1| thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312280847|gb|ADQ61566.1| Thymidylate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|325685698|gb|EGD27777.1| thymidylate kinase [Lactobacillus delbrueckii subsp. lactis DSM
           20072]
          Length = 212

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 119/209 (56%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FI+FEG +GAGKTT I+ + + +Q +   ++ VTREPGG+  AE  R ++L     E 
Sbjct: 3   GYFITFEGPDGAGKTTVINEVVKAIQGQCKREILVTREPGGSKIAEKIRDIILDPANTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AA+R  HV  +I PAL  G +++ DRF+DSS AYQG+    + L +D + +
Sbjct: 63  NAKTEALLYAASRSQHVSEIINPALKRGDLVISDRFVDSSLAYQGQ---GRGLGIDEVAQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +   + PD TI LDL    GL R+    S  E    D  E++ ++ HE+  + +  
Sbjct: 120 INAFATGHLEPDLTIFLDLDPAQGLARIAKVRSGSE----DRLEQEKLVFHEEVYRGYQK 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + +  PDR  +VD++     V    + +V
Sbjct: 176 VNQAHPDRVKVVDASQDLPQVVAASVKLV 204


>gi|148272108|ref|YP_001221669.1| hypothetical protein CMM_0928 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|166221738|sp|A5CPG8|KTHY_CLAM3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|147830038|emb|CAN00966.1| tmkA [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
          Length = 211

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 122/208 (58%), Gaps = 18/208 (8%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G+FI+ EG +G GK+T  +LL+ +L+ + ++V VTREPGG+      R ++L       
Sbjct: 2   TGVFITLEGGDGVGKSTQSALLRGWLEDEGHEVVVTREPGGSELGVEIREIVLHR-RGHI 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R  HVE V+RPAL  G ++L DR+LDSS AYQG   + + L    ++E
Sbjct: 61  APRAEALLYAADRAHHVETVVRPALDRGAVVLQDRYLDSSVAYQG---AGRVLDAGEIRE 117

Query: 123 ISV---QEVMPDCTIILDL---PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           +S+   Q ++PD T++LDL      + L   + R+   ES      ER D   HE+ RQ 
Sbjct: 118 LSLWAAQGLLPDLTVLLDLDQAAARVRLDAARTRFDRLES------ERAD--FHERVRQA 169

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNI 204
           FL +A  +P+R  +VD+A   + +A  I
Sbjct: 170 FLGLAGAEPERFLVVDAARPREEIAAAI 197


>gi|225351239|ref|ZP_03742262.1| hypothetical protein BIFPSEUDO_02831 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158695|gb|EEG71937.1| hypothetical protein BIFPSEUDO_02831 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 219

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 126/224 (56%), Gaps = 20/224 (8%)

Query: 1   MN-SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           MN  G+FISFEG++G GKTT +  L+ +++ +  +  VTREPGGT    A R +LL  GV
Sbjct: 1   MNMQGIFISFEGVDGVGKTTQVERLRAYVEAQGRECVVTREPGGTVLGVAIRKLLLG-GV 59

Query: 60  D----EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHL 115
           +    +    AEA++FAA R  HV  VIRPAL  G +++ DR+LDSS AYQ      + L
Sbjct: 60  EGSDADIAPRAEALLFAADRAQHVAEVIRPALERGAVVITDRYLDSSLAYQA---GGREL 116

Query: 116 FLDSLQEISVQ---EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEK 172
               ++++S+    E++P+ T +LDL       R+Q+     ESA  D+  R        
Sbjct: 117 TAGEIRDLSMWATCELLPNRTYLLDLDPVQSHARLQHDEDRMESAGNDFQRRT------- 169

Query: 173 RRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            RQ FLD+A+ +  R  ++D++ S   V ++I +   ++ Q + 
Sbjct: 170 -RQAFLDLAKAESQRFRVIDASQSIDEVWSHIQDDFAQISQTKT 212


>gi|224824708|ref|ZP_03697815.1| dTMP kinase [Lutiella nitroferrum 2002]
 gi|224603201|gb|EEG09377.1| dTMP kinase [Lutiella nitroferrum 2002]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 112/206 (54%), Gaps = 7/206 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG++GAGK+T ++ ++ +L  +  D   TREPGGT   E  R +LL+    
Sbjct: 1   MRRGTFITLEGVDGAGKSTQLAAVRDWLAEQGIDAVFTREPGGTVLGEKLRELLLAVDT- 59

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E   E E ++  AAR +H+  VI PAL  G+ ++ DRF D+++AYQG         +++L
Sbjct: 60  EVTLETETLLMFAARQEHIARVIEPALAAGRWVVSDRFTDATFAYQGGGRGLPFARIEAL 119

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++   Q + PD T++ D+P+D+  +R+           LD FE++    H + R  +L  
Sbjct: 120 EDWVQQGLQPDLTLLFDVPLDVAARRMAG-----GERVLDRFEQEAADFHARVRAAYLQR 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILN 206
           A   P R  +VD+  S + V   ++ 
Sbjct: 175 ASANP-RIAVVDANRSPEQVRAEVMR 199


>gi|325696293|gb|EGD38184.1| thymidylate kinase [Streptococcus sanguinis SK160]
          Length = 212

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 115/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FL++    +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLKKYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GKI+L DRF+DSS AYQG         +D L
Sbjct: 61  AMDAKTELLLYIASRRQHLAERVLPALAQGKIVLMDRFIDSSVAYQGYGRGLDVADIDWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIARSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|218767791|ref|YP_002342303.1| thymidylate kinase [Neisseria meningitidis Z2491]
 gi|304388080|ref|ZP_07370209.1| thymidylate kinase [Neisseria meningitidis ATCC 13091]
 gi|14285515|sp|Q9JVE7|KTHY_NEIMA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|121051799|emb|CAM08105.1| putative thymidylate kinase [Neisseria meningitidis Z2491]
 gi|304337937|gb|EFM04077.1| thymidylate kinase [Neisseria meningitidis ATCC 13091]
 gi|319410042|emb|CBY90376.1| thymidylate kinase (dTMP kinase) [Neisseria meningitidis WUE 2594]
          Length = 206

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRSVYLNRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS      V  +I  ++
Sbjct: 178 ERYAVIDSNLGLDEVRNSIEKVL 200


>gi|148543567|ref|YP_001270937.1| thymidylate kinase [Lactobacillus reuteri DSM 20016]
 gi|184152974|ref|YP_001841315.1| thymidylate kinase [Lactobacillus reuteri JCM 1112]
 gi|227363473|ref|ZP_03847595.1| thymidylate kinase [Lactobacillus reuteri MM2-3]
 gi|325681917|ref|ZP_08161435.1| thymidylate kinase [Lactobacillus reuteri MM4-1A]
 gi|166987704|sp|A5VIC6|KTHY_LACRD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229621731|sp|B2G5V3|KTHY_LACRJ RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|148530601|gb|ABQ82600.1| thymidylate kinase [Lactobacillus reuteri DSM 20016]
 gi|183224318|dbj|BAG24835.1| thymidylate kinase [Lactobacillus reuteri JCM 1112]
 gi|227071487|gb|EEI09788.1| thymidylate kinase [Lactobacillus reuteri MM2-3]
 gi|324978561|gb|EGC15510.1| thymidylate kinase [Lactobacillus reuteri MM4-1A]
          Length = 213

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFL--QRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           G FISFEG +GAGKT+ I  ++  L  Q     V  TREPGG   +E  R VL      +
Sbjct: 3   GKFISFEGPDGAGKTSVIQQIQLELEDQLGTEKVMYTREPGGNKISEQIRQVLFDGQNTD 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA++FAAAR  H+ + I P L  GK++LCDRF+DSS AYQG         +  + 
Sbjct: 63  MDGRTEALLFAAARRQHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQIN 122

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + ++  +MP  TI LD+  +IGLKR+        S  ++  + + +  H   RQ +L + 
Sbjct: 123 QFAIDGLMPALTIYLDIESEIGLKRIAE----HRSNQVNRLDEEKLEFHRTVRQSYLKLY 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
           +N P+R  ++D++   + V  ++
Sbjct: 179 QNYPERIELIDASQPLEKVIEDV 201


>gi|251794049|ref|YP_003008780.1| thymidylate kinase [Paenibacillus sp. JDR-2]
 gi|247541675|gb|ACS98693.1| thymidylate kinase [Paenibacillus sp. JDR-2]
          Length = 217

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 113/205 (55%), Gaps = 4/205 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN G+FI+ EG EGAGKTT I  L   +Q++   V  TREPGG P AE  R V+L     
Sbjct: 1   MNKGIFITIEGGEGAGKTTLIEQLAHTMQQRGKTVITTREPGGIPIAEQIRSVILDRNHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A  EA+++AA+R  H+   + PAL +G+I++CDRF+DSS AYQG         + S+
Sbjct: 61  GMDARTEALLYAASRRQHLVEKVMPALADGQIVICDRFVDSSLAYQGHARGLGMEEVWSI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +V   MP  TI +D+  ++GL R++     RE   LD    + +  H+  R+ +  +
Sbjct: 121 NRFAVDGAMPQLTIYMDIDPEVGLARIRAAGE-REVNRLDL---ESLAFHQLVREGYQKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNIL 205
               P+R   +D+ ++  +V   ++
Sbjct: 177 LEQFPERIVQIDAGNAANAVLEEVI 201


>gi|121634466|ref|YP_974711.1| thymidylate kinase [Neisseria meningitidis FAM18]
 gi|166221758|sp|A1KST1|KTHY_NEIMF RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|120866172|emb|CAM09912.1| putative thymidylate kinase [Neisseria meningitidis FAM18]
 gi|325131877|gb|EGC54577.1| thymidylate kinase [Neisseria meningitidis M6190]
          Length = 206

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRSVYLNRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS      V  +I  ++
Sbjct: 178 ERYAVIDSNLGLDEVRNSIEKVL 200


>gi|307288618|ref|ZP_07568599.1| thymidylate kinase [Enterococcus faecalis TX0109]
 gi|306500372|gb|EFM69708.1| thymidylate kinase [Enterococcus faecalis TX0109]
 gi|315165331|gb|EFU09348.1| thymidylate kinase [Enterococcus faecalis TX1302]
          Length = 212

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG +GAGKT+ +  + +R  +     +  TREPGG P AE  R V+L    D  
Sbjct: 3   GIFITFEGPDGAGKTSVLKEVAERLAKESKRKIVTTREPGGIPIAEKIRTVILDPRNDRM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF DSS AYQG         + S+  
Sbjct: 63  DERTEALLYAAARRQHLVEKILPALEAGHLVLCDRFADSSLAYQGAGRRIGIAPIASINA 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + + V PD TI LD+  D GL+R+Q NR     +  +D  + + +  H++ R  +L +A
Sbjct: 123 FATEGVSPDFTIYLDVDSDTGLRRIQENR-----TQQIDRLDSEGLEFHQRVRHEYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              P R   +D+  S + V       + E
Sbjct: 178 EENPQRIKKIDARMSLELVVEATYQAIIE 206


>gi|229544854|ref|ZP_04433579.1| thymidylate kinase [Enterococcus faecalis TX1322]
 gi|229310022|gb|EEN76009.1| thymidylate kinase [Enterococcus faecalis TX1322]
          Length = 212

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 110/199 (55%), Gaps = 7/199 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG +GAGKT+ +  + +R  +     +  TREPGG P AE  R V+L    D  
Sbjct: 3   GIFITFEGPDGAGKTSVLKEVSERLAKESKRKIVTTREPGGIPIAEKIRTVILDPRNDRM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF+DSS AYQG         + S+  
Sbjct: 63  DERTEALLYAAARRQHLVEKILPALEAGHLVLCDRFVDSSLAYQGAGRRIGIAPIASINA 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + + V PD TI LD+  D GL+R+Q NR     +  +D  + + +  H++ R  +L +A
Sbjct: 123 FATEGVSPDFTIYLDVDSDTGLRRIQENR-----TQQIDRLDSEGLEFHQRVRHEYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSV 200
              P R   +D+  S + V
Sbjct: 178 EENPQRIKKIDARMSLELV 196


>gi|311744559|ref|ZP_07718359.1| thymidylate kinase [Aeromicrobium marinum DSM 15272]
 gi|311312178|gb|EFQ82095.1| thymidylate kinase [Aeromicrobium marinum DSM 15272]
          Length = 217

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 109/203 (53%), Gaps = 9/203 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +SG+F++ EG EG GK+T   LL  +L  + + V VTREPGGTP     R ++L      
Sbjct: 6   DSGVFVALEGGEGGGKSTQSGLLASWLTERGHQVLVTREPGGTPVGSQLRRIVLDPATGA 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             +  EA+++AA + +HVE ++ PAL  G+++L DR++DS+ AYQG   +     L+ + 
Sbjct: 66  LNSRTEALIYAADKAEHVEALVLPALAAGQVVLTDRYVDSTLAYQGAGRAIDVQELEHVA 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +  ++ P  T++LD+   +GL R             D  E + +  H + R+ FL +A
Sbjct: 126 RWATADLRPHLTVVLDIDPVVGLARAGEP---------DRIEAEPLAFHRRVREHFLRLA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNI 204
              PD   +VD+    + V  +I
Sbjct: 177 AADPDHYLVVDADRPAEQVQADI 199


>gi|93004986|ref|YP_579423.1| thymidylate kinase [Psychrobacter cryohalolentis K5]
 gi|92392664|gb|ABE73939.1| thymidylate kinase [Psychrobacter cryohalolentis K5]
          Length = 225

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 115/219 (52%), Gaps = 16/219 (7%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             G FISFEG EG GKTT I  L   LQ    D   TREPGG+P AE  R +LL      
Sbjct: 17  TQGRFISFEGTEGVGKTTAIEQLCARLQAHGIDYLRTREPGGSPFAERLREILLDPNT-A 75

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG----ERDSSQHLFL 117
              + E ++  AAR DH++ VI PAL  G  ++CDRF DS+ AYQG    + D+     +
Sbjct: 76  INDDTELLLMFAARCDHMQQVILPALQRGTWVICDRFTDSTVAYQGFGRADGDAIVRAKI 135

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           D L E  V + +P+ T+ LDLPV  G+ R   R      +  D FE++      +  Q F
Sbjct: 136 DMLIEQFVMQ-LPELTLWLDLPVLEGMARANKR------SAADRFEQQATEFFTRVHQGF 188

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
             +A  QP+R   +D++ S   V+  I    W+ +++++
Sbjct: 189 SVLASEQPERIQRIDASGSANEVSARI----WQTIEEKL 223


>gi|227519453|ref|ZP_03949502.1| thymidylate kinase [Enterococcus faecalis TX0104]
 gi|227073065|gb|EEI11028.1| thymidylate kinase [Enterococcus faecalis TX0104]
          Length = 212

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 110/199 (55%), Gaps = 7/199 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG +GAGKT+ +  + +R  +     +  TREPGG P AE  R V+L    D  
Sbjct: 3   GIFITFEGPDGAGKTSVLKEVSERLAKESKRKIVTTREPGGIPIAEKIRTVILDPRNDRM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF+DSS AYQG         + S+  
Sbjct: 63  DERTEALLYAAARRQHLVEKILPALEAGHLVLCDRFVDSSLAYQGAGRRIGIAPIASINA 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + + V PD TI LD+  D GL+R+Q NR     +  +D  + + +  H++ R  +L +A
Sbjct: 123 FATEGVSPDFTIYLDVDSDTGLRRIQENR-----TQQIDRLDSEGLEFHQRVRHEYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSV 200
              P R   +D+  S + V
Sbjct: 178 EENPQRIKKIDARMSLELV 196


>gi|220927615|ref|YP_002504524.1| thymidylate kinase [Clostridium cellulolyticum H10]
 gi|219997943|gb|ACL74544.1| thymidylate kinase [Clostridium cellulolyticum H10]
          Length = 206

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+ EG +G+GKTT I L++++L+    +V ++REPGGT  +E  R ++L     
Sbjct: 1   MRKGLFITVEGTDGSGKTTQIKLMEQYLKDMGNEVVLSREPGGTRISEMIRDLILDPENK 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +     E +++AAAR  HV  VIRPA+  GK ++CDRF+DSSYAYQG         +  +
Sbjct: 61  DISPLTEMMLYAAARAQHVSQVIRPAIESGKSVICDRFVDSSYAYQGCGRGVDLKTIADV 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              ++  V+PD T  LDL   + ++R        +S   D  E++ +  H +  + +  +
Sbjct: 121 NRAAIDGVVPDITFFLDLDPRVAMER------RVKSTGADRIEQEKMDFHIRVYEGYERM 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A   P+R   +D++ S + +++ I
Sbjct: 175 ALLYPERIKTIDASKSIEEISSQI 198


>gi|224475615|ref|YP_002633221.1| thymidylate kinase [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222420222|emb|CAL27036.1| thymidylate kinase [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 204

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 122/212 (57%), Gaps = 14/212 (6%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSC-GVDEF 62
           FI+FEG EG+GKTT   +L+R  +R  ++YDV  TREPGG PAAE  R +LL    VD+ 
Sbjct: 4   FITFEGPEGSGKTT---VLQRVAERLSQDYDVLKTREPGGVPAAEQIREILLDGEAVDD- 59

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA++FAA+R +H+   + PAL E K++LCDR++DSS AYQG         + ++ E
Sbjct: 60  --RTEALLFAASRREHLVEKVLPALKEDKVVLCDRYIDSSLAYQGFARGIGVEEVRAINE 117

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            ++  + PD TI LD+  + G +R++N         ++  + + +  H++  + + D+  
Sbjct: 118 FAINGLYPDLTIYLDITAETGRERIENN-----DRNMNRLDHESIAFHQRVIKGYHDLID 172

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            +P+R  ++D+    ++V  +    +   + K
Sbjct: 173 KEPERFKVIDANQELEAVVEDTYTAIKMFLGK 204


>gi|329925532|ref|ZP_08280406.1| dTMP kinase [Paenibacillus sp. HGF5]
 gi|328939815|gb|EGG36155.1| dTMP kinase [Paenibacillus sp. HGF5]
          Length = 234

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 108/192 (56%), Gaps = 4/192 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           LFI+ EG +G+GKTT +  L  F+Q  +    +TREPGG   AE  R ++L        A
Sbjct: 27  LFITVEGGDGSGKTTMMGRLAAFMQNHSIPYLITREPGGIEIAEKIRSIILDPEHTSMDA 86

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA+++AAAR  H+   + PAL +G  +LCDRF+DSS  YQG         + S+ + +
Sbjct: 87  RTEALLYAAARRQHLVEKVEPALRQGLTVLCDRFVDSSLVYQGYARGLGMEEVWSINQFA 146

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +   MPD T++ D+   IGL R+    + RE   LD    +++  HEK R+ +L +A   
Sbjct: 147 IDTRMPDLTLLFDIEPRIGLSRIAAN-AEREWNRLDM---ENLTFHEKVREGYLLVAERN 202

Query: 185 PDRCHIVDSAHS 196
           PDR  IVD++ +
Sbjct: 203 PDRIRIVDASKT 214


>gi|256616735|ref|ZP_05473581.1| thymidylate kinase [Enterococcus faecalis ATCC 4200]
 gi|256596262|gb|EEU15438.1| thymidylate kinase [Enterococcus faecalis ATCC 4200]
 gi|315032614|gb|EFT44546.1| thymidylate kinase [Enterococcus faecalis TX0017]
 gi|315143843|gb|EFT87859.1| thymidylate kinase [Enterococcus faecalis TX2141]
          Length = 212

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 112/209 (53%), Gaps = 7/209 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+FEG +GAGKT+ +  + +R  +     +  TREPGG P AE  R V+L    D  
Sbjct: 3   GIFITFEGPDGAGKTSVLKEVSERLAKESKRKIVTTREPGGIPIAEKIRTVILDPRNDRM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AAAR  H+   I PAL  G ++LCDRF+DSS AYQG         + S+  
Sbjct: 63  DERTEALLYAAARRQHLVEKIFPALEAGHLVLCDRFVDSSLAYQGAGRRIGIAPIASINA 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            + + V PD TI LD+  D GL+R+Q NR     +  +D  + + +  H++ R  +L +A
Sbjct: 123 FATEGVSPDFTIYLDVDSDTGLRRIQENR-----TQQIDRLDSEGLEFHQRVRHEYLKLA 177

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              P R   +D+  S + V       + E
Sbjct: 178 EENPQRIKKIDARMSLELVVEATYQAIIE 206


>gi|171780208|ref|ZP_02921112.1| hypothetical protein STRINF_01996 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281556|gb|EDT46991.1| hypothetical protein STRINF_01996 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 208

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 5/210 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ I+FEG +GAGKTT +  +   LQ K YD+  TREPGG   AE  R V+L     
Sbjct: 1   MKNGIIITFEGPDGAGKTTVLEKVLPVLQEKGYDIVTTREPGGVEIAERIRDVILDVKHV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              ++ E +++ AAR  H    + PAL  GK++L DRF+DSS AYQG         +  L
Sbjct: 61  AMDSKTELLLYMAARRQHYVEKVLPALEAGKVVLIDRFIDSSVAYQGAGRGLDKEIIAKL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + S     PD T+  D+  +IGL R+      RE   LD  E+ D  +H++ RQ +LD+
Sbjct: 121 NDFSTDGRKPDLTLYFDVESEIGLARIAKNAD-REVNRLD-LEKLD--MHKRVRQGYLDL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A+ + +R   +D++   + V     +++ E
Sbjct: 177 AQTE-ERIVTIDASRELEQVVAEATHVILE 205


>gi|268318943|ref|YP_003292599.1| hypothetical protein FI9785_450 [Lactobacillus johnsonii FI9785]
 gi|262397318|emb|CAX66332.1| tmk [Lactobacillus johnsonii FI9785]
          Length = 213

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 117/209 (55%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ ++K+  Q       VTREPGG+  +E  R ++L     E 
Sbjct: 3   GYLITFEGPDGAGKTTVINEIIKQLPQSLQERTLVTREPGGSKISENIRTIILDPENKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GK++L DRF+DSS AYQG     ++L ++ +++
Sbjct: 63  DDRTEALLYAAQRSQHVSEVIRPALAAGKVVLSDRFIDSSLAYQG---VGRNLGIEEVKQ 119

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + PD TI LDL   +GL R++   + +E    D  E++ +  H K    + +
Sbjct: 120 INDFGTGGLEPDLTIFLDLDPAVGLARIEKERAGQE----DRLEQEKIDFHNKVYAGYRE 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    PDR   VD+    + VA N + I+
Sbjct: 176 LLERYPDRIKKVDANLPIKDVAANSVKII 204


>gi|320547322|ref|ZP_08041613.1| dTMP kinase [Streptococcus equinus ATCC 9812]
 gi|320448020|gb|EFW88772.1| dTMP kinase [Streptococcus equinus ATCC 9812]
          Length = 210

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 118/214 (55%), Gaps = 5/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ ISFEG +GAGKTT +  +   LQ K YD+  TREPGG   AE  R V+L     
Sbjct: 1   MKNGIIISFEGPDGAGKTTVLEKVLPVLQEKGYDIVTTREPGGVEIAERIRDVILDVKHV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              ++ E +++ AAR  H    + PAL  GK++L DRF+DSS AYQG         +  L
Sbjct: 61  AMDSKTELLLYMAARRQHYVEKVLPALEAGKVVLIDRFIDSSVAYQGAGRGLDKDSIAKL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + S     PD T+  D+  ++GL R+  + + RE   LD  E+ D  +H++ RQ +LD+
Sbjct: 121 NDFSTDGREPDLTLYFDVESEVGLDRIA-KNADREVNRLD-LEKLD--MHKRVRQGYLDL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A+ + +R   +D++   + V  +   ++ E + K
Sbjct: 177 AQTE-NRIVTIDASRELEQVVADATQVILERLAK 209


>gi|288965848|pdb|3LD9|A Chain A, Crystal Structure Of Thymidylate Kinase From Ehrlichia
           Chaffeensis At 2.15a Resolution
 gi|288965849|pdb|3LD9|B Chain B, Crystal Structure Of Thymidylate Kinase From Ehrlichia
           Chaffeensis At 2.15a Resolution
 gi|288965850|pdb|3LD9|C Chain C, Crystal Structure Of Thymidylate Kinase From Ehrlichia
           Chaffeensis At 2.15a Resolution
 gi|288965851|pdb|3LD9|D Chain D, Crystal Structure Of Thymidylate Kinase From Ehrlichia
           Chaffeensis At 2.15a Resolution
          Length = 223

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 110/190 (57%), Gaps = 17/190 (8%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSC-GVDE 61
           +FI+FEGI+G+GKTT   LL  +L       +V +TREPGGT   E+ R++L    G+D 
Sbjct: 22  MFITFEGIDGSGKTTQSHLLAEYLSEIYGVNNVVLTREPGGTLLNESVRNLLFKAQGLDS 81

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               +E + F A R +H   +I+P+LM+ KI++CDRF+DS+ AYQG         +D L 
Sbjct: 82  L---SELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAYQGYGQGIDCSLIDQLN 138

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++ V +V PD T I+D+ ++  L R          +C + +E  D+  + + R  F DIA
Sbjct: 139 DL-VIDVYPDITFIIDVDINESLSR----------SCKNGYEFADMEFYYRVRDGFYDIA 187

Query: 182 RNQPDRCHIV 191
           +  P RCH++
Sbjct: 188 KKNPHRCHVI 197


>gi|294791185|ref|ZP_06756342.1| dTMP kinase [Scardovia inopinata F0304]
 gi|294457656|gb|EFG26010.1| dTMP kinase [Scardovia inopinata F0304]
          Length = 216

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 122/222 (54%), Gaps = 20/222 (9%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++FEG++G GKTT  + LK +L  +   V +TREPGGT   E  R +LL    D+  
Sbjct: 13  GLFVTFEGVDGVGKTTQATRLKNYLIHQGRQVLITREPGGTHLGEQIRQLLLHG--DDEA 70

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQE 122
              EA+++AA+R   V   IRPAL  GK+++ DR++DSS AYQ G R+ +    +  L E
Sbjct: 71  PRTEALLYAASRAQLVFQEIRPALNMGKVVISDRYIDSSLAYQAGGRELTMEQ-IRQLNE 129

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + P  T +LD+  +    R+       ES+  D+F R         RQ FLD+A 
Sbjct: 130 WATNGLWPQRTYLLDMDFEQAQARLSGPKDRLESSGADFFNRT--------RQAFLDLAG 181

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKD 224
            +PDR  I++++ S        ++ VW+ V+  +  L +++D
Sbjct: 182 QEPDRFVILNASLS--------VDQVWDAVKADIDSLLARRD 215


>gi|58697581|ref|ZP_00372803.1| thymidylate kinase [Wolbachia endosymbiont of Drosophila simulans]
 gi|58535919|gb|EAL59679.1| thymidylate kinase [Wolbachia endosymbiont of Drosophila simulans]
          Length = 197

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 113/194 (58%), Gaps = 15/194 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKTT   LL    ++     +V +TREPGGT  AE  R VLL+  +D  
Sbjct: 17  MFITFEGIDGSGKTTQSKLLANHFKQIHGENNVVLTREPGGTNFAEKIRGVLLTNNIDPI 76

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +H++ +I PAL EGKI++CDRF+DS+ AYQG   S     +  L +
Sbjct: 77  ---SELLLLISMRREHMKKLILPALAEGKIVICDRFIDSTIAYQGYGLSVDLGLIRDLHK 133

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V +GL R +++         + +E  DV  + K R+ F +IA 
Sbjct: 134 L-VEIKCPDITFILDIDVKVGLNRAKDK---------NKYEEMDVNFYNKVRKGFQEIAI 183

Query: 183 NQPDRCHIVDSAHS 196
            +P RC ++    +
Sbjct: 184 KEPVRCSVITGIET 197


>gi|299820920|ref|ZP_07052809.1| thymidylate kinase [Listeria grayi DSM 20601]
 gi|299817941|gb|EFI85176.1| thymidylate kinase [Listeria grayi DSM 20601]
          Length = 217

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 114/197 (57%), Gaps = 10/197 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+ EG +G+GKTT  + +   L  +N     TREPGG+P +E  R V+L  G +  
Sbjct: 9   SGFFITLEGPDGSGKTTVGNKIAEKLTAENIAYIKTREPGGSPISEKLREVILGIGNEAM 68

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               E ++ AAAR  HV   IRPAL E  ++LCDRFLDSS AYQ      ++L +D +  
Sbjct: 69  DPRTEVLLIAAARRQHVVETIRPALAENLVVLCDRFLDSSLAYQA---GGRNLDMDEVLA 125

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +V++ MPD T  LD+P ++GL+R+    +  +   ++  +++D++ H++  + + +
Sbjct: 126 INHYAVEDTMPDRTYYLDVPAEVGLERI----AANKGREINRLDQEDIVYHQRVGRAYAE 181

Query: 180 IARNQPDRCHIVDSAHS 196
           +    P+R   +D+  +
Sbjct: 182 VMNRFPERFKRMDAMQA 198


>gi|15606283|ref|NP_213662.1| thymidylate kinase [Aquifex aeolicus VF5]
 gi|6016457|sp|O67099|KTHY_AQUAE RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|158429380|pdb|2PBR|A Chain A, Crystal Structure Of Thymidylate Kinase (Aq_969) From
           Aquifex Aeolicus Vf5
 gi|158429381|pdb|2PBR|B Chain B, Crystal Structure Of Thymidylate Kinase (Aq_969) From
           Aquifex Aeolicus Vf5
 gi|2983484|gb|AAC07063.1| thymidylate kinase [Aquifex aeolicus VF5]
          Length = 195

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 117/201 (58%), Gaps = 15/201 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           + I+FEGI+G+GKTT    L  +L++K Y V + REPGGT   E  R +LL+  +DE   
Sbjct: 1   MLIAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGEVLREILLTEELDE--- 57

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E ++F A+R   +E  I P L   K+++ DRF+ S+ AYQG        F+ +L E +
Sbjct: 58  RTELLLFEASRSKLIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKGLDVEFIKNLNEFA 117

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            + V PD T++LD+PVDI L+R++ +         + FE K+ +  EK R+ FL++A+ +
Sbjct: 118 TRGVKPDITLLLDIPVDIALRRLKEK---------NRFENKEFL--EKVRKGFLELAKEE 166

Query: 185 PDRCHIVDSAHSFQSVATNIL 205
            +   ++D++   + V   IL
Sbjct: 167 EN-VVVIDASGEEEEVFKEIL 186


>gi|68171235|ref|ZP_00544639.1| Thymidylate kinase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658326|ref|YP_507050.1| thymidylate kinase [Ehrlichia chaffeensis str. Arkansas]
 gi|123493813|sp|Q2GHN3|KTHY_EHRCR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|67999355|gb|EAM86000.1| Thymidylate kinase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599783|gb|ABD45252.1| thymidylate kinase [Ehrlichia chaffeensis str. Arkansas]
          Length = 202

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 110/190 (57%), Gaps = 17/190 (8%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSC-GVDE 61
           +FI+FEGI+G+GKTT   LL  +L       +V +TREPGGT   E+ R++L    G+D 
Sbjct: 1   MFITFEGIDGSGKTTQSHLLAEYLSEIYGVNNVVLTREPGGTLLNESVRNLLFKAQGLDS 60

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               +E + F A R +H   +I+P+LM+ KI++CDRF+DS+ AYQG         +D L 
Sbjct: 61  L---SELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAYQGYGQGIDCSLIDQLN 117

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           ++ V +V PD T I+D+ ++  L R          +C + +E  D+  + + R  F DIA
Sbjct: 118 DL-VIDVYPDITFIIDVDINESLSR----------SCKNGYEFADMEFYYRVRDGFYDIA 166

Query: 182 RNQPDRCHIV 191
           +  P RCH++
Sbjct: 167 KKNPHRCHVI 176


>gi|302332195|gb|ADL22388.1| putative thymidylate kinase [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 205

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 4   FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 61  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRTLNEFAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 121 NGLYPDLTIYLNVSAEVGRERI-----IKNSRNQNRLDQEDLKFHEKVIEGYQEIIHNES 175

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 176 QRFKSVNADQPLENVVEDTYQTIIKYLEK 204


>gi|58698493|ref|ZP_00373398.1| thymidylate kinase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630910|ref|YP_002727701.1| thymidylate kinase [Wolbachia sp. wRi]
 gi|58534987|gb|EAL59081.1| thymidylate kinase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225592891|gb|ACN95910.1| thymidylate kinase [Wolbachia sp. wRi]
          Length = 212

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 113/194 (58%), Gaps = 15/194 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQR--KNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +FI+FEGI+G+GKTT   LL    ++     +V +TREPGGT  AE  R VLL+  +D  
Sbjct: 17  MFITFEGIDGSGKTTQSKLLANHFKQIHGENNVVLTREPGGTNFAEKIRGVLLTNNIDPI 76

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              +E ++  + R +H++ +I PAL EGKI++CDRF+DS+ AYQG   S     +  L +
Sbjct: 77  ---SELLLLISMRREHMKKLILPALAEGKIVICDRFIDSTIAYQGYGLSVDLGLIRDLHK 133

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
           + V+   PD T ILD+ V +GL R +++         + +E  DV  + K R+ F +IA 
Sbjct: 134 L-VEIKCPDITFILDIDVKVGLNRAKDK---------NKYEEMDVNFYNKVRKGFQEIAI 183

Query: 183 NQPDRCHIVDSAHS 196
            +P RC ++    +
Sbjct: 184 KEPVRCSVITGIET 197


>gi|42518522|ref|NP_964452.1| thymidylate kinase [Lactobacillus johnsonii NCC 533]
 gi|59798356|sp|Q74KZ7|KTHY_LACJO RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|41582807|gb|AAS08418.1| thymidylate kinase [Lactobacillus johnsonii NCC 533]
          Length = 213

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 117/209 (55%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ ++K+  Q       VTREPGG+  +E  R ++L     E 
Sbjct: 3   GYLITFEGPDGAGKTTVINEIIKQLPQSLQERTLVTREPGGSKISENIRTIILDPENKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GK++L DRF+DSS AYQG     ++L ++ +++
Sbjct: 63  DDRTEALLYAAQRSQHVSEVIRPALATGKVVLSDRFIDSSLAYQG---VGRNLGIEEVKQ 119

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + PD TI LDL   +GL R++   + +E    D  E++ +  H K    + +
Sbjct: 120 INDFGTGGLEPDLTIFLDLDPAVGLARIEKERAGQE----DRLEQEKIDFHNKVYAGYRE 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    PDR   VD+    + VA N + I+
Sbjct: 176 LFERYPDRIKKVDANLPIKDVAANSVKII 204


>gi|300867280|ref|ZP_07111940.1| Thymidylate kinase [Oscillatoria sp. PCC 6506]
 gi|300334757|emb|CBN57106.1| Thymidylate kinase [Oscillatoria sp. PCC 6506]
          Length = 217

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 117/209 (55%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFL-QRKNY----DVHVTREPGGTPAAEAARHVLLSCG 58
           G  I FEG+EG+GKTT I   + +L  ++N+     + VTREPGGT   +  R +LL  G
Sbjct: 3   GKLIVFEGVEGSGKTTQIERSRLWLLSKENHCKVPQIVVTREPGGTDLGKGLRGLLLESG 62

Query: 59  VDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD 118
            +     AE +++AA R  HVE V++P L +G I+LCDRF DS+ AYQG         ++
Sbjct: 63  GENICDRAELLLYAADRAQHVEAVLKPELAKGSIVLCDRFTDSTIAYQGYGRGLSLSLIN 122

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            L EI+   +  D T+ LDL V++GL+RV+ R         D  E+ D+  H + +Q F 
Sbjct: 123 QLNEIATLGLQSDLTLWLDLEVEVGLRRVKRR------GVSDRIEQADLEFHRRVQQGFA 176

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNI 207
           D+A    DR   VD+  S + V+  I +I
Sbjct: 177 DLATANRDRIIRVDANRSEEEVSEEIHHI 205


>gi|75908183|ref|YP_322479.1| thymidylate kinase [Anabaena variabilis ATCC 29413]
 gi|123609755|sp|Q3MBQ2|KTHY_ANAVT RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|75701908|gb|ABA21584.1| thymidylate kinase [Anabaena variabilis ATCC 29413]
          Length = 211

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 113/207 (54%), Gaps = 6/207 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            G FI FEG+EG GKT+ + L   +LQ     V +TREPGGT      R +LL    D+ 
Sbjct: 2   GGRFIVFEGVEGCGKTSQMQLCAEWLQNLGISVILTREPGGTELGVDLRRLLLQKAEDKP 61

Query: 63  GAE-AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            AE  E +++AA R  HV   ++P L +GK +LCDR++DS+ AYQG   +     +  L 
Sbjct: 62  IAEVTELLLYAADRAQHVAQELKPKLAQGKYILCDRYVDSTIAYQGYGRNLDMNLIHQLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +I+   +  D TI LD+ V++GL R +      E+  LD  E++ +  H + +Q + ++A
Sbjct: 122 DIATGGLTSDITIWLDVDVEVGLARKRG-----ENVGLDRIEQETIAFHRRVQQGYANLA 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
            + P R   VD   S ++V   I  I+
Sbjct: 177 ASSPSRIIRVDGQLSKETVHKTIQEIL 203


>gi|309803553|ref|ZP_07697646.1| dTMP kinase [Lactobacillus iners LactinV 11V1-d]
 gi|312870920|ref|ZP_07731025.1| dTMP kinase [Lactobacillus iners LEAF 3008A-a]
 gi|308164437|gb|EFO66691.1| dTMP kinase [Lactobacillus iners LactinV 11V1-d]
 gi|311093610|gb|EFQ51949.1| dTMP kinase [Lactobacillus iners LEAF 3008A-a]
          Length = 213

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 119/213 (55%), Gaps = 11/213 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FISFEG +GAGKTT I+ L + L  K    + VTREPGG+  +E  R+++L     E 
Sbjct: 3   GYFISFEGPDGAGKTTIINELVQQLSSKTIAPILVTREPGGSKISENIRNIILDPKNKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE EA+++AAAR  HV   I PAL  GKI+  DRF+DSS AYQG     + L +D +++
Sbjct: 63  NAETEALLYAAARSQHVIETIIPALNAGKIVFSDRFIDSSLAYQG---IGRDLGIDEIKQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + + + PD T+  D+    GL+R+Q      E    D  E+++ + H+K    +  
Sbjct: 120 INEFATRHITPDLTLFFDIDPLKGLQRIQKVRPENE----DRLEQENNLFHQKVYTGYKQ 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +    P+R   VD+  S   VA+  + I+ E +
Sbjct: 176 LLSAYPERIKRVDAELSIAEVASQSVKILEEYM 208


>gi|188584675|ref|YP_001916220.1| dTMP kinase [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349362|gb|ACB83632.1| dTMP kinase [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 206

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 118/209 (56%), Gaps = 10/209 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEGI+G GK+T +  +   L++  ++V  TREPGGT   +A R +LL+       
Sbjct: 5   GKFITFEGIDGCGKSTQLKKVTSKLKKLGFNVVSTREPGGTSVGDAIREILLAPKHYNMT 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E EA+++AA+R+ H+E  I P L E  I+LCDRF+DSS AYQG + S + +    + + 
Sbjct: 65  IETEALLYAASRVQHIEEFIIPNLAEDNIVLCDRFVDSSVAYQGIKLSHEEVI--RVNQP 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +  +V PD T +    +DI  +R   R  + +    D  E + V    + R+ +L +A  
Sbjct: 123 AYDKVTPDITFL----IDITPERAAKRLGIEK----DRIENRGVNYQSQVRENYLFLAEE 174

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +PDR  I++   S + V   + N++ +++
Sbjct: 175 EPDRIVIINGDQSEEKVFEELWNVLEDIL 203


>gi|329946277|ref|ZP_08293871.1| dTMP kinase [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328527569|gb|EGF54564.1| dTMP kinase [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 253

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 111/213 (52%), Gaps = 8/213 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + GLFISFEG +G GKTT I +L   L   + D  +TREPGGT      R +LL  G   
Sbjct: 10  HPGLFISFEGGDGVGKTTQIRILADLLTAADVDHVLTREPGGTGLGLEIRRLLLHGGY-- 67

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AEA+++AA R  H+   +RPAL  G ++L DR+LDSS AYQG   S     +  L 
Sbjct: 68  VAPRAEALLYAADRAHHIATRVRPALERGAVVLADRYLDSSVAYQGAARSLGPQEVRDLS 127

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             + + ++PD TI+LD   D+  +R   R         D  E++        R+ FL +A
Sbjct: 128 LWATEGLLPDLTILLDGDPDLAEQRATGR------GAKDRLEQEGGTFRTSLRRQFLALA 181

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             +P R  ++D+  S   VA +++    E V++
Sbjct: 182 EAEPGRFVVIDADRSVDQVADDVIGAAVEAVRR 214


>gi|227888765|ref|ZP_04006570.1| thymidylate kinase [Lactobacillus johnsonii ATCC 33200]
 gi|227850602|gb|EEJ60688.1| thymidylate kinase [Lactobacillus johnsonii ATCC 33200]
          Length = 217

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 117/209 (55%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ ++K+  Q       +TREPGG+  +E  R ++L     E 
Sbjct: 7   GYLITFEGPDGAGKTTVINEIIKQLPQSLQERTLITREPGGSKISENIRTIILDPENKEM 66

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GK++L DRF+DSS AYQG     ++L ++ +++
Sbjct: 67  DDRTEALLYAAQRSQHVSEVIRPALAAGKVVLSDRFIDSSLAYQG---VGRNLGIEEVKQ 123

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + PD TI LDL   +GL R++   + +E    D  E++ +  H K    + +
Sbjct: 124 INDFGTGGLEPDLTIFLDLDPAVGLARIEKERAGQE----DRLEQEKIDFHNKVYAGYRE 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    PDR   VD+    + VA N + I+
Sbjct: 180 LLERYPDRIKKVDANLPIKDVAANSVKII 208


>gi|258424483|ref|ZP_05687362.1| thymidylate kinase [Staphylococcus aureus A9635]
 gi|257845352|gb|EEV69387.1| thymidylate kinase [Staphylococcus aureus A9635]
          Length = 210

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 9   FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 65

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGKI+LCDR++DSS AYQG         + +L E ++
Sbjct: 66  TEAMLFAASRREHLVLKVIPALKEGKIVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 125

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 126 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 180

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 181 QRFKSVNADQPLENVVEDTYQTIIKYLEK 209


>gi|89101171|ref|ZP_01174003.1| thymidylate kinase [Bacillus sp. NRRL B-14911]
 gi|89084106|gb|EAR63275.1| thymidylate kinase [Bacillus sp. NRRL B-14911]
          Length = 212

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 122/226 (53%), Gaps = 18/226 (7%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ GLFI+ EG EGAGKTT I++L   L  + Y V  TREPGG   AE  R V+L     
Sbjct: 2   MDKGLFITAEGPEGAGKTTIINMLASGLADEGYKVMQTREPGGIEIAEQIRAVILDTKNT 61

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLD-- 118
                 EA+++AAAR  H+   ++PAL EG I+LCDRF+DSS AYQG    ++ L +D  
Sbjct: 62  AMDPRTEALLYAAARRQHLAEKVQPALDEGYIVLCDRFIDSSLAYQG---YARGLGIDEV 118

Query: 119 -SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
            S+   +++ +MP+ T+  D+    GL+R+  R   RE   LD    + +  H K R+ +
Sbjct: 119 YSINHFAIEGMMPELTLYFDIDPASGLQRI-GRNQGREVNRLDL---ESLEFHTKVREGY 174

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKK 223
             +    PDR   +D++   +         V++L   R+  L + K
Sbjct: 175 EILLAKFPDRISRIDASLPVEE--------VYQLASARLKSLFADK 212


>gi|223932402|ref|ZP_03624404.1| dTMP kinase [Streptococcus suis 89/1591]
 gi|302023623|ref|ZP_07248834.1| thymidylate kinase [Streptococcus suis 05HAS68]
 gi|330832635|ref|YP_004401460.1| dTMP kinase [Streptococcus suis ST3]
 gi|223898856|gb|EEF65215.1| dTMP kinase [Streptococcus suis 89/1591]
 gi|329306858|gb|AEB81274.1| dTMP kinase [Streptococcus suis ST3]
          Length = 212

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 117/208 (56%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FI+FEG +GAGKTT +  L   LQ    +V  TREPGG   AE  R+++L+    
Sbjct: 1   MRNGFFITFEGPDGAGKTTVLQQLLPALQELGPEVVTTREPGGVAIAEEIRNIILNPANT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E   + E ++F AAR  H++  I P L +GK+LL DRF+DSS AYQG         +  L
Sbjct: 61  EMDDKTELLLFIAARRQHLKEKILPPLAQGKLLLIDRFIDSSIAYQGFGRGLDIGDIHWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+  + GL R+  R + R+   LD  E+ D  +H + RQ +L+I
Sbjct: 121 NQFATDGLKPDLTLYFDIDTEEGLARIA-RNADRDVDRLD-MEKAD--MHRRVRQGYLNI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
              +P+R   +D++   ++V  + L ++
Sbjct: 177 LEQEPERFVKIDASQPLEAVVADALAVI 204


>gi|78044441|ref|YP_358922.1| thymidylate kinase [Carboxydothermus hydrogenoformans Z-2901]
 gi|123577218|sp|Q3AG12|KTHY_CARHZ RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|77996556|gb|ABB15455.1| thymidylate kinase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 203

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 111/208 (53%), Gaps = 16/208 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG+EG+GKTT I  + R+L  KN    +TREPGGT   +  R +LL+       
Sbjct: 3   GKFITIEGVEGSGKTTQIQYIARYLTEKNIPHIITREPGGTALGKKIRELLLNPSYPVV- 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            EAE +++ A R  HV   I P L +G  ++ DR+ DS+ AYQG         L S    
Sbjct: 62  PEAEILLYLADRAQHVGEKIIPHLDKGVWVISDRYFDSTLAYQGYGRGFDLTLLKSFIAF 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           + + ++PD T+++DLP ++GL RV+ R         D  ER+ +  H++ R+ FL +AR+
Sbjct: 122 ATKGLIPDLTVLIDLPPEVGLSRVKGR------GEYDRLERETLEFHQRVREGFLQLARD 175

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWEL 211
           Q  R  +VD     +        I WE+
Sbjct: 176 Q--RFRVVDGRKKPE-------EIFWEI 194


>gi|227529519|ref|ZP_03959568.1| dTMP kinase [Lactobacillus vaginalis ATCC 49540]
 gi|227350604|gb|EEJ40895.1| dTMP kinase [Lactobacillus vaginalis ATCC 49540]
          Length = 213

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 120/210 (57%), Gaps = 10/210 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRK--NYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +G FISFEG +GAGKT+ I+ ++  L+++     V  TREPGG   +E  R VL      
Sbjct: 2   AGKFISFEGPDGAGKTSVITAIQAELEQQLGKEKVMYTREPGGNHISEQVRRVLFDEHNT 61

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ--GERDSSQHLFLD 118
           +     EA++FAAAR  H+ + I PAL +GK++LCDR++DSS AYQ  G     Q ++  
Sbjct: 62  DMDGRTEALLFAAARRQHIVSEILPALKDGKVILCDRYVDSSIAYQVAGRHLGEQKIW-- 119

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
            + + ++  ++PD TI LD+   +GL+R+        +  ++  + + +  H+  R+ FL
Sbjct: 120 QINQYAIDGLLPDLTIYLDIESKLGLQRIAE----HRADQVNRLDEEQLSFHKTVREAFL 175

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIV 208
            + R  P+R  ++D++ S   V +++   +
Sbjct: 176 RLQRENPERIKLIDASQSLPKVISDVKQTI 205


>gi|218283200|ref|ZP_03489270.1| hypothetical protein EUBIFOR_01858 [Eubacterium biforme DSM 3989]
 gi|218216018|gb|EEC89556.1| hypothetical protein EUBIFOR_01858 [Eubacterium biforme DSM 3989]
          Length = 212

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 119/214 (55%), Gaps = 6/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+FI+FEG +G+GKTT    ++  L +  YD   TREPGG+  AE+ R++LL     
Sbjct: 3   MKQGVFITFEGNDGSGKTTVCKAVQEELIKMGYDCIYTREPGGSKIAESIRNILLDVNNT 62

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     EA+++AA+R  H++ V+ PAL   KI+LCDRF+DSS AYQG         +  +
Sbjct: 63  EMDDRTEALLYAASRRQHLKEVVLPALENKKIVLCDRFIDSSLAYQGIARGIGLKEVWDI 122

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + ++   MP+ T+ L + V+ G KR+  R        L+  ++++   H+  RQ +  +
Sbjct: 123 NQFAIDGCMPEKTLFLSVSVETGKKRMNLRGD------LNRLDQEESSFHKAVRQGYETL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
               P+R  ++D+    + V  + +  V +++++
Sbjct: 177 VSMYPERIEVIDAEPCKEEVLKSAMECVLKVIKE 210


>gi|88705167|ref|ZP_01102879.1| Thymidylate kinase [Congregibacter litoralis KT71]
 gi|88700862|gb|EAQ97969.1| Thymidylate kinase [Congregibacter litoralis KT71]
          Length = 244

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 107/201 (53%), Gaps = 6/201 (2%)

Query: 12  IEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVF 71
           I GAGK+T +S ++  L+    D+  TREPGGT   E  R  LL+         AE ++ 
Sbjct: 42  IFGAGKSTAMSYIEERLRDAGVDLICTREPGGTSLGEQLRETLLAPTEAGIAPLAELLMM 101

Query: 72  AAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPD 131
            AAR  H+   I PAL  G+ +LCDRF D++YAYQG   +     +  L+E    ++ PD
Sbjct: 102 FAARAQHLSECILPALRRGQWVLCDRFTDATYAYQGAGRNMGEAPVALLEEFVQGDLRPD 161

Query: 132 CTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIV 191
            T++LD+P D+GL R + R        LD FE +D+   E+ RQ +L  AR    R  I+
Sbjct: 162 VTLLLDVPADLGLSRARGR------GALDRFELEDLAFFERVRQSYLSRARRSSGRYQII 215

Query: 192 DSAHSFQSVATNILNIVWELV 212
           D++     V   +  +V +L+
Sbjct: 216 DASAELADVERALQAVVKDLI 236


>gi|327490146|gb|EGF21934.1| thymidylate kinase [Streptococcus sanguinis SK1058]
          Length = 212

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FLQ     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLQNYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVLPALAQGKLVLMDRFIDSSVAYQGNGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIAKSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|282915799|ref|ZP_06323567.1| thymidylate kinase [Staphylococcus aureus subsp. aureus D139]
 gi|283768917|ref|ZP_06341826.1| dTMP kinase [Staphylococcus aureus subsp. aureus H19]
 gi|282320290|gb|EFB50632.1| thymidylate kinase [Staphylococcus aureus subsp. aureus D139]
 gi|283461098|gb|EFC08184.1| dTMP kinase [Staphylococcus aureus subsp. aureus H19]
          Length = 210

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 9   FITFEGPEGSGKTTVINEVYHRLA-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 65

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 66  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 125

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 126 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 180

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 181 QRFKSVNADQPLENVVEDTYQTIIKYLEK 209


>gi|229819159|ref|YP_002880685.1| thymidylate kinase [Beutenbergia cavernae DSM 12333]
 gi|229565072|gb|ACQ78923.1| thymidylate kinase [Beutenbergia cavernae DSM 12333]
          Length = 210

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 119/219 (54%), Gaps = 26/219 (11%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+F+SFEG +GAGKTT + LL  ++++   +V  TREPGGT      R ++L    ++  
Sbjct: 7   GVFVSFEGGDGAGKTTQLELLATWIEQAGREVVRTREPGGTAIGRTLRDLVLHG--EDVD 64

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++A  R  HV +++RPAL  G ++L DR++DSS AYQ      + L  D ++ +
Sbjct: 65  ARTEALLYATDRAHHVASLVRPALARGAVVLTDRYVDSSLAYQA---GGRELAADDVRRL 121

Query: 124 SVQEV---MPDCTIILDL-PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           S+  V   MPD TI+LDL P  +           R +A  D  ER     H + R+ +L 
Sbjct: 122 SMWAVDGLMPDVTILLDLDPAHL---------PARLTAAPDRLERAGSAFHVRTREAYLG 172

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSP 218
           +A  +P+R  ++D+A     +A          V+ RV+P
Sbjct: 173 LAAREPERWLVLDAALGRAELAAQ--------VRARVAP 203


>gi|256826256|ref|YP_003150216.1| thymidylate kinase [Kytococcus sedentarius DSM 20547]
 gi|256689649|gb|ACV07451.1| thymidylate kinase [Kytococcus sedentarius DSM 20547]
          Length = 213

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 115/214 (53%), Gaps = 12/214 (5%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFL--QRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
             GLF++ EG +GAGK+T I LL   L  Q    +V VTREPGGT      R +LL    
Sbjct: 5   GHGLFVALEGGDGAGKSTQIRLLVEHLAGQHAGREVVVTREPGGTDLGRRIRELLLHG-- 62

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           D     AEA++FAA R  HVE+++RPAL  G +++ DR++DSS AYQG       + + S
Sbjct: 63  DHVAPRAEALLFAADRAHHVESLVRPALDRGAVVVGDRYVDSSIAYQGAGRDLDAVEVAS 122

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +   + + ++PD T++LD  VD    R       R  A  D  E +    HE+ RQ FLD
Sbjct: 123 ISRWATEGLVPDLTVLLD--VDPATGRS------RRGAEHDRLEAEPTAFHERVRQHFLD 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           +A   P R  ++D++   Q +   +   V  L++
Sbjct: 175 LAAAAPQRYLVLDASRPPQELGAEVARAVDGLLE 208


>gi|73663583|ref|YP_302364.1| thymidylate kinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123641634|sp|Q49UZ1|KTHY_STAS1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|72496098|dbj|BAE19419.1| thymidylate kinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 205

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 120/214 (56%), Gaps = 12/214 (5%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I  + + L+ + Y V +TREPGG    E  R VLL    D+    
Sbjct: 4   FITFEGPEGSGKTTVIQQVAQKLENQ-YSVVLTREPGGVKTGEQIREVLLEG--DDMDDR 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + P+L  GK++LCDR++DSS AYQG         + S+ E ++
Sbjct: 61  TEALLFAASRREHLVGKVIPSLENGKLVLCDRYIDSSLAYQGYARGIGIEEVKSINEFAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI LD+ V +G +R+     L+     +  +++DV  HEK  + +  I  N+ 
Sbjct: 121 NGLYPDITIYLDVSVAVGRERI-----LKNQRNQNRLDQEDVKFHEKVVEGYKKIIHNES 175

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
           +R  ++++  S   V    +N  +E + K +  L
Sbjct: 176 ERFIVIEADRSIDEV----VNATYESISKYLEKL 205


>gi|297207416|ref|ZP_06923855.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|300910375|ref|ZP_07127828.1| thymidylate kinase [Staphylococcus aureus subsp. aureus TCH70]
 gi|296887979|gb|EFH26873.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|300888364|gb|EFK83551.1| thymidylate kinase [Staphylococcus aureus subsp. aureus TCH70]
          Length = 208

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 7   FITFEGPEGSGKTTVINKVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 64  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 124 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 178

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 179 QRFKSVNADQPLENVVEDTYQTIIKYLEK 207


>gi|228982456|ref|ZP_04142715.1| Thymidylate kinase [Bacillus thuringiensis Bt407]
 gi|228776639|gb|EEM24947.1| Thymidylate kinase [Bacillus thuringiensis Bt407]
          Length = 206

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 115/198 (58%), Gaps = 17/198 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF+S EG EG+GK+  I  L  +L+ +  +   +REPGG   AE  R +++    +E  
Sbjct: 5   GLFVSIEGGEGSGKSALIQGLSLYLEEQGMECLTSREPGGVKVAEEIRELIME---NEMD 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA++FA+AR +H +N I PAL EGKI++CDRF+DSS  YQG     Q + +D++  I
Sbjct: 62  AITEALLFASARREHFKNKISPALTEGKIVICDRFVDSSIVYQG---YVQGIGMDNVLSI 118

Query: 124 SVQE----VMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           + Q     VMP  T+ LD+   I L R+ QN    RE+   + F+ K +  H+K R+ +L
Sbjct: 119 NSQALEGLVMPHLTLYLDVEPTIALNRIAQNN---RET---NRFDEKSIEFHKKVREGYL 172

Query: 179 DIARNQPDRCHIVDSAHS 196
            I     +R   VD++ S
Sbjct: 173 LIEEKHSNRIKKVDASLS 190


>gi|295694727|ref|YP_003587965.1| thymidylate kinase [Bacillus tusciae DSM 2912]
 gi|295410329|gb|ADG04821.1| thymidylate kinase [Bacillus tusciae DSM 2912]
          Length = 209

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 115/211 (54%), Gaps = 4/211 (1%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G+FI+FEG +GAGK+T ++LL   LQ+       TREPGGT  ++  R +LL     E 
Sbjct: 2   TGVFITFEGPDGAGKSTQVALLASRLQKACIRCITTREPGGTTISDKIRGILLDPHHREM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA+R   V   IRP L  G +++CDR++D+S AYQG     +   L  L  
Sbjct: 62  TPRTEALLYAASRAQLVGEFIRPHLERGDVVICDRYVDASLAYQGALGLDRK-ELARLNH 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + P  T ++D+P D+GL RV+ R+S+     +D  E + +  HE  R+ FL  A+
Sbjct: 121 WATDGLEPLRTYLIDVPADVGLDRVRTRHSM--YGVMDRIEERSIEYHEAVRRWFLGQAQ 178

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
             P R  ++D     + V+  I   V  L+ 
Sbjct: 179 TSP-RYRVIDGTMPPEMVSEAIWRDVKSLLN 208


>gi|158339115|ref|YP_001520292.1| thymidylate kinase [Acaryochloris marina MBIC11017]
 gi|189028825|sp|B0C3N6|KTHY_ACAM1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|158309356|gb|ABW30973.1| thymidylate kinase [Acaryochloris marina MBIC11017]
          Length = 231

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/221 (34%), Positives = 114/221 (51%), Gaps = 17/221 (7%)

Query: 4   GLFISFEGIEGAGKTTHISL-------------LKRFLQRKNYDVHVTREPGGTPAAEAA 50
           G FI FEG EGAGKTT ++L             +K ++Q     V  TREPGGT   ++ 
Sbjct: 3   GKFIVFEGGEGAGKTTQLNLVFEWLTGSGWTNRIKGYIQGDYPSVLTTREPGGTALGKSI 62

Query: 51  RHVLL---SCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG 107
           R +LL   + G +     AE ++FAA R  HV + + P L +G ++LCDR+ DS+ AYQG
Sbjct: 63  RKLLLDVTATGNESIDERAELLLFAADRAQHVSSCLLPHLQQGALVLCDRYTDSTIAYQG 122

Query: 108 ERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDV 167
                    +  L +I+ Q ++ D T  LD+  + GL R  +R    E    D  E  ++
Sbjct: 123 YGRELDLTLIHQLNQIATQGLVSDLTFWLDIDPEFGLARTHDREQDPEIET-DRMEANEI 181

Query: 168 MIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
             H++ RQ F D+AR  P+R   +++  S   VA  I  I+
Sbjct: 182 AFHQRLRQGFADLARQHPERIFRIEAHQSDDVVAQQIQGIL 222


>gi|282918262|ref|ZP_06326002.1| thymidylate kinase [Staphylococcus aureus subsp. aureus C427]
 gi|282317828|gb|EFB48197.1| thymidylate kinase [Staphylococcus aureus subsp. aureus C427]
          Length = 210

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 9   FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 65

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 66  TEAMLFAASRREHLVLKVVPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 125

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 126 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 180

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 181 QRFKSVNADQPLENVVEDTYQTIIKYLEK 209


>gi|85374070|ref|YP_458132.1| thymidylate kinase [Erythrobacter litoralis HTCC2594]
 gi|84787153|gb|ABC63335.1| thymidylate kinase [Erythrobacter litoralis HTCC2594]
          Length = 212

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 106/213 (49%), Gaps = 6/213 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG GK+T   LL   L  +  +  VTREPGGT  AEA R +LL    D
Sbjct: 1   MTRGRFIALEGGEGTGKSTQARLLAEALSTRGIECVVTREPGGTEGAEAIRRLLLDPPGD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            +G  AEA++FAAAR DHVE +I PAL  G  ++ DRFLDSS AYQG         + +L
Sbjct: 61  GWGPRAEALLFAAARSDHVEKLILPALERGAWVVSDRFLDSSRAYQGGAGGIGDQAVRTL 120

Query: 121 QEISVQEVMPDCTIILDL-PVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
            +I    + PD T+++++ P  I       R + R+    D    +    H      F  
Sbjct: 121 HDIGSGGLRPDLTVLIEVEPATI-----AERLADRDGNRSDAIGGRSAQYHADVAASFKR 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            A   P    +VD   +   V + IL  +  L+
Sbjct: 176 FAAEDPGGFAVVDGEGTPDEVHSRILEAIEPLI 208


>gi|325978913|ref|YP_004288629.1| thymidylate kinase [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
 gi|325178841|emb|CBZ48885.1| thymidylate kinase [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
          Length = 210

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 116/215 (53%), Gaps = 5/215 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ ISFEG +GAGKTT +  +   LQ K YD+  TREPGG   AE  R V+L     
Sbjct: 1   MKNGIIISFEGPDGAGKTTVLEQVLPVLQEKGYDIVTTREPGGVEIAERIRDVILDVNHV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              ++ E +++ AAR  H    + PAL  GK++L DRF+DSS AYQG         +  L
Sbjct: 61  AMDSKTELLLYMAARRQHYVEKVLPALEAGKVVLIDRFIDSSIAYQGAGRGLDKDIITRL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +     PD T+  D+  +IGL R+  + + RE   LD  E+ D  +H++ R+ +L +
Sbjct: 121 NDFATDGRKPDLTLYFDVESEIGLARIA-KNAEREVNRLD-LEKLD--MHKRVREGYLAL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           A  Q  R   +D++     V +  L I+ E + K+
Sbjct: 177 A-EQEKRIVTIDASRELADVVSETLQIILEQLAKK 210


>gi|317407094|gb|EFV87102.1| tmk protein [Achromobacter xylosoxidans C54]
          Length = 207

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 117/214 (54%), Gaps = 10/214 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           + G FI+ EG++GAGK+TH   +  FL+ +  +V  TREPGGTP  E  R ++L+   D 
Sbjct: 3   SRGRFITLEGVDGAGKSTHTEWIAEFLRGQGLEVVSTREPGGTPLGEKLRALVLT---DP 59

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G + E ++  AAR +H+  VI PAL  G  ++CDR+ D++YAYQG         + +L 
Sbjct: 60  MGLDTETLLMFAARCEHLHQVIEPALARGAWVVCDRYTDATYAYQGGGRGLGAERVAAL- 118

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E  +Q   PD T + D+P+++   R+ +    RE    D FER+     E+ R  +   A
Sbjct: 119 ETWMQAGRPDRTWLFDVPLEVARARLAD---AREP---DRFEREGAAFFERTRAAYQARA 172

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
             +PDR  ++DS  +  ++   +   + ELV  R
Sbjct: 173 AAEPDRIRVIDSTRAIAAIRAELEAGLRELVAVR 206


>gi|50365491|ref|YP_053916.1| thymidylate kinase [Mesoplasma florum L1]
 gi|59798247|sp|Q6F0E1|KTHY_MESFL RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|50364047|gb|AAT76032.1| thymidylate kinase [Mesoplasma florum L1]
          Length = 211

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 122/211 (57%), Gaps = 9/211 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG++G+GKTT +  +K++L+  NY V +TREPGG P +E  R ++L+   D  G 
Sbjct: 1   MFITIEGMDGSGKTTALQRVKQYLEDLNYKVVMTREPGGLPLSEKIRELILNK--DGVGM 58

Query: 65  E--AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
           E   EA++F AAR +H+E VI+P L +G I++ DRF+DS+ AYQG        +L+ LQ+
Sbjct: 59  EPWTEALLFIAARKEHLEKVIKPYLKKGYIVISDRFMDSTTAYQGGARGLGVDYLNELQK 118

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
             ++  +PD T+  +L  +   KR+  R    E   LD   RK     E  +  F ++  
Sbjct: 119 NILEGFLPDLTLYFELSFEDAEKRLSARPE--EKNRLDEEGRK---FKEAVKLAFEELVV 173

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            +P+R  ++D++ S + V      ++ E ++
Sbjct: 174 KEPNRITVIDASKSPEEVFEETKKVILEKIE 204


>gi|161508727|ref|YP_001574386.1| thymidylate kinase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253735215|ref|ZP_04869380.1| dTMP kinase [Staphylococcus aureus subsp. aureus TCH130]
 gi|297591609|ref|ZP_06950246.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MN8]
 gi|304380498|ref|ZP_07363175.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|160367536|gb|ABX28507.1| dTMP kinase [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253726775|gb|EES95504.1| dTMP kinase [Staphylococcus aureus subsp. aureus TCH130]
 gi|297575478|gb|EFH94195.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MN8]
 gi|304340943|gb|EFM06866.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312436430|gb|ADQ75501.1| thymidylate kinase [Staphylococcus aureus subsp. aureus TCH60]
 gi|320139433|gb|EFW31311.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320144210|gb|EFW35978.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MRSA177]
          Length = 208

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 7   FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 64  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 124 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 178

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 179 QRFKSVNADQPLENVVEDTYQTIIKYLEK 207


>gi|297621242|ref|YP_003709379.1| Thymidylate kinase [Waddlia chondrophila WSU 86-1044]
 gi|297376543|gb|ADI38373.1| Thymidylate kinase [Waddlia chondrophila WSU 86-1044]
          Length = 199

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 114/205 (55%), Gaps = 15/205 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE-FG 63
           +FIS EG EG+GKTT I  L  +L+ K   V +TREPGGT   E+ R VLL       F 
Sbjct: 2   MFISVEGGEGSGKTTLIRNLAEYLESKGDQVLITREPGGTRFGESLRKVLLDPEFPAAFN 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A AE ++F AAR+ H+E VI+PAL +GK ++CDRF DS+ AYQG     + L +  ++++
Sbjct: 62  ARAEMLLFLAARVQHIEEVIQPALRKGKTVICDRFNDSTIAYQG---GGRELGVVRVEQL 118

Query: 124 SVQ---EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             +      PD T +LD+  +   +R+ NR         D  E++    H K R  F  +
Sbjct: 119 CFEVCDGFQPDKTFVLDINPETAFQRL-NRSK-------DRMEKESFDFHNKVRSAFYAL 170

Query: 181 ARNQPDRCHIVDSAHSFQSVATNIL 205
               P+R H++++  S + V  ++L
Sbjct: 171 KDKHPNRIHLINADQSKEKVLADVL 195


>gi|78188893|ref|YP_379231.1| thymidylate kinase [Chlorobium chlorochromatii CaD3]
 gi|123579949|sp|Q3AS37|KTHY_CHLCH RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|78171092|gb|ABB28188.1| thymidylate kinase [Chlorobium chlorochromatii CaD3]
          Length = 222

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 122/220 (55%), Gaps = 6/220 (2%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           + I+FEGI+GAGK+T ++ L  +L++++  +   REPGGTP AE+ R +LL         
Sbjct: 1   MLITFEGIDGAGKSTQVAKLVAYLKQQSTPLLSLREPGGTPTAESIRSLLLD-NRKSITP 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE ++F+A+R + VE +IRPAL EGK ++ DRF DS+ AYQG         L S+  +S
Sbjct: 60  IAELLLFSASRAELVETLIRPALAEGKTVILDRFFDSTTAYQGHGRGISLEQLHSIIALS 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSL-----RESACLDYFERKDVMIHEKRRQIFLD 179
             +++PD T  LDL  +  L+R  +R  L      +S   D  E+  +  + K R  +L 
Sbjct: 120 TGDLLPDVTFYLDLEPEEALRRAFSRSGLPLDFAAQSNESDRMEQAGIAFYHKVRNGYLT 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
           + +  P R   +D+     ++  +I+  V   ++  +SPL
Sbjct: 180 LMQQHPSRFVALDATQPPDTLHQHIIAEVETRLKLHISPL 219


>gi|151220658|ref|YP_001331480.1| thymidylate kinase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|257424593|ref|ZP_05601021.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427259|ref|ZP_05603660.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257429895|ref|ZP_05606281.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 68-397]
 gi|257432598|ref|ZP_05608960.1| thymidylate kinase [Staphylococcus aureus subsp. aureus E1410]
 gi|257435503|ref|ZP_05611553.1| thymidylate kinase [Staphylococcus aureus subsp. aureus M876]
 gi|257794277|ref|ZP_05643256.1| thymidylate kinase [Staphylococcus aureus A9781]
 gi|258407206|ref|ZP_05680351.1| thymidylate kinase [Staphylococcus aureus A9763]
 gi|258420828|ref|ZP_05683764.1| thymidylate kinase [Staphylococcus aureus A9719]
 gi|258429598|ref|ZP_05688272.1| thymidylate kinase [Staphylococcus aureus A9299]
 gi|258446131|ref|ZP_05694292.1| thymidylate kinase [Staphylococcus aureus A6300]
 gi|258448039|ref|ZP_05696169.1| thymidylate kinase [Staphylococcus aureus A6224]
 gi|258452837|ref|ZP_05700832.1| thymidylate kinase [Staphylococcus aureus A5948]
 gi|258453814|ref|ZP_05701787.1| thymidylate kinase [Staphylococcus aureus A5937]
 gi|282895088|ref|ZP_06303308.1| thymidylate kinase [Staphylococcus aureus A8117]
 gi|282903066|ref|ZP_06310958.1| dTMP kinase [Staphylococcus aureus subsp. aureus C160]
 gi|282904857|ref|ZP_06312717.1| thymidylate kinase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282907803|ref|ZP_06315642.1| thymidylate kinase [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282910120|ref|ZP_06317926.1| thymidylate kinase [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913308|ref|ZP_06321099.1| dTMP kinase [Staphylococcus aureus subsp. aureus M899]
 gi|282923013|ref|ZP_06330699.1| thymidylate kinase [Staphylococcus aureus subsp. aureus C101]
 gi|282925555|ref|ZP_06333208.1| thymidylate kinase [Staphylococcus aureus A9765]
 gi|283957270|ref|ZP_06374728.1| dTMP kinase [Staphylococcus aureus subsp. aureus A017934/97]
 gi|293500358|ref|ZP_06666210.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509296|ref|ZP_06668012.1| thymidylate kinase [Staphylococcus aureus subsp. aureus M809]
 gi|293515884|ref|ZP_06670574.1| dTMP kinase [Staphylococcus aureus subsp. aureus M1015]
 gi|150373458|dbj|BAF66718.1| thymidylate kinase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|257272620|gb|EEV04740.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275910|gb|EEV07378.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279411|gb|EEV10006.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 68-397]
 gi|257282463|gb|EEV12596.1| thymidylate kinase [Staphylococcus aureus subsp. aureus E1410]
 gi|257285140|gb|EEV15257.1| thymidylate kinase [Staphylococcus aureus subsp. aureus M876]
 gi|257788249|gb|EEV26589.1| thymidylate kinase [Staphylococcus aureus A9781]
 gi|257841164|gb|EEV65613.1| thymidylate kinase [Staphylococcus aureus A9763]
 gi|257843220|gb|EEV67633.1| thymidylate kinase [Staphylococcus aureus A9719]
 gi|257849657|gb|EEV73624.1| thymidylate kinase [Staphylococcus aureus A9299]
 gi|257855108|gb|EEV78050.1| thymidylate kinase [Staphylococcus aureus A6300]
 gi|257858729|gb|EEV81602.1| thymidylate kinase [Staphylococcus aureus A6224]
 gi|257859523|gb|EEV82376.1| thymidylate kinase [Staphylococcus aureus A5948]
 gi|257863985|gb|EEV86740.1| thymidylate kinase [Staphylococcus aureus A5937]
 gi|282314532|gb|EFB44919.1| thymidylate kinase [Staphylococcus aureus subsp. aureus C101]
 gi|282322779|gb|EFB53099.1| dTMP kinase [Staphylococcus aureus subsp. aureus M899]
 gi|282325968|gb|EFB56274.1| thymidylate kinase [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282328318|gb|EFB58592.1| thymidylate kinase [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282331974|gb|EFB61483.1| thymidylate kinase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282592459|gb|EFB97471.1| thymidylate kinase [Staphylococcus aureus A9765]
 gi|282596492|gb|EFC01452.1| dTMP kinase [Staphylococcus aureus subsp. aureus C160]
 gi|282762506|gb|EFC02646.1| thymidylate kinase [Staphylococcus aureus A8117]
 gi|283791194|gb|EFC30004.1| dTMP kinase [Staphylococcus aureus subsp. aureus A017934/97]
 gi|290921292|gb|EFD98350.1| dTMP kinase [Staphylococcus aureus subsp. aureus M1015]
 gi|291096318|gb|EFE26578.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467841|gb|EFF10351.1| thymidylate kinase [Staphylococcus aureus subsp. aureus M809]
          Length = 210

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 9   FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 65

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 66  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 125

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 126 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 180

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 181 QRFKSVNADQPLENVVEDTYQTIIKYLEK 209


>gi|21282166|ref|NP_645254.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MW2]
 gi|49485346|ref|YP_042567.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|23821762|sp|Q8NY05|KTHY_STAAW RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|56748991|sp|Q6GC06|KTHY_STAAS RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|21203602|dbj|BAB94302.1| tmk [Staphylococcus aureus subsp. aureus MW2]
 gi|49243789|emb|CAG42214.1| putative thymidylate kinase [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 205

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 4   FITFEGPEGSGKTTVINKVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 61  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 121 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 175

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 176 QRFKSVNADQPLENVVEDTYQTIIKYLEK 204


>gi|223939277|ref|ZP_03631158.1| dTMP kinase [bacterium Ellin514]
 gi|223892109|gb|EEF58589.1| dTMP kinase [bacterium Ellin514]
          Length = 213

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 116/220 (52%), Gaps = 10/220 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-SCGV 59
           M  GL ISFEG EG GK+T ISLL   L+   + + + REPGGTP  E  R+ L  S   
Sbjct: 1   MKKGLLISFEGTEGCGKSTQISLLTERLRALGHVIRMVREPGGTPIGEEIRYTLKHSVKN 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               +EAE ++  A+R   V  V+RPAL  G+I++CDR+ DS+ AYQG         + +
Sbjct: 61  HAMTSEAELLLMNASRAQLVREVLRPALEAGEIIVCDRYYDSTTAYQGYGRGLDLKLVQA 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + +V +  PD T++L +P ++   R+ +R +       D  E  D     +  Q +  
Sbjct: 121 VIDFAVGDTRPDLTLLLRVPPEVSAARLASRQATL-PFIRDRIEEADQSFFNRVSQGYEA 179

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPL 219
           +A   P+R   +D++ S Q+V+ +I    W     RV PL
Sbjct: 180 LATAHPERIQTIDASSSVQNVSDSI----W----SRVKPL 211


>gi|18978102|ref|NP_579459.1| thymidylate kinase [Pyrococcus furiosus DSM 3638]
 gi|23821777|sp|Q8U071|KTHY_PYRFU RecName: Full=Probable thymidylate kinase; AltName: Full=dTMP
           kinase
 gi|18893897|gb|AAL81854.1| thymidylate kinase (tmk) [Pyrococcus furiosus DSM 3638]
          Length = 210

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 120/217 (55%), Gaps = 15/217 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI  EGI+G+GKTT   LL R+ +   + V +T+EP  T   +  R ++L   + 
Sbjct: 1   MKRGLFIVLEGIDGSGKTTQARLLARWFEDNGFKVVLTKEPTDTEFGKIIRKLVLEGSII 60

Query: 61  EFG---AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFL 117
           + G    EAEA++FAA R +HV+ +I PAL EGK+++ DR+  SS AYQ  R     L L
Sbjct: 61  DGGRISLEAEALLFAADRAEHVKKIIEPALREGKVVISDRYFYSSLAYQWARG----LNL 116

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
           + L EI+     PD  I+LD+P   G+KR++ R S  E   L         + EK R+ +
Sbjct: 117 EWLIEINKFAPHPDIAILLDIPPREGIKRIKKRSSQTEFDKL-------FKLQEKVRENY 169

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +A+   D   I+D+  S + V   I++ + E+  K
Sbjct: 170 IKLAK-MFDEIKIIDATKSVEEVHREIISSIKEIWGK 205


>gi|330428264|gb|AEC19598.1| Thymidylate kinase [Pusillimonas sp. T7-7]
          Length = 216

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 116/214 (54%), Gaps = 5/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN GL I  +G  GAGK T +  ++ FL     +V +TREPGGT   E  R +LL     
Sbjct: 1   MNKGLMIVVDGGNGAGKGTCLHDIEAFLSGLGLEVVMTREPGGTAIGEQIREILLDKSAV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E     E ++FAAAR  HV   I PA+  GK+++ DRF  ++ ++Q          ++SL
Sbjct: 61  EMCDVTELMLFAAARAQHVRQKIVPAINAGKVVVSDRFDSATISFQHYARGLDLELINSL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +I+V  + PD TIILDL   +GL+RV +R S       D  E++++   E+ RQ ++  
Sbjct: 121 NDIAVAGLRPDFTIILDLDPAVGLQRVASRGS-----DFDRLEKENLSFLERARQGYIKQ 175

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A   P R   VD++ SF  V   +L +V +++ +
Sbjct: 176 ALADPQRFATVDASQSFDQVRHEVLQLVEQVIAR 209


>gi|325687059|gb|EGD29082.1| thymidylate kinase [Streptococcus sanguinis SK72]
          Length = 212

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FLQ     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLQSYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVWPALTQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIAKSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|229094752|ref|ZP_04225758.1| Thymidylate kinase [Bacillus cereus Rock3-29]
 gi|229113705|ref|ZP_04243141.1| Thymidylate kinase [Bacillus cereus Rock1-3]
 gi|228669702|gb|EEL25108.1| Thymidylate kinase [Bacillus cereus Rock1-3]
 gi|228688620|gb|EEL42492.1| Thymidylate kinase [Bacillus cereus Rock3-29]
          Length = 208

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 117/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKKLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  +IGL R++     RE   LD    +D+  H++ R+ +L+
Sbjct: 119 INRFATEDCMPSVTIYLDIEPEIGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|300811154|ref|ZP_07091666.1| dTMP kinase [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|300497858|gb|EFK32868.1| dTMP kinase [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
          Length = 212

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 119/206 (57%), Gaps = 12/206 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FI+FEG +GAGKTT I+ + + +Q +   ++ VTREPGG+  AE  R ++L     E 
Sbjct: 3   GYFITFEGPDGAGKTTVINEVVKAIQGQCKREILVTREPGGSKIAEKIRDIILDPANTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A+ EA+++AA+R  HV  +I PAL  G +++ DRF+DSS AYQG+    + L +D + +
Sbjct: 63  NAKTEALLYAASRSQHVSEIINPALKRGDLVISDRFVDSSLAYQGQ---GRGLGIDEVAQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   +   + PD TI LDL    GL R+    S  E    D  E++ +  HE+  + +  
Sbjct: 120 INAFATGYLEPDLTIFLDLDPAQGLARIAKVRSGSE----DRLEQEKLSFHEEVYRGYQK 175

Query: 180 IARNQPDRCHIVDSAHSF-QSVATNI 204
           + +  PDR  +VD++    Q VA ++
Sbjct: 176 VNQAHPDRVKVVDASQDLPQVVAASV 201


>gi|229027878|ref|ZP_04184033.1| Thymidylate kinase [Bacillus cereus AH1271]
 gi|228733392|gb|EEL84219.1| Thymidylate kinase [Bacillus cereus AH1271]
          Length = 208

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  +IGL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEIGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +VD+    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVDADQPMEKLIEEVVQII 203


>gi|325137927|gb|EGC60502.1| thymidylate kinase [Neisseria meningitidis ES14902]
          Length = 206

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 118/203 (58%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++++K + +R+   V  TREPGGTP  E  R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGETLREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR+ H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GGLRPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFMRVRSVYLNRAAACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++DS      V  +I  ++
Sbjct: 178 ERYAVIDSNLGLDEVRNSIEKVL 200


>gi|15923472|ref|NP_371006.1| thymidylate kinase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926159|ref|NP_373692.1| thymidylate kinase [Staphylococcus aureus subsp. aureus N315]
 gi|49482709|ref|YP_039933.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|57651363|ref|YP_185412.1| thymidylate kinase [Staphylococcus aureus subsp. aureus COL]
 gi|82750189|ref|YP_415930.1| thymidylate kinase [Staphylococcus aureus RF122]
 gi|87162349|ref|YP_493168.1| thymidylate kinase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194238|ref|YP_499030.1| thymidylate kinase [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148266940|ref|YP_001245883.1| dTMP kinase [Staphylococcus aureus subsp. aureus JH9]
 gi|150392986|ref|YP_001315661.1| dTMP kinase [Staphylococcus aureus subsp. aureus JH1]
 gi|156978810|ref|YP_001441069.1| thymidylate kinase [Staphylococcus aureus subsp. aureus Mu3]
 gi|221142326|ref|ZP_03566819.1| thymidylate kinase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253315924|ref|ZP_04839137.1| thymidylate kinase [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253730948|ref|ZP_04865113.1| dTMP kinase [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|255005275|ref|ZP_05143876.2| thymidylate kinase [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|262049967|ref|ZP_06022826.1| hypothetical protein SAD30_0195 [Staphylococcus aureus D30]
 gi|262052513|ref|ZP_06024710.1| hypothetical protein SA930_1934 [Staphylococcus aureus 930918-3]
 gi|269202101|ref|YP_003281370.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ED98]
 gi|284023491|ref|ZP_06377889.1| thymidylate kinase [Staphylococcus aureus subsp. aureus 132]
 gi|294850341|ref|ZP_06791074.1| thymidylate kinase [Staphylococcus aureus A9754]
 gi|295407370|ref|ZP_06817167.1| thymidylate kinase [Staphylococcus aureus A8819]
 gi|295427016|ref|ZP_06819653.1| thymidylate kinase [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296276563|ref|ZP_06859070.1| thymidylate kinase [Staphylococcus aureus subsp. aureus MR1]
 gi|297246450|ref|ZP_06930290.1| thymidylate kinase [Staphylococcus aureus A8796]
 gi|54037703|sp|P65249|KTHY_STAAN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|54041417|sp|P65248|KTHY_STAAM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|56749045|sp|Q6GJI9|KTHY_STAAR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|73920829|sp|Q5HIJ5|KTHY_STAAC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|122540513|sp|Q2G230|KTHY_STAA8 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|123487157|sp|Q2FJG0|KTHY_STAA3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|123548600|sp|Q2YVW3|KTHY_STAAB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|166223118|sp|A7WYM2|KTHY_STAA1 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|189030842|sp|A6TYV6|KTHY_STAA2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|189030843|sp|A5IQ34|KTHY_STAA9 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|93279034|pdb|2CCJ|A Chain A, Crystal Structure Of S. Aureus Thymidylate Kinase
           Complexed With Thymidine Monophosphate
 gi|93279035|pdb|2CCJ|B Chain B, Crystal Structure Of S. Aureus Thymidylate Kinase
           Complexed With Thymidine Monophosphate
 gi|93279036|pdb|2CCK|A Chain A, Crystal Structure Of Unliganded S. Aureus Thymidylate
           Kinase
 gi|93279037|pdb|2CCK|B Chain B, Crystal Structure Of Unliganded S. Aureus Thymidylate
           Kinase
 gi|13700372|dbj|BAB41670.1| tmk [Staphylococcus aureus subsp. aureus N315]
 gi|14246250|dbj|BAB56644.1| thymidylate kinase homologue [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|49240838|emb|CAG39505.1| putative thymidylate kinase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57285549|gb|AAW37643.1| thymidylate kinase [Staphylococcus aureus subsp. aureus COL]
 gi|82655720|emb|CAI80119.1| thymidylate kinase [Staphylococcus aureus RF122]
 gi|87128323|gb|ABD22837.1| thymidylate kinase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87201796|gb|ABD29606.1| thymidylate kinase [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740009|gb|ABQ48307.1| thymidylate kinase [Staphylococcus aureus subsp. aureus JH9]
 gi|149945438|gb|ABR51374.1| dTMP kinase [Staphylococcus aureus subsp. aureus JH1]
 gi|156720945|dbj|BAF77362.1| thymidylate kinase homologue [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|253725298|gb|EES94027.1| dTMP kinase [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|259159560|gb|EEW44607.1| hypothetical protein SA930_1934 [Staphylococcus aureus 930918-3]
 gi|259161902|gb|EEW46485.1| hypothetical protein SAD30_0195 [Staphylococcus aureus D30]
 gi|262074391|gb|ACY10364.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ED98]
 gi|269940053|emb|CBI48429.1| putative thymidylate kinase [Staphylococcus aureus subsp. aureus
           TW20]
 gi|283469774|emb|CAQ48985.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ST398]
 gi|285816181|gb|ADC36668.1| Thymidylate kinase [Staphylococcus aureus 04-02981]
 gi|294822765|gb|EFG39201.1| thymidylate kinase [Staphylococcus aureus A9754]
 gi|294967727|gb|EFG43759.1| thymidylate kinase [Staphylococcus aureus A8819]
 gi|295129019|gb|EFG58648.1| thymidylate kinase [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297176637|gb|EFH35899.1| thymidylate kinase [Staphylococcus aureus A8796]
 gi|298693811|gb|ADI97033.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ED133]
 gi|302750372|gb|ADL64549.1| putative thymidylate kinase [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|312828977|emb|CBX33819.1| thymidylate kinase [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315128606|gb|EFT84609.1| thymidylate kinase [Staphylococcus aureus subsp. aureus CGS03]
 gi|315193841|gb|EFU24235.1| thymidylate kinase [Staphylococcus aureus subsp. aureus CGS00]
 gi|315196161|gb|EFU26517.1| thymidylate kinase [Staphylococcus aureus subsp. aureus CGS01]
 gi|323438403|gb|EGA96161.1| thymidylate kinase [Staphylococcus aureus O11]
 gi|323441265|gb|EGA98936.1| thymidylate kinase [Staphylococcus aureus O46]
 gi|329313200|gb|AEB87613.1| Thymidylate kinase [Staphylococcus aureus subsp. aureus T0131]
 gi|329725071|gb|EGG61566.1| dTMP kinase [Staphylococcus aureus subsp. aureus 21172]
 gi|329729774|gb|EGG66171.1| dTMP kinase [Staphylococcus aureus subsp. aureus 21189]
 gi|329731077|gb|EGG67449.1| dTMP kinase [Staphylococcus aureus subsp. aureus 21193]
          Length = 205

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 4   FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 60

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 61  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 120

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 121 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 175

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 176 QRFKSVNADQPLENVVEDTYQTIIKYLEK 204


>gi|93279032|pdb|2CCG|A Chain A, Crystal Structure Of His-Tagged S. Aureus Thymidylate
           Kinase Complexed With Thymidine Monophosphate (Tmp)
 gi|93279033|pdb|2CCG|B Chain B, Crystal Structure Of His-Tagged S. Aureus Thymidylate
           Kinase Complexed With Thymidine Monophosphate (Tmp)
          Length = 225

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EG+GKTT I+ +   L  K+YDV +TREPGG P  E  R ++L    ++    
Sbjct: 24  FITFEGPEGSGKTTVINEVYHRLV-KDYDVIMTREPGGVPTGEEIRKIVLEG--NDMDIR 80

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL EGK++LCDR++DSS AYQG         + +L E ++
Sbjct: 81  TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAI 140

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI L++  ++G +R+     ++ S   +  +++D+  HEK  + + +I  N+ 
Sbjct: 141 NGLYPDLTIYLNVSAEVGRERI-----IKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES 195

Query: 186 DRCHIVDSAHSFQSVATNILNIVWELVQK 214
            R   V++    ++V  +    + + ++K
Sbjct: 196 QRFKSVNADQPLENVVEDTYQTIIKYLEK 224


>gi|324991362|gb|EGC23295.1| thymidylate kinase [Streptococcus sanguinis SK353]
          Length = 212

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FLQ     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLQSYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVLPALTQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIAKSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|255065851|ref|ZP_05317706.1| dTMP kinase [Neisseria sicca ATCC 29256]
 gi|255049762|gb|EET45226.1| dTMP kinase [Neisseria sicca ATCC 29256]
          Length = 208

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 116/199 (58%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T++++++R+ +  +  V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIRRWFESHDLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR  H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARQQHLEDVILPALADGIHVVSDRFTDATFAYQGGGRGVPLQDIEMLENWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
               PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GGFGPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFTRVRAVYLERAAAHP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++D   S + V  +I
Sbjct: 178 ERYALIDGNRSLEEVRADI 196


>gi|229159205|ref|ZP_04287230.1| Thymidylate kinase [Bacillus cereus R309803]
 gi|228624220|gb|EEK81021.1| Thymidylate kinase [Bacillus cereus R309803]
          Length = 208

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 117/211 (55%), Gaps = 10/211 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +     DR  +V++    + +   ++ I+ E
Sbjct: 175 VVERFSDRIVVVNADQPMEQLIEEVVQIIEE 205


>gi|146318315|ref|YP_001198027.1| thymidylate kinase [Streptococcus suis 05ZYH33]
 gi|145689121|gb|ABP89627.1| Thymidylate kinase [Streptococcus suis 05ZYH33]
 gi|292558109|gb|ADE31110.1| Thymidylate kinase [Streptococcus suis GZ1]
          Length = 222

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 118/216 (54%), Gaps = 4/216 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FI+FEG +GAGKTT +  L   LQ    +V  TREPGG   AE  R+++L+    
Sbjct: 11  MRNGFFITFEGPDGAGKTTVLQQLLPALQELGPEVVTTREPGGVAIAEEIRNIILNPANT 70

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               + E ++F AAR  H++  I P L +GK+LL DRF+DSS AYQG         +  L
Sbjct: 71  AMDDKTELLLFIAARRQHLKEKILPPLAQGKLLLIDRFIDSSIAYQGFGRGLDIGDIHWL 130

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+  + GL R+  R + R+   LD  E+ D  +H + RQ +L I
Sbjct: 131 NQFATDGLKPDLTLYFDIDTEEGLARIA-RNADRDVDRLD-MEKAD--MHRRVRQGYLSI 186

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
              +P+R   +D++   ++V  N L ++ +   +R 
Sbjct: 187 LEQEPERFVKIDASQPLEAVVANALAVIKKRFAERT 222


>gi|332109434|gb|EGJ10357.1| thymidylate kinase / thymidylate synthase [Rubrivivax
           benzoatilyticus JA2]
          Length = 205

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 106/204 (51%), Gaps = 9/204 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G F+SFEGI+GAGK++HI  L  +L+ +  +V VTREPGGT  AE  R ++L   +D
Sbjct: 1   MTAGRFLSFEGIDGAGKSSHIEWLAGWLRERGREVLVTREPGGTELAERLRELVLHQPMD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A  EA++  AAR DH+   I PAL  G ++LCDRF D+++AYQG         L +L
Sbjct: 61  ---ALTEALLVFAARRDHLATRIEPALAAGAVVLCDRFTDATFAYQGAGRGFDLGVLATL 117

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           +    Q   PD T+  DLP                    D FE +D    E+ R  +   
Sbjct: 118 ETWVQQGRQPDLTVWFDLPT------AVAAARRAAVRAPDRFESQDEAFFERVRSGYARR 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A   P R  I+D+A +  +V   +
Sbjct: 172 AAADPGRFVILDAAATPDAVRAQL 195


>gi|125718521|ref|YP_001035654.1| thymidylate kinase [Streptococcus sanguinis SK36]
 gi|166223121|sp|A3CPJ9|KTHY_STRSV RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|125498438|gb|ABN45104.1| Thymidylate kinase, putative [Streptococcus sanguinis SK36]
          Length = 212

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FLQ     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLQNYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVLPALAQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIAKSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|118602262|ref|YP_903477.1| thymidylate kinase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166223114|sp|A1AVP9|KTHY_RUTMC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|118567201|gb|ABL02006.1| thymidylate kinase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 205

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 113/206 (54%), Gaps = 10/206 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ +G+EG+GK+T I  +  +L  K  +V +TREPGGT   E  R +LLS  + 
Sbjct: 1   MQRGKFITIDGVEGSGKSTQIDFICDYLVTKKINVILTREPGGTELGEKIRTLLLSTDIQ 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               + E ++  AAR +H+   I P+L +G  +L DRF D+SYAYQG         +  L
Sbjct: 61  SIHGDTELLLLFAARNEHIRTKIIPSLEKGDWVLSDRFTDASYAYQGGGRGLSIERITQL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQN--RYSLRESACLDYFERKDVMIHEKRRQIFL 178
           ++  +Q+  PD T++LD+ V +G+ RV++  R    E    D+F+R         R  ++
Sbjct: 121 EKWVLQDFTPDVTLLLDVSVALGMSRVESRGRKDRIELETNDFFKRV--------RNSYI 172

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNI 204
           + ++  P R  ++D++ + +  A  I
Sbjct: 173 ERSKQFPKRIKLIDASKTLEQTAQQI 198


>gi|322515570|ref|ZP_08068551.1| dTMP kinase [Actinobacillus ureae ATCC 25976]
 gi|322118373|gb|EFX90639.1| dTMP kinase [Actinobacillus ureae ATCC 25976]
          Length = 208

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 83/208 (39%), Positives = 117/208 (56%), Gaps = 13/208 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI  EG+EGAGKTT   ++   L++   +V   REPGGTP AE  RH++     +   
Sbjct: 3   GKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQIREPGGTPLAEKLRHLIKHETEEAVS 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQE 122
            +AE ++  AAR+  VENVI+PAL EGK +L DR   SS AYQ G R   +HL L++L+E
Sbjct: 63  DKAELLMLYAARIQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHL-LETLKE 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR--ESACLDYFERKDVMIHEKRRQIFLDI 180
             + +  PD TI LD+   IGL R   R  L   E   LD+F R         RQ +L++
Sbjct: 122 TVLGKFEPDLTIYLDIDPAIGLARAIGRGELDRIEQQSLDFFYRT--------RQRYLEL 173

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
            +N  ++  I+++  S + VA +I   V
Sbjct: 174 TQNN-EKAVIINAEQSIEQVAADIQQAV 200


>gi|227533730|ref|ZP_03963779.1| thymidylate kinase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227188714|gb|EEI68781.1| thymidylate kinase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 238

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 113/201 (56%), Gaps = 4/201 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M  G FI+FEG +GAGKT+ + +L+ +  Q     +H+TREPGG   +E  R V+L    
Sbjct: 24  MVKGTFITFEGPDGAGKTSVLKTLIPQLEQHVRVPLHLTREPGGAKISETIREVILDPAN 83

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               A  EA+++AA+R  H+  VI+PAL +G I++CDRF+DSS AYQG         +  
Sbjct: 84  TAMDARTEALLYAASRRQHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLK 143

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           + + +   + P  T+ LD+PV +GL R+++  + R+    D  +++ +  HE+    ++ 
Sbjct: 144 MNQFATAGLEPALTLYLDVPVQVGLDRIKSHQNERQ---YDRLDQESLAFHERVHDAYMT 200

Query: 180 IARNQPDRCHIVDSAHSFQSV 200
           +  + P R   +D+    + V
Sbjct: 201 LIVDNPQRIVSIDATEPLEKV 221


>gi|313891237|ref|ZP_07824855.1| dTMP kinase [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120304|gb|EFR43425.1| dTMP kinase [Streptococcus pseudoporcinus SPIN 20026]
          Length = 209

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 113/213 (53%), Gaps = 5/213 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKN-YDVHVTREPGGTPAAEAARHVLLSCGV 59
           M+ G  I+FEG +GAGKT+ I  L   L+  N  ++ VTREPGG   AE+ R V+L    
Sbjct: 1   MSKGRLITFEGPDGAGKTSVIEGLVPLLENLNQTEIVVTREPGGVSIAESIREVILDVRN 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
                + E +++ AAR  H+   + PAL +G+++L DRF+DSS AYQG         +  
Sbjct: 61  TAMDPKTELLLYIAARRQHLVEKVLPALEQGQMVLIDRFIDSSVAYQGAGRGLSKKAIQW 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L + +   V PD T+  DL  +IGL R+      RE   LD    + + +H++ R  +L+
Sbjct: 121 LNDFATDGVTPDLTLYFDLSPEIGLARIAKNKK-REINRLDM---EKIEMHQQVRNGYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +A+  PDR   VD+  S   V      I+ E V
Sbjct: 177 LAKEFPDRIVTVDATKSLDEVVAQAFEIIKENV 209


>gi|222152616|ref|YP_002561791.1| thymidylate kinase [Streptococcus uberis 0140J]
 gi|254808308|sp|B9DTV7|KTHY_STRU0 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|222113427|emb|CAR41106.1| thymidylate kinase [Streptococcus uberis 0140J]
          Length = 211

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 117/211 (55%), Gaps = 5/211 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKN-YDVHVTREPGGTPAAEAARHVLLSCGV 59
           M  G  I+ EG +GAGKT+ +  L   L++ N   +  TREPGG   +E+ R+++L    
Sbjct: 1   MTKGKIITLEGPDGAGKTSVLEQLVLKLEKDNEQSIVTTREPGGVAISESIRNIILDVNN 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
            E   + E +++ AAR  H+   + P+L  GK++  DRF+DSS AYQGE        ++ 
Sbjct: 61  TEMDFKTELLLYIAARRQHLVEKVLPSLSAGKLVFIDRFIDSSVAYQGEGRGLNKSDIEW 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L + +   + PD T++ D+P +IG+ R+ N+   RE   LD    + + +H+K RQ +L+
Sbjct: 121 LNDFATDGIKPDLTLLFDVPSEIGIARI-NQNVNREINRLDL---EKLEMHQKVRQGYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +A+  PDR  ++D++     V      ++ E
Sbjct: 177 LAKANPDRIVLIDASKPLDDVVDEAYRVIKE 207


>gi|86608314|ref|YP_477076.1| thymidylate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123503195|sp|Q2JN62|KTHY_SYNJB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|86556856|gb|ABD01813.1| thymidylate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 206

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 115/217 (52%), Gaps = 16/217 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG EG GKTT  +LL   L+++ Y    TREPGGT   +  R +LL    D F  
Sbjct: 1   MFITLEGGEGVGKTTQQALLVERLRQEGYACLCTREPGGTALGKTLRELLLHG--DPFSP 58

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE +++AA R +HV  VI PAL  G++++CDRF DS+ AYQG         +  L  ++
Sbjct: 59  LAELLLYAADRAEHVSKVIAPALAAGQVVVCDRFTDSTLAYQGYGRGLDLEKIRQLNHLA 118

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + P  T+ LDLP ++GL R + R         D  E++ +  H +  Q F  +A  +
Sbjct: 119 TGGLQPHLTLWLDLPPEVGLARAKAR---------DRLEQERLEFHRRVYQGFQALAAAE 169

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSS 221
           P R   + +  S   VA  +    W +V+ R+ PL++
Sbjct: 170 PQRIVRISAQGSPAEVAARL----WSVVEPRL-PLAT 201


>gi|253751477|ref|YP_003024618.1| thymidylate kinase [Streptococcus suis SC84]
 gi|253753378|ref|YP_003026519.1| thymidylate kinase [Streptococcus suis P1/7]
 gi|253755793|ref|YP_003028933.1| thymidylate kinase [Streptococcus suis BM407]
 gi|251815766|emb|CAZ51368.1| thymidylate kinase [Streptococcus suis SC84]
 gi|251818257|emb|CAZ56065.1| thymidylate kinase [Streptococcus suis BM407]
 gi|251819624|emb|CAR45362.1| thymidylate kinase [Streptococcus suis P1/7]
 gi|319757895|gb|ADV69837.1| thymidylate kinase [Streptococcus suis JS14]
          Length = 212

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 118/216 (54%), Gaps = 4/216 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G FI+FEG +GAGKTT +  L   LQ    +V  TREPGG   AE  R+++L+    
Sbjct: 1   MRNGFFITFEGPDGAGKTTVLQQLLPALQELGPEVVTTREPGGVAIAEEIRNIILNPANT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               + E ++F AAR  H++  I P L +GK+LL DRF+DSS AYQG         +  L
Sbjct: 61  AMDDKTELLLFIAARRQHLKEKILPPLAQGKLLLIDRFIDSSIAYQGFGRGLDIGDIHWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+  + GL R+  R + R+   LD  E+ D  +H + RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDTEEGLARIA-RNADRDVDRLD-MEKAD--MHRRVRQGYLSI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
              +P+R   +D++   ++V  N L ++ +   +R 
Sbjct: 177 LEQEPERFVKIDASQPLEAVVANALAVIKKRFAERT 212


>gi|242371688|ref|ZP_04817262.1| dTMP kinase [Staphylococcus epidermidis M23864:W1]
 gi|242350637|gb|EES42238.1| dTMP kinase [Staphylococcus epidermidis M23864:W1]
          Length = 208

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 114/195 (58%), Gaps = 8/195 (4%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEG EGAGKT+ I+ + + L  +++DV  TREPGG P  E  R V+L    D     
Sbjct: 7   FITFEGPEGAGKTSVITKVSQKLA-EDFDVITTREPGGVPTGEEIRRVVLDG--DNMDIR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
            EA++FAA+R +H+   + PAL +GKI+LCDR++DSS AYQG         + +L E ++
Sbjct: 64  TEAMLFAASRREHLVEKVIPALKDGKIVLCDRYIDSSLAYQGYARGIGIEEVQTLNEFAI 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD TI LD+  ++G +R+     L+ +   +  +++D   HEK  + +  +    P
Sbjct: 124 NGLYPDLTIYLDVSAEVGRQRI-----LKNNRDQNRLDQEDKAFHEKVIEGYHKVIEGNP 178

Query: 186 DRCHIVDSAHSFQSV 200
           +R   V++  + ++V
Sbjct: 179 ERFVKVNANQNLENV 193


>gi|116495711|ref|YP_807445.1| thymidylate kinase [Lactobacillus casei ATCC 334]
 gi|191639199|ref|YP_001988365.1| thymidylate kinase [Lactobacillus casei BL23]
 gi|122262887|sp|Q035W9|KTHY_LACC3 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|238693006|sp|B3W9Y8|KTHY_LACCB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|116105861|gb|ABJ71003.1| thymidylate kinase [Lactobacillus casei ATCC 334]
 gi|190713501|emb|CAQ67507.1| Thymidylate kinase (dTMP kinase) [Lactobacillus casei BL23]
 gi|327383275|gb|AEA54751.1| Thymidylate kinase [Lactobacillus casei LC2W]
 gi|327386459|gb|AEA57933.1| Thymidylate kinase [Lactobacillus casei BD-II]
          Length = 214

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 113/199 (56%), Gaps = 4/199 (2%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ + +L+ +  Q     +H+TREPGG   +E  R V+L      
Sbjct: 2   TGTFITFEGPDGAGKTSVLKTLIPQLEQHVRVPLHLTREPGGAKISETIREVILDPANTA 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA+++AA+R  H+  VI+PAL +G I++CDRF+DSS AYQG         +  + 
Sbjct: 62  MDARTEALLYAASRRQHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLKMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +   + P  T+ LD+PV +GL R+++  + R+    D  +++ +  HE+    ++ + 
Sbjct: 122 QFATAGLEPALTLYLDVPVQVGLDRIKSHQNERQ---YDRLDQESLAFHERVHDAYMTLI 178

Query: 182 RNQPDRCHIVDSAHSFQSV 200
            + P R   +D+    + V
Sbjct: 179 VDNPQRIVSIDATEPLEKV 197


>gi|162147582|ref|YP_001602043.1| putative thymidylate kinase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542215|ref|YP_002274444.1| dTMP kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786159|emb|CAP55741.1| putative thymidylate kinase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209529892|gb|ACI49829.1| dTMP kinase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 215

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 111/209 (53%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLFI+FEG EGAGK+T    L+  L+    +V  TREPGGTP AEA R +LL  G D  
Sbjct: 2   AGLFITFEGGEGAGKSTQAQRLEAHLRAAGREVVRTREPGGTPGAEALRQLLLFGGHD-L 60

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG---ERDSSQHLFLDS 119
              AE +   AAR DHV+ +IRPAL  G +++CDRF+DS+ AYQG    R     L L +
Sbjct: 61  SLRAEILAHFAARCDHVDQLIRPALARGAVVICDRFIDSTLAYQGYGLGRADPGILHLIA 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +    V  + PD T++L L     L R++ R         D +E  D   H +    F  
Sbjct: 121 VLGAQVG-LAPDLTLVLMLERAGALARLRAR-----GGPADRYEAADEAFHARVADGFDT 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           IAR +  RC  + +      VA +I  +V
Sbjct: 175 IARAEAGRCVTIAADRPVDVVAGDIARLV 203


>gi|329666793|gb|AEB92741.1| thymidylate kinase [Lactobacillus johnsonii DPC 6026]
          Length = 213

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 117/209 (55%), Gaps = 11/209 (5%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G  I+FEG +GAGKTT I+ ++K+  Q       VTREPGG+  +E  R ++L     E 
Sbjct: 3   GYLITFEGPDGAGKTTVINEIIKQLPQSLQERTLVTREPGGSKISENIRTIILDPKNKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  HV  VIRPAL  GK++L DRF+DSS AYQG     ++L ++ +++
Sbjct: 63  DDRTEALLYAAQRSQHVSEVIRPALAAGKVVLSDRFIDSSLAYQG---VGRNLGVEEVKQ 119

Query: 123 IS---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I+      + P+ TI LDL   +GL R++   + +E    D  E++ +  H K    + +
Sbjct: 120 INDFGTGGLEPNLTIFLDLDPAVGLARIEKERAGQE----DRLEQEKIDFHNKVYAGYRE 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +    PDR   VD+    + VA N + I+
Sbjct: 176 LLERYPDRIKKVDANLPIKDVAANSVKII 204


>gi|325690660|gb|EGD32661.1| thymidylate kinase [Streptococcus sanguinis SK115]
          Length = 212

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FLQ     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLQSYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVLPALAQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIAKSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|297193021|ref|ZP_06910419.1| thymidylate kinase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197719849|gb|EDY63757.1| thymidylate kinase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 1039

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 69/200 (34%), Positives = 108/200 (54%), Gaps = 8/200 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+ EG +GAGK+T +  L  +++ K ++V VTREPG TP  +  R +LL       
Sbjct: 520 SGFFIAVEGGDGAGKSTQVEALAEWIRAKGHEVVVTREPGATPVGKRLRSILLDVSSAGL 579

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R +HV++VIRPAL  G I++ DR++DSS AYQG         +  +  
Sbjct: 580 SNRAEALLYAADRAEHVDSVIRPALDRGAIVISDRYIDSSVAYQGAGRDLSPTEIARISR 639

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P+ T++LD+  +   +R         +   D  E +    H++ R  FL +A 
Sbjct: 640 WATDGLVPNLTVLLDVSPEAARERF--------TEAPDRLESEPAEFHQRVRSGFLTLAA 691

Query: 183 NQPDRCHIVDSAHSFQSVAT 202
             P R  +VD+     SV T
Sbjct: 692 ADPGRYLVVDAGQEPGSVTT 711


>gi|229074092|ref|ZP_04207139.1| Thymidylate kinase [Bacillus cereus Rock4-18]
 gi|228708986|gb|EEL61112.1| Thymidylate kinase [Bacillus cereus Rock4-18]
          Length = 208

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 117/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKKLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 ISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I++   ++ MP  TI LD+  +IGL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INLFATEDCMPSVTIYLDIEPEIGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|325912933|ref|ZP_08175307.1| dTMP kinase [Lactobacillus iners UPII 60-B]
 gi|325477747|gb|EGC80885.1| dTMP kinase [Lactobacillus iners UPII 60-B]
          Length = 213

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 117/213 (54%), Gaps = 11/213 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FISFEG +GAGKTT I+ L + L  K    + VTREPGG+  +E  R ++L     E 
Sbjct: 3   GYFISFEGPDGAGKTTIINELVQQLSSKTIAPILVTREPGGSKISENIRKIILDPKNKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE EA+++AAAR  HV   I PAL  GKI+  DRF+DSS AYQG     + L +D +++
Sbjct: 63  NAETEALLYAAARSQHVIETIIPALNAGKIVFSDRFIDSSLAYQG---IGRDLGIDEIKQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + + + PD TI  D+    GL+R+Q      E    D  E+++ + H+K    +  
Sbjct: 120 INEFATRHITPDLTIFFDIDPLKGLQRIQKVRPENE----DRLEQENNLFHQKVYTGYKQ 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +    P+R   VD+  S   V +  + I+ E +
Sbjct: 176 LLSAYPERIKRVDAELSIAEVVSQSVKILEEYM 208


>gi|307729688|ref|YP_003906912.1| thymidylate kinase [Burkholderia sp. CCGE1003]
 gi|307584223|gb|ADN57621.1| thymidylate kinase [Burkholderia sp. CCGE1003]
          Length = 206

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 115/215 (53%), Gaps = 13/215 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH++  +  L++K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLAWFRERLEQKVAATGRAVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QKMD---LETEALLMFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DL  +I  +R   R + R+    D FER+     E+ R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLAPEIANER---RSAARDP---DRFERESAAFFERTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
           +L  A   P R  I+DS+ S   +   + +++ +L
Sbjct: 172 YLRRAEEAPYRFAIIDSSQSIVRIQKQLEDLLAKL 206


>gi|227510683|ref|ZP_03940732.1| thymidylate kinase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227189804|gb|EEI69871.1| thymidylate kinase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 216

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 119/210 (56%), Gaps = 4/210 (1%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ ++ ++ +F ++    + VTREPGG   +E  R V+L     E
Sbjct: 2   TGKFITFEGPDGAGKTSVMNEVVNQFQKQLGDHLIVTREPGGNKISEQIRRVILDRKNTE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   I PAL   K++LCDR++DSS AYQG         +  + 
Sbjct: 62  MDYRTEALLYAAARRQHLVETILPALQADKLVLCDRYVDSSVAYQGAGREIGMQAVARMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E + ++++P  TI  D+PV++GL R+      R+S+ +D  + +    H++  Q ++ + 
Sbjct: 122 EFATEKILPYKTIYFDIPVEVGLNRIAKH---RDSSKIDRLDVETTAFHKRVHQGYMKLI 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
               DR  I+D+    + V  +  +++ ++
Sbjct: 179 GEYNDRFIIIDATQPIEKVIQDTTDVIHQI 208


>gi|313900951|ref|ZP_07834441.1| dTMP kinase [Clostridium sp. HGF2]
 gi|312954371|gb|EFR36049.1| dTMP kinase [Clostridium sp. HGF2]
          Length = 210

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 6/216 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MN GLFI+FEG +G+GKTT   L    L+   Y V  TREPGG   AE  R ++L     
Sbjct: 1   MNKGLFITFEGNDGSGKTTISKLAYEKLKEMGYPVLYTREPGGIDIAEQIRSIILDPANT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AA+R  H+   + PAL EGKI+LCDRF+DSS  YQG         + ++
Sbjct: 61  AMDERCEALLYAASRRQHLIEKVLPALKEGKIVLCDRFVDSSLVYQGIARGIGVEEVFAI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +++  +PD T+ L +  + GL RV +R         D  + + +  H+   Q +  I
Sbjct: 121 NQFAIEGHLPDATVFLSVDFETGLSRVTSR------GNKDRLDNESMEFHKLVAQGYELI 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
                +R HIVD+     +V  N +  + E+++  V
Sbjct: 175 KDKFKERMHIVDANPDVDTVLNNTVACLMEIIKNHV 210


>gi|324993714|gb|EGC25633.1| thymidylate kinase [Streptococcus sanguinis SK405]
 gi|324994973|gb|EGC26886.1| thymidylate kinase [Streptococcus sanguinis SK678]
 gi|327462985|gb|EGF09306.1| thymidylate kinase [Streptococcus sanguinis SK1]
 gi|327474588|gb|EGF19993.1| thymidylate kinase [Streptococcus sanguinis SK408]
          Length = 212

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FL+     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLKNYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GKI+L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVLPALAQGKIVLMDRFIDSSVAYQGYGRGLDVTDIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+  R   RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIA-RSESREVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|239630116|ref|ZP_04673147.1| thymidylate kinase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301067265|ref|YP_003789288.1| thymidylate kinase [Lactobacillus casei str. Zhang]
 gi|239527728|gb|EEQ66729.1| thymidylate kinase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439672|gb|ADK19438.1| Thymidylate kinase [Lactobacillus casei str. Zhang]
          Length = 214

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 113/199 (56%), Gaps = 4/199 (2%)

Query: 3   SGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ + +L+ +  Q     +H+TREPGG   +E  R V+L      
Sbjct: 2   TGTFITFEGPDGAGKTSVLKTLIPQLEQHVRVPLHLTREPGGAKISETIREVILDPANTA 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
             A  EA+++AA+R  H+  VI+PAL +G I++CDRF+DSS AYQG         +  + 
Sbjct: 62  MDARTEALLYAASRRQHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLKMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + +   + P  T+ LD+PV +GL R+++  + R+    D  +++ +  HE+    ++ + 
Sbjct: 122 QFATAGLEPALTLYLDVPVQMGLDRIKSHQNERQ---YDRLDQESLAFHERVHDAYMTLI 178

Query: 182 RNQPDRCHIVDSAHSFQSV 200
            + P R   +D+    + V
Sbjct: 179 VDNPQRIVSIDATEPLEKV 197


>gi|326772517|ref|ZP_08231801.1| dTMP kinase [Actinomyces viscosus C505]
 gi|326637149|gb|EGE38051.1| dTMP kinase [Actinomyces viscosus C505]
          Length = 269

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 110/213 (51%), Gaps = 8/213 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             GLFISFEG +G GKTT I +L   L   + D  +TREPGGT      R +LL  G   
Sbjct: 26  GPGLFISFEGGDGVGKTTQIRILADLLTAADVDHVLTREPGGTELGVEIRRLLLHGG--H 83

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AEA+++AA R  H+   +RPAL  G ++L DR+LDSS AYQG   S     +  L 
Sbjct: 84  VAPRAEALLYAADRAHHIATRVRPALERGAVVLADRYLDSSVAYQGAARSLGPQEVRDLS 143

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             + + ++PD T++LD   D+  +R   R         D  E++        R+ FL +A
Sbjct: 144 LWATEGLLPDLTVLLDGDPDLAERRTTGR------GAKDRLEQEGDAFRVALREQFLTLA 197

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
             +P+R  +VD+      VA +++  V   V++
Sbjct: 198 EGEPERFVVVDADRPVDQVADDVIEAVVAAVRR 230


>gi|312864169|ref|ZP_07724403.1| dTMP kinase [Streptococcus vestibularis F0396]
 gi|322517269|ref|ZP_08070148.1| thymidylate kinase [Streptococcus vestibularis ATCC 49124]
 gi|311100170|gb|EFQ58379.1| dTMP kinase [Streptococcus vestibularis F0396]
 gi|322124175|gb|EFX95709.1| thymidylate kinase [Streptococcus vestibularis ATCC 49124]
          Length = 209

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 5/209 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHI-SLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV 59
           M+ GL IS EG +GAGKTT + +LL R  +     V  TREPGG   AE  R V+L    
Sbjct: 1   MSKGLLISIEGPDGAGKTTVLEALLPRLREAYPAKVVTTREPGGVAIAEQIREVILDVNN 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
               A+ E +++ AAR  H+   + P L EG +++ DRF+DSS AYQG         +  
Sbjct: 61  TAMDAKTELLLYIAARRQHLVERVLPELEEGNMVIMDRFIDSSVAYQGTGRGLNQDEIAW 120

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L   +     PD T++ D+  + GL R+      RE   LD  E+ D  +H++ RQ +LD
Sbjct: 121 LNAYATDGYKPDVTLLFDVDSETGLARIAANGE-REVNRLD-LEKLD--LHQRVRQGYLD 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +A+ +P+R  I+D++ +F+ V      ++
Sbjct: 177 LAQAEPERIKIIDASQAFEDVVEEAWKVI 205


>gi|323490969|ref|ZP_08096163.1| thymidylate kinase [Planococcus donghaensis MPA1U2]
 gi|323395325|gb|EGA88177.1| thymidylate kinase [Planococcus donghaensis MPA1U2]
          Length = 216

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 4/214 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G  I+ EG EG+GK+T + +L   L  K + V  TREPGG   AE  R V+L+       
Sbjct: 2   GYLINLEGGEGSGKSTVLKMLAEALTEKGFSVVCTREPGGIDIAEQIREVILNRENTAMD 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           A  EA+++AAAR  H+   I PAL  G I+LCDR++DSS AYQG         + ++ + 
Sbjct: 62  ARTEALLYAAARRQHLVEKIIPALETGSIVLCDRYIDSSLAYQGYARGLGMEEIFAINKF 121

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++ E MPD T+  D+   +GL R++ + + RE   LD    + +  H K R+ +L +   
Sbjct: 122 AIDEYMPDLTLYFDVNPKVGLARIE-KDAGREVNRLDV---ESMKFHYKVREGYLLLLSK 177

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
            P+R  +V++ +    V T+ L      +++R S
Sbjct: 178 NPERIRLVNAENELPIVFTDALETAVRFIEERQS 211


>gi|313201192|ref|YP_004039850.1| thymidylate kinase [Methylovorus sp. MP688]
 gi|312440508|gb|ADQ84614.1| thymidylate kinase [Methylovorus sp. MP688]
          Length = 201

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 113/199 (56%), Gaps = 13/199 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+THI  +   LQ +  +V  TREPGGT   E  R VLL   +    
Sbjct: 3   GKFITLEGMDGAGKSTHIPDILAQLQTRGVEVISTREPGGTALGEQLREVLLHTPM---A 59

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ--GERDSSQHLFLDSLQ 121
           AE E+++  AAR +H+  +I PAL  G  +L DRF D+S+AYQ  G   +S+   +  L+
Sbjct: 60  AETESLLMFAARQEHLSTLILPALERGAYVLSDRFTDASFAYQHGGRGLASER--IAQLE 117

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   Q + PD T++ D+PV++ ++R      L  +   D FER+      + R+ +LD A
Sbjct: 118 QWVQQGLQPDLTLLFDVPVEVSVQR------LAAARTPDKFERESADFFRRIRRAYLDRA 171

Query: 182 RNQPDRCHIVDSAHSFQSV 200
           +  P+R  I+DS    + V
Sbjct: 172 QQFPERFRIIDSNQPLEQV 190


>gi|261364212|ref|ZP_05977095.1| dTMP kinase [Neisseria mucosa ATCC 25996]
 gi|288567825|gb|EFC89385.1| dTMP kinase [Neisseria mucosa ATCC 25996]
          Length = 208

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 117/199 (58%), Gaps = 7/199 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T++++++++ +  +  V  TREPGGTP  EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAVIRQWFESHHLPVLFTREPGGTPVGEALREILLNPET-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  AAR  H+E+VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFAARQQHLEDVILPALADGVHVVSDRFTDATFAYQGGGRGVPLQDIEMLENWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
               PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GGFGPDLTLLLDVPLEVSMARIGQ---TREK---DRFEQEQADFFTRVRAVYLERAAAHP 177

Query: 186 DRCHIVDSAHSFQSVATNI 204
           +R  ++DS  S + V  +I
Sbjct: 178 ERYALIDSNRSLEEVRADI 196


>gi|189183417|ref|YP_001937202.1| thymidylate kinase [Orientia tsutsugamushi str. Ikeda]
 gi|238692237|sp|B3CR61|KTHY_ORITI RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|189180188|dbj|BAG39968.1| thymidylate kinase [Orientia tsutsugamushi str. Ikeda]
          Length = 217

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 4/205 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG+GKTT   LL   L         TRE GGT  AE  R ++L     +  
Sbjct: 7   GKFITFEGNEGSGKTTQSKLLYEKLLDNGIKAVWTREIGGTDIAELIRDIVL---FKDMS 63

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR +H+E  IRP L EGK ++CDRF+DS+  YQ E    Q L L+ L   
Sbjct: 64  ITTELLLIMAARYEHIEKFIRPNLNEGKWVICDRFIDSTLCYQSENSEEQQLILE-LHRK 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +    PD T+I+++   I ++R++ R   + +  L+ F+ ++   H+K    F+ +++ 
Sbjct: 123 LLDNFFPDLTLIINVSPSIAMQRIKIREIHKNTNQLNKFDSRNQQFHQKITDAFIQVSKL 182

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P+R   ++     + V++ ++NI+
Sbjct: 183 FPERIVQINGEPMIEDVSSEVINII 207


>gi|284028576|ref|YP_003378507.1| thymidylate kinase [Kribbella flavida DSM 17836]
 gi|283807869|gb|ADB29708.1| thymidylate kinase [Kribbella flavida DSM 17836]
          Length = 661

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 121/221 (54%), Gaps = 17/221 (7%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
            +GLFI+FEG EGAGK+T  +LL ++L+ +   V +TREPG T   +  R ++L     +
Sbjct: 456 TTGLFIAFEGGEGAGKSTQSALLVKWLEERGQHVLLTREPGATDLGKTLRQIVLDPATGD 515

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AEA+++AA + +HV++VI+PAL  G +++ DR++DS+ AYQG         ++ + 
Sbjct: 516 ISHRAEALIYAADKAEHVDSVIKPALKAGTVVITDRYVDSALAYQGSGRDLDLADVERVN 575

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +  ++ P+ TI+LDLP   GL R + R         D  E +    HE+ R  FL++A
Sbjct: 576 RWATDDLRPNLTILLDLPPKSGLGRFEER---------DRIEAQSADFHERVRAAFLELA 626

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSK 222
             +P    ++D+    + +A  I        Q R+ P+  K
Sbjct: 627 AAEPQHYLVLDATQDREQLAAQI--------QARLLPMLPK 659


>gi|329766836|ref|ZP_08258365.1| thymidylate kinase [Gemella haemolysans M341]
 gi|328838562|gb|EGF88168.1| thymidylate kinase [Gemella haemolysans M341]
          Length = 208

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 120/208 (57%), Gaps = 13/208 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG +G+GKT+ I+    +L RK Y V  TREPGGT  +E  R +L     D   
Sbjct: 3   GKFITVEGSDGSGKTSFINFATEYLTRKGYKVITTREPGGTDFSEKVRELLFDSSND-ID 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDSLQE 122
           A+ E+++F A+R DH+   I P + EG I++CDRF+DSS AYQ   R  S+   LD +  
Sbjct: 62  AKTESLLFCASRRDHIVKKILPHVNEGYIVICDRFVDSSVAYQSYGRGLSKQDILD-INA 120

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNR--YSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +   + PD T+   + V++GL R +NR   +  +   LD++  K+V      ++ + D+
Sbjct: 121 YATDNLEPDLTLYFSVDVEVGLARTKNRDDNNRMDQESLDFY--KNV------KRGYDDL 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           ++   +R  ++D++ ++++V    L+I+
Sbjct: 173 SKENTERIKVIDASDTYENVQKQALSIL 200


>gi|253999090|ref|YP_003051153.1| thymidylate kinase [Methylovorus sp. SIP3-4]
 gi|253985769|gb|ACT50626.1| thymidylate kinase [Methylovorus sp. SIP3-4]
          Length = 201

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 112/198 (56%), Gaps = 11/198 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+THI  +   LQ +  +V  TREPGGT   E  R VLL   +    
Sbjct: 3   GKFITLEGMDGAGKSTHIPDILAQLQTRGVEVISTREPGGTALGEQLREVLLHTPM---A 59

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQE 122
           AE E+++  AAR +H+  +I PAL  G  +L DRF D+S+AYQ G R  +    +  L++
Sbjct: 60  AETESLLMFAARQEHLSTLILPALERGAYVLSDRFTDASFAYQHGGRGLAAER-IAQLEQ 118

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
              Q + PD T++ D+PV++ ++R      L  +   D FER+      + R+ +LD A+
Sbjct: 119 WVQQGLQPDLTLLFDVPVEVSVQR------LAAARTPDKFERESADFFRRIRRAYLDRAQ 172

Query: 183 NQPDRCHIVDSAHSFQSV 200
             P+R  I+DS    + V
Sbjct: 173 QFPERFRIIDSNQPLEQV 190


>gi|309806674|ref|ZP_07700670.1| dTMP kinase [Lactobacillus iners LactinV 03V1-b]
 gi|308166979|gb|EFO69162.1| dTMP kinase [Lactobacillus iners LactinV 03V1-b]
          Length = 213

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 117/211 (55%), Gaps = 11/211 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FISFEG +GAGKTT I+ L + L  K    + VTREPGG+  +E  R+++L     E 
Sbjct: 3   GYFISFEGPDGAGKTTIINELVQQLSSKTIAPILVTREPGGSKISENIRNIILDPKNKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE EA+++AAAR  HV   I PAL  GKI+  DRF+DSS AYQG     + L +D +++
Sbjct: 63  NAETEALLYAAARSQHVIETIIPALNAGKIVFSDRFIDSSLAYQG---IGRDLGIDEIKQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + + + PD T+  D+    GL+R+Q      E    D  E+++ + H+K    +  
Sbjct: 120 INEFATRHITPDLTLFFDIDPLKGLQRIQKVRPENE----DRLEQENNLFHQKVYTGYKQ 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +    P+R   VD+  S   V +  + I+ E
Sbjct: 176 LLSAYPERIKRVDAELSIAEVVSQSVKILEE 206


>gi|259047401|ref|ZP_05737802.1| dTMP kinase [Granulicatella adiacens ATCC 49175]
 gi|259035592|gb|EEW36847.1| dTMP kinase [Granulicatella adiacens ATCC 49175]
          Length = 215

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 112/208 (53%), Gaps = 4/208 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           GLFI+ EG +GAGKTT I+ L   LQ+    D+  TREPGG+  AE  R V+L     E 
Sbjct: 3   GLFITMEGPDGAGKTTVINQLIPLLQKHALVDIVSTREPGGSRIAEDIRKVILDVNNTEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EAI++AA R  H+++ I P L +G I+ CDRF+DSS  YQG         +  L  
Sbjct: 63  DERTEAILYAAGRRQHLKDRILPNLEKGNIVFCDRFVDSSLVYQGVARGIGVEEVAELNR 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + P  T+ LD+P ++GL+R+   +  R +   D  +++ +  H   R+ +L++ +
Sbjct: 123 FATDGLSPSTTLYLDVPAEVGLERI---HKARGNRQFDRLDQEGLSFHTMVREGYLELLK 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWE 210
             P+R   +D+  + + V      ++ E
Sbjct: 180 KYPERMVSIDATQTIEEVVNECFKVLVE 207


>gi|117925167|ref|YP_865784.1| thymidylate kinase [Magnetococcus sp. MC-1]
 gi|171460782|sp|A0L8T5|KTHY_MAGSM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|117608923|gb|ABK44378.1| thymidylate kinase [Magnetococcus sp. MC-1]
          Length = 210

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 116/212 (54%), Gaps = 9/212 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EGAGK+T I+ L + LQ     V  TREPGG P +E  R +L++   D+  
Sbjct: 3   GRFITFEGGEGAGKSTQIAQLTQSLQAHGVKVLCTREPGGCPISERIREILVTGQGDDLD 62

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
             +E ++  AAR +H+  VIRPAL  G  +LCDRF DS+ AYQG        +L  L + 
Sbjct: 63  GTSELLLILAARHEHIRQVIRPALASGHWVLCDRFEDSTLAYQGGGRGGDGPWLRQLGQW 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              +V PD T++LDL   +GL R     S R       FE++ +  H++ RQ FL +A+ 
Sbjct: 123 IRGDVFPDLTLLLDLDPTVGLAR-----SKRRGGQEQRFEQEALSFHQQVRQAFLQMAQQ 177

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           +P R   +D+    Q VA  I    W  V+ R
Sbjct: 178 EPQRMIPIDADQPVQMVAATI----WREVEGR 205


>gi|291278502|ref|YP_003495337.1| dTMP kinase [Deferribacter desulfuricans SSM1]
 gi|290753204|dbj|BAI79581.1| dTMP kinase [Deferribacter desulfuricans SSM1]
          Length = 215

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 119/213 (55%), Gaps = 8/213 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           +    F+  +GI+G GKTT   LLK +L     ++ +T+EPGGT      R++L+S   D
Sbjct: 4   IKKSFFLVIDGIDGCGKTTQCKLLKEYLNNIGLNILLTKEPGGTKTGTILRNILISTDYD 63

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 E ++++A RL+H + +I P L  GK ++CDRF+ S+YAYQ      +  FL  L
Sbjct: 64  -IEPNTELLLYSADRLEHQKKIIIPGLNSGKTIICDRFISSTYAYQIFARGLEKSFLQYL 122

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD---YFERKDVMIHEKRRQIF 177
           ++ +V +  PD TII+DLPV+I L+R   R  L++  C +    FE+  +  ++K R+ F
Sbjct: 123 EQHTVFK-WPDLTIIIDLPVEIALERALKR--LKDQNCENSEGKFEKNGIDFYKKVREGF 179

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           L  ++N  +   +++      S+   I +IV E
Sbjct: 180 LWYSKNYKN-VKVINGDRDIDSLFKEIKSIVNE 211


>gi|187923929|ref|YP_001895571.1| thymidylate kinase [Burkholderia phytofirmans PsJN]
 gi|229470188|sp|B2T436|KTHY_BURPP RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|187715123|gb|ACD16347.1| dTMP kinase [Burkholderia phytofirmans PsJN]
          Length = 206

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 111/212 (52%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH+S  +  L++K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLSWFRERLEQKVASTGRSVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QKMD---LETEALLMFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DL  +I  +R   R + R+    D FE + V    + R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLAPEIANER---RSAARDP---DRFESESVAFFNRTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +L  A   P R  I+DSA S   +   +  ++
Sbjct: 172 YLRRAEEAPYRFAIIDSAQSIVQIQRKLEELI 203


>gi|226309662|ref|YP_002769556.1| thymidylate kinase [Brevibacillus brevis NBRC 100599]
 gi|226092610|dbj|BAH41052.1| thymidylate kinase [Brevibacillus brevis NBRC 100599]
          Length = 213

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 119/212 (56%), Gaps = 10/212 (4%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             G FI+ EG EGAGK+T I+ L   L+ +  DV +TREPGG   AE  R ++L+    +
Sbjct: 7   KKGRFITIEGGEGAGKSTVIAKLYEELKTRGVDVLLTREPGGIDIAEKIREIILNPAHTQ 66

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   + PAL EGK++LCDRF+DSS AYQG    ++ L +D++ 
Sbjct: 67  MDERTEALLYAAARGQHLAEKVLPALAEGKLVLCDRFIDSSLAYQGH---ARGLGIDAVY 123

Query: 122 EI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +I   +V + MP+ T+  D+  + GL R+ N    RE   LD    + +  HE  R+ + 
Sbjct: 124 QINRFAVGDCMPELTLFFDVQPETGLARI-NASRGREVNRLDL---EGMRFHELVREGYQ 179

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
            +    P+R  ++D+    + V  + L  + +
Sbjct: 180 LVMERDPERFVVIDAEQPMEQVYQSALQALLD 211


>gi|309810854|ref|ZP_07704655.1| dTMP kinase [Dermacoccus sp. Ellin185]
 gi|308435160|gb|EFP58991.1| dTMP kinase [Dermacoccus sp. Ellin185]
          Length = 268

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 14/213 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           GLF++FEG +GAGKTT I     +L+    +V +TREPGGTP     R +LL    D+  
Sbjct: 56  GLFVTFEGGDGAGKTTQIERAAAWLRELGREVVITREPGGTPLGVEIRRLLLHG--DDVA 113

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
           + AEA+++AA R  HVE ++RPAL  G ++L DR++DSS AYQG   + + L  D ++ I
Sbjct: 114 SRAEALLYAADRAHHVETLVRPALARGAVVLQDRYIDSSIAYQG---AGRALAADDVESI 170

Query: 124 S---VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           S    + + PD T+++D+  ++  +R   R         D  ER+    H + R+ FL +
Sbjct: 171 SRWATRGLTPDVTVLIDVSPEVARERRGAR------GAEDRLEREADDFHTRVREHFLRL 224

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           A     R  ++D+  S   +   +   + +L++
Sbjct: 225 AARDEARYLVLDAGRSRDDLTAAVRTRLEQLLE 257


>gi|295099397|emb|CBK88486.1| thymidylate kinase [Eubacterium cylindroides T2-87]
          Length = 210

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 118/220 (53%), Gaps = 18/220 (8%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+F++FEG +G+GKTT    +   L++  YDV  TREPGG+  AE+ R++LL     
Sbjct: 1   MKQGVFLTFEGNDGSGKTTVCKAICEELKKLGYDVVYTREPGGSKIAESIRNILLDVENT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG-ERDSSQHLFLDS 119
                 EA+++AA+R  H+++ + PAL    I+LCDRF+DSS AYQG  RD       D 
Sbjct: 61  GMDPRTEALLYAASRRQHLKDRVLPALKNKSIVLCDRFVDSSLAYQGYARDLGMQEVYD- 119

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRV-----QNRYSLRESACLDYFERKDVMIHEKRR 174
           + + ++   MP  T  L + ++ G KR+     +NR  L +S             H+K R
Sbjct: 120 INQFAIDGCMPIKTFFLSVSIETGQKRMDLRGDKNRLDLEQSD-----------FHKKVR 168

Query: 175 QIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           + +  +    P+R  ++D+    + V  N LN V +++ +
Sbjct: 169 EGYAKLIEMYPERICVIDAEPELKVVVKNTLNEVMKVIHE 208


>gi|325694989|gb|EGD36893.1| thymidylate kinase [Streptococcus sanguinis SK150]
          Length = 212

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 113/210 (53%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FLQ     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLQSYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLAERVLPALTQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
              +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NRFATDGLKPDLTLYFDIDVEEGLARIARSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|323697768|ref|ZP_08109680.1| thymidylate kinase [Desulfovibrio sp. ND132]
 gi|323457700|gb|EGB13565.1| thymidylate kinase [Desulfovibrio desulfuricans ND132]
          Length = 213

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 111/206 (53%), Gaps = 3/206 (1%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGIEG GK+T I  ++ + + +  +V +T EPGG+      R +LL     E   
Sbjct: 1   MFITFEGIEGTGKSTQIGRVRDYFEARGREVLLTLEPGGSRIGVELRKMLLHVDNREITP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             E  ++ A R  HV  VIRPAL  GK++LCDRF DS+  YQG         L  L E++
Sbjct: 61  ITELFLYLADRAQHVGQVIRPALAAGKVVLCDRFADSTIVYQGYGRGLDTSMLRELNEVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLD--YFERKDVMIHEKRRQIFLDIAR 182
           V  + PD TI+LD+  +IGLKR   R ++ +    +   FE + +  H++ R+ +L  A 
Sbjct: 121 VNGLWPDLTIVLDIDPEIGLKRATLR-NIEDGKAKEEGRFEAEHLSFHKRIREGYLTWAA 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIV 208
               R  +VD+A +   V   I  ++
Sbjct: 180 LNHRRMSVVDAAGTPDQVFDQIRAVI 205


>gi|229170881|ref|ZP_04298484.1| Thymidylate kinase [Bacillus cereus MM3]
 gi|228612547|gb|EEK69766.1| Thymidylate kinase [Bacillus cereus MM3]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 117/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   NGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  +IGL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEIGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|124267049|ref|YP_001021053.1| thymidylate kinase / thymidylate synthase [Methylibium
           petroleiphilum PM1]
 gi|124259824|gb|ABM94818.1| thymidylate kinase / thymidylate synthase [Methylibium
           petroleiphilum PM1]
          Length = 215

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 114/213 (53%), Gaps = 15/213 (7%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FISFEGI+GAGK++H+  +    QR+  +V  TREPGGTP AE  R ++L  G+D  
Sbjct: 10  SGRFISFEGIDGAGKSSHLDAVAERWQRRGLEVVRTREPGGTPLAETLRDLVLHQGMD-- 67

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA++  AAR +H++  I PAL  G ++LCDRF D+++AYQG         L +L E
Sbjct: 68  -ALTEALLIFAARRNHLQQCIAPALERGAVVLCDRFTDATFAYQGAGRGFDLAVLTTL-E 125

Query: 123 ISVQEV-----MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
             VQ        PD T+  DL   +  +R      L  +   D FER+D     + R  +
Sbjct: 126 SWVQRGPGGLRQPDLTLWFDLDPAVAAQR------LVAARTPDRFERQDEAFFHRVRDGY 179

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
                 QP+R   +D++ S   VA  I  ++ E
Sbjct: 180 RARFEAQPERFVRIDASQSRDQVAVQIAAMLAE 212


>gi|206972586|ref|ZP_03233529.1| thymidylate kinase [Bacillus cereus AH1134]
 gi|228950579|ref|ZP_04112714.1| Thymidylate kinase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|229067795|ref|ZP_04201113.1| Thymidylate kinase [Bacillus cereus F65185]
 gi|229077306|ref|ZP_04209987.1| Thymidylate kinase [Bacillus cereus Rock4-2]
 gi|229176631|ref|ZP_04304036.1| Thymidylate kinase [Bacillus cereus 172560W]
 gi|229188316|ref|ZP_04315365.1| Thymidylate kinase [Bacillus cereus ATCC 10876]
 gi|206732488|gb|EDZ49667.1| thymidylate kinase [Bacillus cereus AH1134]
 gi|228595115|gb|EEK52885.1| Thymidylate kinase [Bacillus cereus ATCC 10876]
 gi|228606798|gb|EEK64214.1| Thymidylate kinase [Bacillus cereus 172560W]
 gi|228705997|gb|EEL58304.1| Thymidylate kinase [Bacillus cereus Rock4-2]
 gi|228715279|gb|EEL67137.1| Thymidylate kinase [Bacillus cereus F65185]
 gi|228809054|gb|EEM55538.1| Thymidylate kinase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEKKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|86607432|ref|YP_476195.1| thymidylate kinase [Synechococcus sp. JA-3-3Ab]
 gi|123504727|sp|Q2JR37|KTHY_SYNJA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|86555974|gb|ABD00932.1| thymidylate kinase [Synechococcus sp. JA-3-3Ab]
          Length = 204

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 110/212 (51%), Gaps = 15/212 (7%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+ EG EG GKTT  +LL   LQR+ Y    TREPGGT   EA R +LL    D    
Sbjct: 1   MFITLEGGEGVGKTTQQALLAERLQREGYACVSTREPGGTALGEALRELLLHG--DPLTP 58

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            AE +++AA R +HV  VI PAL  G++++CDRF DS+ AYQG         +  L  ++
Sbjct: 59  LAELLLYAADRAEHVNKVIAPALAVGQVVICDRFTDSTLAYQGYGRGLNLEQIRQLNHLA 118

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + P  T+ LDL  ++GL R         S   D  E++ +  H +  + F  +A  +
Sbjct: 119 TGGLQPQLTLWLDLAPEVGLAR---------SRLGDKLEQEHLEFHRRVYRGFQALAAAE 169

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
           P R   +D+  S   VA  I    W +V+ R+
Sbjct: 170 PQRIVRIDAGGSPLEVAARI----WSVVKPRL 197


>gi|325570727|ref|ZP_08146453.1| thymidylate kinase [Enterococcus casseliflavus ATCC 12755]
 gi|325156573|gb|EGC68753.1| thymidylate kinase [Enterococcus casseliflavus ATCC 12755]
          Length = 220

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 112/210 (53%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQ-RKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +GLFI+ EG +GAGKT+ I  L   LQ      +  TREPGG   AE  R ++L    +E
Sbjct: 7   NGLFITIEGPDGAGKTSVIEELYPRLQLEATRKIVKTREPGGVKIAEKIRKIILDPRNEE 66

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+  V+ PAL  G I++CDRF+DSS AYQG         +  + 
Sbjct: 67  MDERTEALLYAAARRQHLIEVVLPALNAGHIVICDRFVDSSLAYQGAGRRIGIPEIARIN 126

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E + +   PD T+ LD+  D GL+R+Q NR     +   D  + + +  H++ R  +L +
Sbjct: 127 EFATEGTTPDFTLYLDVDSDTGLRRIQENR-----AHQYDRLDSEGLEFHQRVRHAYLKL 181

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A   P R H +D+    Q V  +  + + E
Sbjct: 182 AEENPVRIHKIDARMGLQEVVESSYSAIVE 211


>gi|269925799|ref|YP_003322422.1| thymidylate kinase [Thermobaculum terrenum ATCC BAA-798]
 gi|269789459|gb|ACZ41600.1| thymidylate kinase [Thermobaculum terrenum ATCC BAA-798]
          Length = 216

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 118/213 (55%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG EG+GKTT   +L   L+     V +TREPGGT   E  R +LL     +   
Sbjct: 1   MFITFEGPEGSGKTTQARMLATALETLQCKVVLTREPGGTLVGEEIRKILLGPLGKDLDP 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
           +   ++F+AAR   V ++I+PA+  GKI++CDR+ DS+ AYQ   D      ++   ++ 
Sbjct: 61  KCILLLFSAARAQLVRHIIKPAIDSGKIVICDRYADSTRAYQWGGDGIPRDEVERAIQLG 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
            + + PD T  LDL  + GL+R +   +    +  +  + +++  H++ R+ +L +A+  
Sbjct: 121 TEGLEPDITFYLDLSPEEGLRRRRTDSARGAESGWNSMDARELEFHQRVREAYLSLAKEY 180

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQKRVS 217
             R +++D+A   + +   I+ IV + +Q R+ 
Sbjct: 181 SSRFYVIDAAGRIEDIHRTIIEIVNKKLQSRIG 213


>gi|257867902|ref|ZP_05647555.1| thymidylate kinase [Enterococcus casseliflavus EC30]
 gi|257874231|ref|ZP_05653884.1| thymidylate kinase [Enterococcus casseliflavus EC10]
 gi|257876795|ref|ZP_05656448.1| thymidylate kinase [Enterococcus casseliflavus EC20]
 gi|257801985|gb|EEV30888.1| thymidylate kinase [Enterococcus casseliflavus EC30]
 gi|257808395|gb|EEV37217.1| thymidylate kinase [Enterococcus casseliflavus EC10]
 gi|257810961|gb|EEV39781.1| thymidylate kinase [Enterococcus casseliflavus EC20]
          Length = 215

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 112/210 (53%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQ-RKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +GLFI+ EG +GAGKT+ I  L   LQ      +  TREPGG   AE  R ++L    +E
Sbjct: 2   NGLFITIEGPDGAGKTSVIEELYPRLQLEATRKIVKTREPGGVKIAEKIRKIILDPRNEE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+  V+ PAL  G I++CDRF+DSS AYQG         +  + 
Sbjct: 62  MDERTEALLYAAARRQHLIEVVLPALNAGHIVICDRFVDSSLAYQGAGRRIGIPEIARIN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQ-NRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           E + +   PD T+ LD+  D GL+R+Q NR     +   D  + + +  H++ R  +L +
Sbjct: 122 EFATEGTTPDFTLYLDVDSDTGLRRIQENR-----AHQYDRLDSEGLEFHQRVRHAYLKL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           A   P R H +D+    Q V  +  + + E
Sbjct: 177 AEENPVRIHKIDARMGLQEVVESSYSAIVE 206


>gi|119486991|ref|ZP_01620863.1| Thymidylate kinase [Lyngbya sp. PCC 8106]
 gi|119455920|gb|EAW37054.1| Thymidylate kinase [Lyngbya sp. PCC 8106]
          Length = 219

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 116/224 (51%), Gaps = 11/224 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYD----VHVTREPGGTPAAEAARHVLLSCG 58
           +G  I FEG EG GKTT I    ++L+ +       +  T+EPGGT    + R++LL   
Sbjct: 2   NGKLIVFEGSEGGGKTTQIQQTDQWLRDQLGSSVPAIITTKEPGGTALGRSLRNILLDSR 61

Query: 59  VDE-FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFL 117
           ++E     AE ++FA+ R  HVE  ++P L +G I+LCDRF DS+ AYQG         +
Sbjct: 62  LEEPIAPTAELLLFASDRAQHVETFLKPHLKQGAIILCDRFTDSTIAYQGFGRGLDKNLI 121

Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
             L +I+   +  D T+  D+ ++ GL R Q R        +D  E+ D+  H++  Q F
Sbjct: 122 KQLNQIATVGLESDLTLWFDIEIEKGLARTQTR------GEMDRMEKADLAFHQRVNQGF 175

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSS 221
            ++A    DR   +D+  S Q V+T I  I+ + + K    L S
Sbjct: 176 CELADQAGDRMIRIDANLSLQQVSTQIQTILTQYLLKWGFTLQS 219


>gi|114327739|ref|YP_744896.1| thymidylate kinase [Granulibacter bethesdensis CGDNIH1]
 gi|114315913|gb|ABI61973.1| thymidylate kinase [Granulibacter bethesdensis CGDNIH1]
          Length = 250

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 114/218 (52%), Gaps = 7/218 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +SG FI+ EG EGAGK+T    L   L+       VTREPGGT  AE  R +LL  G D 
Sbjct: 34  SSGRFITLEGGEGAGKSTQTRALAEALESLGIRTLVTREPGGTEGAEQLRSLLLY-GPDW 92

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            G  AE ++  AAR  HV   IRPAL +G  +LCDR+ DS+ AYQG    +    + +L 
Sbjct: 93  DGL-AETLLHFAARAQHVARTIRPALEQGIWVLCDRYYDSTMAYQGYCQGADRQRIAALS 151

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +   + P+ T++LD PV+  ++R+  R      A  D +ER      E+ R  FLDIA
Sbjct: 152 --AWLGLDPEVTLVLDAPVEASVQRLATRSGTLTVA--DRYERLGKPFFEQVRAAFLDIA 207

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWE-LVQKRVSP 218
            + P RC ++D       V    L  + E L   R++P
Sbjct: 208 ASSPQRCVVLDGIRPPAEVTRMALAALAEKLGDPRLAP 245


>gi|323144741|ref|ZP_08079318.1| dTMP kinase [Succinatimonas hippei YIT 12066]
 gi|322415492|gb|EFY06249.1| dTMP kinase [Succinatimonas hippei YIT 12066]
          Length = 205

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 123/211 (58%), Gaps = 8/211 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE- 61
           SGLFI+FEG EGAGK+T I  ++R+L+ K  D    REPGGT  AE  R +L +   +E 
Sbjct: 2   SGLFITFEGTEGAGKSTLIKEIERWLREKEIDFVSVREPGGTVLAEKMRAILKTPSPEEK 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              ++E ++  AAR   VE +I+PAL +GK ++CDR   S+ AYQG         +D+++
Sbjct: 62  LCDKSELLLMYAARAQLVETLIKPALAQGKCVICDRHDLSTVAYQGGGRGLPMDEIDAVR 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +++ +  PD T++LD+   +G++R ++R        LD FE + +   E+ R+ +LD A
Sbjct: 122 NVALGKFRPDLTLLLDIDPKLGMQRARSR------GVLDRFELEQLSFFERVRKAYLDAA 175

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +  P    ++D++ +   V    ++ + +L+
Sbjct: 176 KRLP-YIKVIDASKNVDEVRLAAISALEDLL 205


>gi|302190918|ref|ZP_07267172.1| thymidylate kinase [Lactobacillus iners AB-1]
 gi|309808247|ref|ZP_07702156.1| dTMP kinase [Lactobacillus iners LactinV 01V1-a]
 gi|309810090|ref|ZP_07703936.1| dTMP kinase [Lactobacillus iners SPIN 2503V10-D]
 gi|312873623|ref|ZP_07733670.1| dTMP kinase [Lactobacillus iners LEAF 2052A-d]
 gi|312875715|ref|ZP_07735710.1| dTMP kinase [Lactobacillus iners LEAF 2053A-b]
 gi|325911589|ref|ZP_08173997.1| dTMP kinase [Lactobacillus iners UPII 143-D]
 gi|308168535|gb|EFO70644.1| dTMP kinase [Lactobacillus iners LactinV 01V1-a]
 gi|308169589|gb|EFO71636.1| dTMP kinase [Lactobacillus iners SPIN 2503V10-D]
 gi|311088707|gb|EFQ47156.1| dTMP kinase [Lactobacillus iners LEAF 2053A-b]
 gi|311090876|gb|EFQ49273.1| dTMP kinase [Lactobacillus iners LEAF 2052A-d]
 gi|325476575|gb|EGC79733.1| dTMP kinase [Lactobacillus iners UPII 143-D]
          Length = 213

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 116/211 (54%), Gaps = 11/211 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FISFEG +GAGKTT I+ L + L  K    + VTREPGG+  +E  R ++L     E 
Sbjct: 3   GYFISFEGPDGAGKTTIINELVQQLSSKTIAPILVTREPGGSKISENIRKIILDPKNKEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE EA+++AAAR  HV   I PAL  GKI+  DRF+DSS AYQG     + L +D +++
Sbjct: 63  NAETEALLYAAARSQHVIETIIPALNAGKIVFSDRFIDSSLAYQG---IGRDLGIDEIKQ 119

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + + + PD T+  D+    GL+R+Q      E    D  E+++ + H+K    +  
Sbjct: 120 INEFATRHITPDLTLFFDIDPLKGLQRIQKVRPENE----DRLEQENNLFHQKVYTGYKQ 175

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +    P+R   VD+  S   V +  + I+ E
Sbjct: 176 LLSAYPERIKRVDAELSIAEVVSQSVKILEE 206


>gi|15612605|ref|NP_240908.1| thymidylate kinase [Bacillus halodurans C-125]
 gi|14285517|sp|Q9KGL9|KTHY_BACHD RecName: Full=Thymidylate kinase
 gi|10172654|dbj|BAB03761.1| thymidylate kinase [Bacillus halodurans C-125]
          Length = 210

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 112/210 (53%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EGAGKT+ +  ++  L+     V  TREPGG P AE  R ++L     
Sbjct: 1   MTKGCFITVEGGEGAGKTSALDAIEEMLRENGLSVVRTREPGGIPIAEQIRSIILDVDHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                 EA+++AAAR  H+   + PAL  G ++LCDRF+DSS AYQG         + ++
Sbjct: 61  RMDPRTEALLYAAARRQHLVEKVLPALEAGHVVLCDRFIDSSLAYQGYARGIGFEDILAI 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            E +++   PD T++  +  D+GL R+    S RE   LD   ++ +  H+K ++ +  I
Sbjct: 121 NEFAIEGRYPDLTLLFRVDPDVGLSRIHRDQS-REQNRLD---QEALTFHQKVKEGYERI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
               P+R   +D+  SF  V  + + ++ +
Sbjct: 177 VETYPERVVEIDANQSFDQVVADAVRMIKQ 206


>gi|119384876|ref|YP_915932.1| dTMP kinase [Paracoccus denitrificans PD1222]
 gi|119374643|gb|ABL70236.1| thymidylate kinase [Paracoccus denitrificans PD1222]
          Length = 199

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 107/193 (55%), Gaps = 8/193 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLL-SCGVDEFG 63
           +FISFEGI+G+GK+T    L + L  +  +V +TREPGG+  AE  R +L+  CG + + 
Sbjct: 1   MFISFEGIDGSGKSTQARRLVQALTAQGTEVLLTREPGGSEGAEEIRRLLVEGCG-ERWS 59

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E E ++F AAR DHVE +I+PAL  G  ++ DRF DSS  YQG   +     ++ L  +
Sbjct: 60  PETELLLFTAARRDHVERLIQPALARGAWVVTDRFADSSRVYQGLARAELRQLVEELHRL 119

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++  + PD T I+D+   + L R Q R  +      D FE   +    K R+ FL +A  
Sbjct: 120 TIG-IEPDRTFIIDIDPAVALARGQARGGVE-----DRFETLGLGFQRKLREGFLALAAE 173

Query: 184 QPDRCHIVDSAHS 196
            P R  ++D   S
Sbjct: 174 APGRIRVIDGNGS 186


>gi|14591458|ref|NP_143538.1| thymidylate kinase [Pyrococcus horikoshii OT3]
 gi|6016461|sp|O59366|KTHY_PYRHO RecName: Full=Probable thymidylate kinase; AltName: Full=dTMP
           kinase
 gi|3258125|dbj|BAA30808.1| 205aa long hypothetical thymidylate kinase [Pyrococcus horikoshii
           OT3]
          Length = 205

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 120/208 (57%), Gaps = 15/208 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV---D 60
           G FI  EGI+G+GKTT   LL  + + K Y+V +T+EP  +   +  R ++L   V    
Sbjct: 3   GYFIVLEGIDGSGKTTQAKLLAEWFEDKGYEVLLTKEPTDSELGKLIRRIILEESVIDGS 62

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +   EAEA++FAA R +HV+ +I PAL EGK+++CDR+  SS AYQ  R     L L+ L
Sbjct: 63  KISYEAEALLFAADRAEHVKKIILPALSEGKVVICDRYFYSSLAYQWARG----LDLNWL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +++     PD  I+LDLPV   L+R++ R +L E      F+ K V +  K R  +L +
Sbjct: 119 IQVNSFAPRPDLAILLDLPVKESLRRIKLRGTLTE------FD-KIVELQRKVRHNYLKL 171

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
           A   P+   IV++  S + + ++I+ +V
Sbjct: 172 AEMFPE-MRIVNALSSIEDIHSDIVALV 198


>gi|319936704|ref|ZP_08011117.1| thymidylate kinase [Coprobacillus sp. 29_1]
 gi|319808261|gb|EFW04826.1| thymidylate kinase [Coprobacillus sp. 29_1]
          Length = 207

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 126/213 (59%), Gaps = 10/213 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG EG+GKTT  +++K  L ++ Y V +TREPGG   AE  R ++        
Sbjct: 2   SGKFITFEGGEGSGKTTIAAMVKEVLDKEGYRVTLTREPGGVEIAEKIRDIIHDVKYTNM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             + EA+++AA+R  H+   + PAL +G+I++CDRF+DSS  YQG    ++ + +D +  
Sbjct: 62  DRKTEALLYAASRRQHLVEKVIPALEKGEIVICDRFVDSSMVYQG---LARGIGIDEVYN 118

Query: 123 ISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           +++   + ++P+ T+  D+  ++GL+RV   Y+ +E   ++  + +++  HE+  + +L 
Sbjct: 119 MNLFATENILPNRTVFFDIKPEVGLQRV---YANKERE-VNRLDLENIDFHERVYEGYLT 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           I    P+R   VD++   + V   +L  + E++
Sbjct: 175 ICNRFPERIVKVDASQDIEDVLFQVLEKIREIL 207


>gi|259502695|ref|ZP_05745597.1| dTMP kinase [Lactobacillus antri DSM 16041]
 gi|259169340|gb|EEW53835.1| dTMP kinase [Lactobacillus antri DSM 16041]
          Length = 218

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 113/207 (54%), Gaps = 6/207 (2%)

Query: 4   GLFISFEGIEGAGKTTHI-SLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGVDE 61
           G FISFEG +GAGKT+ + ++ KR + +   D V  TREPGG   +E  R VL S    +
Sbjct: 7   GKFISFEGPDGAGKTSVLRAIQKRLVDQLGADRVMYTREPGGNHISEQIRRVLFSPENTD 66

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA++FAAAR  H+ + I P L  GK++LCDR++DSS AYQG         +  + 
Sbjct: 67  MDGRTEALLFAAARRQHIVSEIVPGLRAGKVILCDRYVDSSIAYQGAGRQLGEEAIWQMN 126

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           + ++  ++PD TI LD+   +GL+R+        +  ++  + + +  H+  R  +L + 
Sbjct: 127 QFAIDGLLPDLTIYLDVESAVGLRRIAE----HRADQVNRLDEEKLAFHQTVRAAYLRLY 182

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
           R  PDR  ++D++     V  ++   +
Sbjct: 183 RAHPDRIKLIDASQPLDQVIADVAQTI 209


>gi|268315735|ref|YP_003289454.1| thymidylate kinase [Rhodothermus marinus DSM 4252]
 gi|262333269|gb|ACY47066.1| thymidylate kinase [Rhodothermus marinus DSM 4252]
          Length = 220

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 114/219 (52%), Gaps = 12/219 (5%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           + ISFEGI+G GK+T   LL + L+   Y   + REPGGT  +E  R +LL   +D    
Sbjct: 1   MLISFEGIDGCGKSTQARLLAQRLETAGYRTLLVREPGGTELSERIRGLLLDPALD-IDP 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLDSLQEI 123
            AE ++F+AAR   V   IRPAL  G I+LCDRF DS+ AYQ G R   +  +L      
Sbjct: 60  FAELLLFSAARRQLVVERIRPALQAGYIVLCDRFYDSTTAYQGGGRGVVELAWLRDFNRR 119

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
               ++PD T  LD+P+++ L R        ++   D  ER D    E+ R  +  +A  
Sbjct: 120 VTDGLVPDRTYWLDVPLEVALARRD------QAGDPDRMERADPAFFERVRATYAQLATE 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSK 222
           +PDR   +D+  S +++   I    W  VQ+ + P  ++
Sbjct: 174 EPDRILRLDATASIETLHETI----WNDVQRLLPPTGTR 208


>gi|254386206|ref|ZP_05001517.1| thymidylate kinase [Streptomyces sp. Mg1]
 gi|194345062|gb|EDX26028.1| thymidylate kinase [Streptomyces sp. Mg1]
          Length = 852

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 66/201 (32%), Positives = 110/201 (54%), Gaps = 8/201 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           ++G FI+ EG +GAGK+T +  L  +++ K ++V VTREPG TP  +  R +LL      
Sbjct: 515 DAGFFIALEGGDGAGKSTQVQALADWIRGKGHEVVVTREPGATPVGKRLRSILLDVSSAG 574

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AEA+++AA R +HV+ V+RPAL  G +++ DR++DSS AYQG         +  + 
Sbjct: 575 LSNRAEALLYAADRAEHVDTVVRPALERGAVVITDRYIDSSVAYQGAGRDLSPTEIARIS 634

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +   ++P+ T++LD+  +   +R         +   D  E +    H++ R  FL +A
Sbjct: 635 RWATGGLVPNLTVLLDVSPEAARERF--------TEAPDRLESEPAEFHQRVRAGFLTLA 686

Query: 182 RNQPDRCHIVDSAHSFQSVAT 202
              P R  +VD+    +SV+T
Sbjct: 687 AADPGRYLVVDAGQDPESVST 707


>gi|260913250|ref|ZP_05919732.1| dTMP kinase [Pasteurella dagmatis ATCC 43325]
 gi|260632837|gb|EEX51006.1| dTMP kinase [Pasteurella dagmatis ATCC 43325]
          Length = 215

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 116/209 (55%), Gaps = 8/209 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGV 59
           M +G FI  EGIEGAGKTT    + R L      D+  TREPGGTP AE  RH++     
Sbjct: 5   MKTGKFIVLEGIEGAGKTTARDSIVRALNAYGIQDIVFTREPGGTPLAEKLRHLIKHETE 64

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
           +    +AE ++  AAR+  VENVI+PAL EGK ++ DR   SS AYQG         L +
Sbjct: 65  EPVTDKAELLMLYAARIQLVENVIKPALAEGKWVIGDRHDMSSQAYQGGGRQLDKTLLLT 124

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L+E  + +  PD T+ LD+   +GL R + R        LD  E++++   ++ RQ +L+
Sbjct: 125 LKETVLGDFEPDLTLYLDIDPVLGLTRARGR------GALDRIEQQNIDFFQRTRQRYLE 178

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           + ++ P  C  +D++H    V+ ++ + V
Sbjct: 179 LVQDNPKAC-CIDASHEIDKVSADVQSAV 206


>gi|240142285|ref|YP_002966795.1| thymidylate kinase [Methylobacterium extorquens AM1]
 gi|240012229|gb|ACS43454.1| thymidylate kinase [Methylobacterium extorquens AM1]
          Length = 225

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 106/190 (55%), Gaps = 6/190 (3%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G+F S EG EGAGK++ I+ L   ++    +V VTREPGG   AE  R+++LS G  ++ 
Sbjct: 11  GVFASLEGPEGAGKSSQINRLAERMRAAGREVVVTREPGGCKGAEVLRNLVLS-GAVQWD 69

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++FAAAR +HV   I PAL  G ++L DRF +SS AYQG          D L+ I
Sbjct: 70  PRTELMLFAAARREHVVRTIAPALARGAVVLSDRFSESSRAYQGAARGVGTALCDDLERI 129

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +   ++PD   +LD+   +GL R + R +  +S     FE  D+  H   RQ FLD A  
Sbjct: 130 ACDGILPDVVFLLDVDPVVGLARSKARAT--DST---MFEALDLEFHRTLRQAFLDRAAE 184

Query: 184 QPDRCHIVDS 193
           +P+   ++ S
Sbjct: 185 RPELFEVIPS 194


>gi|312868193|ref|ZP_07728393.1| dTMP kinase [Streptococcus parasanguinis F0405]
 gi|311095938|gb|EFQ54182.1| dTMP kinase [Streptococcus parasanguinis F0405]
          Length = 212

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G  ISFEG EGAGK++ +  +   L+ K      TREPGG   AE  R V+L     
Sbjct: 1   MVNGTLISFEGPEGAGKSSVLEAVLPLLEEKGIPFITTREPGGVDIAEKIRQVILDPDHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL  GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  SMDAKTELLLYIASRRQHLVERVLPALAAGKVVLMDRFIDSSVAYQGYGRGLSVEDIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  DL V+ GL R+      RE   LD    + + +H+K RQ +L +
Sbjct: 121 NQFATDGLKPDLTLYFDLDVEEGLARIAKNQE-REVNRLDL---EGLELHQKVRQGYLAL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
              +P+R   +D++ SF++V  ++L ++
Sbjct: 177 YEKEPERIVKIDASQSFEAVFADVLAVL 204


>gi|85057772|ref|YP_456688.1| thymidylate kinase [Aster yellows witches'-broom phytoplasma AYWB]
 gi|123518128|sp|Q2NIY4|KTHY_AYWBP RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|84789877|gb|ABC65609.1| thymidylate kinase [Aster yellows witches'-broom phytoplasma AYWB]
          Length = 207

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 123/210 (58%), Gaps = 7/210 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FISFEG EG GKTTH S L   L +K Y   +T+EPGG    E  R++LL     +   
Sbjct: 1   MFISFEGCEGTGKTTHSSYLFEKLSKK-YSCVLTKEPGGGLFNEVIRNILLHSYNKQIDF 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA++FAA R +H+  +I PAL + KI++CDR+LDS+ AYQ         F+ ++  ++
Sbjct: 60  HTEALLFAADRAEHLSKLIIPALQQNKIVICDRYLDSTIAYQVYARGLSKDFVLNINNLA 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI-ARN 183
           +   MP+ T  LDL   IG++RV+ ++  +E   ++ F+ + +  H+K R+ +LD+  ++
Sbjct: 120 L-NYMPNITFYLDLDPKIGIQRVK-QFRPKE---INSFDLQKLSFHKKVRKGYLDLYQKD 174

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
           Q  R  ++D++ S + +   I   + E+ Q
Sbjct: 175 QQKRIFLIDASKSLEKIYNIIEQKLKEVFQ 204


>gi|317126771|ref|YP_004093053.1| thymidylate kinase [Bacillus cellulosilyticus DSM 2522]
 gi|315471719|gb|ADU28322.1| thymidylate kinase [Bacillus cellulosilyticus DSM 2522]
          Length = 213

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 124/216 (57%), Gaps = 10/216 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG+FI+FEG EGAGKTT +  +K  L+  +  V +TREPGG+  AE  R V+L+    E 
Sbjct: 2   SGVFITFEGGEGAGKTTVLKEIKDRLEASDEKVVMTREPGGSIIAEKIRDVILNPDHTEM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + P L +G I+LCDRF+DSS  YQG    ++ + ++ +  
Sbjct: 62  DARTEALLYAAARRQHLVEKVFPYLDKGYIVLCDRFIDSSLVYQG---VARKIGIEEVLN 118

Query: 123 ISV---QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I++      MP  T+  D+   IGL+R+  ++  RE   LD   R+ +  H   R+ + +
Sbjct: 119 INLFATGGFMPSKTLFFDIDPKIGLERIA-KHGNREFNRLD---REALDFHYIVRKAYHE 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           +   +PDR  +VD++ S   V       V+++VQ +
Sbjct: 175 LQGREPDRIEMVDASLSLTEVIEAAWTKVFDIVQAK 210


>gi|240950250|ref|ZP_04754530.1| thymidylate kinase [Actinobacillus minor NM305]
 gi|257465436|ref|ZP_05629807.1| thymidylate kinase [Actinobacillus minor 202]
 gi|240295251|gb|EER46050.1| thymidylate kinase [Actinobacillus minor NM305]
 gi|257451096|gb|EEV25139.1| thymidylate kinase [Actinobacillus minor 202]
          Length = 209

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 115/208 (55%), Gaps = 12/208 (5%)

Query: 4   GLFISFEGIEGAGKTT-HISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FI  EG+EGAGKTT H ++L +      + +  TREPGGTP AE  RH++     +  
Sbjct: 3   GKFIVLEGLEGAGKTTAHQAILAQLEAAGIHHIVQTREPGGTPLAEKLRHLIKHDLEEPV 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
             +AE ++  AAR+  VENVI+PAL EGK +L DR   SS AYQG         L++L++
Sbjct: 63  NDKAELLMLYAARVQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQLDRQLLETLKQ 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLR--ESACLDYFERKDVMIHEKRRQIFLDI 180
             + +  PD TI LD+   IGL+R + R  L   E   LD+F R         RQ +L++
Sbjct: 123 TILGDFEPDLTIYLDIDPAIGLERARGRGELDRIEQQSLDFFYRT--------RQRYLEL 174

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
            +N  D+  I+++    + VA +I   V
Sbjct: 175 TQNN-DKAVIINAEQPIEKVAADIQQAV 201


>gi|73541128|ref|YP_295648.1| thymidylate kinase [Ralstonia eutropha JMP134]
 gi|123625155|sp|Q471X9|KTHY_RALEJ RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|72118541|gb|AAZ60804.1| thymidylate kinase [Ralstonia eutropha JMP134]
          Length = 203

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 114/207 (55%), Gaps = 11/207 (5%)

Query: 4   GLFISFEGIEGAGKTTHI-SLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGVDE 61
           G FI+FEGI+GAGK+THI ++  R  +RK+   V  TREPGGTP  E  R +LL     +
Sbjct: 3   GKFITFEGIDGAGKSTHIGAVAARLRERKDIPAVVTTREPGGTPLGEDLRQILLH---RK 59

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              E EA++  AAR +H+  VI PAL  G  ++ DRF D+++AYQG         L++L+
Sbjct: 60  MHLETEALLMFAARREHIAEVIEPALARGDWVISDRFTDATFAYQGGGRGLATSRLETLE 119

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
                 + PD T++ D+P++   +R+      RE    D FE +     E+ R  +L  A
Sbjct: 120 TWVQDGLQPDLTLLFDVPLETASERLAG---AREP---DKFEAESRAFFERTRAEYLRRA 173

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
              P+R  ++D+  S +++   +  I+
Sbjct: 174 AQAPERFRVIDATQSIEAIRVELEKII 200


>gi|71064726|ref|YP_263453.1| thymidylate kinase [Psychrobacter arcticus 273-4]
 gi|71037711|gb|AAZ18019.1| thymidylate kinase [Psychrobacter arcticus 273-4]
          Length = 225

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 114/216 (52%), Gaps = 16/216 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FISFEG EG GKTT I  L   LQ    D   TREPGG+P AE  R +LL        
Sbjct: 19  GHFISFEGTEGVGKTTAIEQLCARLQANGIDYLRTREPGGSPFAERLREILLDPNT-AIN 77

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQG----ERDSSQHLFLDS 119
            + E ++  AAR DH++ VI PAL  G  ++CDRF DS+ AYQG    + D++    +D+
Sbjct: 78  DDTELLLMFAARCDHMQQVILPALQRGTWVICDRFTDSTVAYQGFGRADGDATVRGKIDT 137

Query: 120 LQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           L E  V + +P+ T+ LDLPV  G+ R   R      +  D FE++      +  + F  
Sbjct: 138 LIEQFVTQ-LPELTLWLDLPVLEGMARANKR------SAADRFEQQATDFFTRVHKGFRT 190

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
           +A   P R   +D++ S   V+  I    W+ V+++
Sbjct: 191 LADEYPKRIQRIDASGSADEVSARI----WQKVEEK 222


>gi|296876048|ref|ZP_06900104.1| thymidylate kinase [Streptococcus parasanguinis ATCC 15912]
 gi|296432959|gb|EFH18750.1| thymidylate kinase [Streptococcus parasanguinis ATCC 15912]
          Length = 212

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G  ISFEG EGAGK++ +  +   L+ K      TREPGG   AE  R V+L     
Sbjct: 1   MVNGTLISFEGPEGAGKSSVLEAVLPLLEEKGIPFITTREPGGVDIAEKIRQVILDPDHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL  GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  RMDAKTELLLYIASRRQHLVERVLPALAAGKVVLMDRFIDSSVAYQGYGRGLSVEDIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  DL V+ GL R+      RE   LD    + + +H+K RQ +L +
Sbjct: 121 NQFATDGLKPDLTLYFDLDVEEGLARIAKNQE-REVNRLDL---EGLELHQKVRQGYLAL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
              +P+R   +D++ SF++V  ++L ++
Sbjct: 177 YEKEPERIVKIDASQSFEAVFADVLAVL 204


>gi|75762825|ref|ZP_00742646.1| Thymidylate kinase [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|218895166|ref|YP_002443577.1| thymidylate kinase [Bacillus cereus G9842]
 gi|228898784|ref|ZP_04063067.1| Thymidylate kinase [Bacillus thuringiensis IBL 4222]
 gi|228956472|ref|ZP_04118269.1| Thymidylate kinase [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228963128|ref|ZP_04124298.1| Thymidylate kinase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|229039935|ref|ZP_04189700.1| Thymidylate kinase [Bacillus cereus AH676]
 gi|229148440|ref|ZP_04276697.1| Thymidylate kinase [Bacillus cereus m1550]
 gi|226732651|sp|B7ISU0|KTHY_BACC2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|74489692|gb|EAO53087.1| Thymidylate kinase [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|218540819|gb|ACK93213.1| thymidylate kinase [Bacillus cereus G9842]
 gi|228634982|gb|EEK91554.1| Thymidylate kinase [Bacillus cereus m1550]
 gi|228727394|gb|EEL78586.1| Thymidylate kinase [Bacillus cereus AH676]
 gi|228796513|gb|EEM43951.1| Thymidylate kinase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228803162|gb|EEM49983.1| Thymidylate kinase [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228860809|gb|EEN05186.1| Thymidylate kinase [Bacillus thuringiensis IBL 4222]
          Length = 208

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|327470490|gb|EGF15946.1| thymidylate kinase [Streptococcus sanguinis SK330]
          Length = 212

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FL+     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLKNYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLAEQVLPALSQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+  R   RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIA-RSESREVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|163856816|ref|YP_001631114.1| thymidylate kinase [Bordetella petrii DSM 12804]
 gi|229487582|sp|A9INL0|KTHY_BORPD RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|163260544|emb|CAP42846.1| tmk [Bordetella petrii]
          Length = 207

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 108/204 (52%), Gaps = 15/204 (7%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+TH + L   L+     V  TREPGGTP  E  R ++LS   +   
Sbjct: 5   GRFITLEGVDGAGKSTHAAWLADALRDMGRTVVATREPGGTPLGETLRGLVLS---ESMT 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS---L 120
            + E ++  AAR +H+  VI PAL  G  ++CDR+ D++YAYQG     + L  D    L
Sbjct: 62  LDTETLLMFAARCEHLTQVIEPALARGDWVVCDRYTDATYAYQG---GGRQLGADRIAVL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           ++     + PD T + D+P+++       R  L ++   D FER++    E+ R  +L  
Sbjct: 119 EQWMRPALQPDRTWLFDVPLELA------RARLADARLPDRFEREEAAFFERTRAAYLAR 172

Query: 181 ARNQPDRCHIVDSAHSFQSVATNI 204
           A+  P R  IVDS+     V   +
Sbjct: 173 AQAHPGRIRIVDSSRPVTEVRAQL 196


>gi|322386922|ref|ZP_08060546.1| thymidylate kinase [Streptococcus cristatus ATCC 51100]
 gi|321269204|gb|EFX52140.1| thymidylate kinase [Streptococcus cristatus ATCC 51100]
          Length = 212

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 113/210 (53%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G+FIS EG EGAGKT+ +  L   L+   Y++  TREPGG   +E  R V+L  G  
Sbjct: 1   MKKGVFISLEGPEGAGKTSVLEALLPQLKEMGYELLTTREPGGVAISEKIREVILDKGHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+AE +++ A+R  H+   + PAL +G  +L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKAELLLYIASRRQHLAEKVLPALEQGTWVLQDRFIDSSVAYQGYGRGLAVDDVEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V  GL R+  R   RE   LD    + + +HE+ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVKEGLARI-ARNKEREVNRLDL---EGLDLHERVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P R   +D++   + V  + L ++ E
Sbjct: 177 LEKEPGRVVKIDASQPLEQVVADSLAVIKE 206


>gi|323526017|ref|YP_004228170.1| thymidylate kinase [Burkholderia sp. CCGE1001]
 gi|323383019|gb|ADX55110.1| thymidylate kinase [Burkholderia sp. CCGE1001]
          Length = 206

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 111/212 (52%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH++  +  L++K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLAWFRERLEQKVAATGRSVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QKMD---LETEALLMFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DL  +I  +R   R + R+    D FE +     E+ R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLAPEIANER---RSAARDP---DRFESESAAFFERTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +L  A   P R  I+DS+ S   +   +  ++
Sbjct: 172 YLRRAEEAPYRFAIIDSSQSIARIQKQLEELI 203


>gi|327462078|gb|EGF08407.1| thymidylate kinase [Streptococcus sanguinis SK1057]
 gi|328946592|gb|EGG40730.1| thymidylate kinase [Streptococcus sanguinis SK1087]
          Length = 212

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FL+     +  TREPGG   AEA R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLKNYGTGLITTREPGGVQIAEAIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLAERVLPALSQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+  R   RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIA-RSESREVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|297622813|ref|YP_003704247.1| thymidylate kinase [Truepera radiovictrix DSM 17093]
 gi|297163993|gb|ADI13704.1| thymidylate kinase [Truepera radiovictrix DSM 17093]
          Length = 217

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 112/214 (52%), Gaps = 8/214 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
             G+FI+FEG EG+GKTT +  L   L+        T+EPGGT   E  R ++L   +  
Sbjct: 7   TRGVFIAFEGPEGSGKTTQLGRLAARLEALGQVPLTTKEPGGTAVGERLRALVLDPAL-R 65

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
              E E +++AA+R + V +V++PAL  G+++LCDRF  ++ AYQGE       ++  L 
Sbjct: 66  MHPETELLLYAASRAELVASVLKPALAAGRVVLCDRFTGATVAYQGEGRGLPKDWIGVLN 125

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
                 + P  T++ DLP ++GL RV  R         D  E+     HE+ R+ FL  A
Sbjct: 126 ARVTGGLKPHLTLLFDLPPEVGLARVARR------GARDRLEQAAFAFHERVRRGFLQQA 179

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR 215
              P   H++D++   + VA  +  +V  L++ R
Sbjct: 180 EQDPS-WHVLDASRPEEEVAGAVWRLVAPLLRDR 212


>gi|148284569|ref|YP_001248659.1| thymidylate kinase [Orientia tsutsugamushi str. Boryong]
 gi|166221759|sp|A5CDS9|KTHY_ORITB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|146740008|emb|CAM80084.1| thymidylate kinase [Orientia tsutsugamushi str. Boryong]
          Length = 217

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 111/205 (54%), Gaps = 4/205 (1%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+FEG EG+GKTT   LL   L         TRE GGT  AE  R ++L     +  
Sbjct: 7   GKFITFEGNEGSGKTTQSKLLYEKLLDNGIKAVWTREIGGTDIAELIRDIVL---FKDMS 63

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              E ++  AAR +H+E  IRP L EGK ++CDRF+DS+  YQ +    Q L L+ L   
Sbjct: 64  ITTELLLIMAARYEHIEKFIRPNLNEGKWVICDRFIDSTLCYQSKNSEEQQLILE-LHRK 122

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
            +    PD T+I+++   I ++R++ R   + +  L+ F+ ++   H+K    F+ +++ 
Sbjct: 123 LLDNFFPDLTLIINVSPSIAMQRIKIREIHKNTNQLNKFDNRNQQFHQKITDAFIQVSKL 182

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
            P+R   ++     + V++ ++NI+
Sbjct: 183 FPERIVQINGEPMIEDVSSEVINII 207


>gi|218231073|ref|YP_002364880.1| thymidylate kinase [Bacillus cereus B4264]
 gi|226732652|sp|B7HIJ8|KTHY_BACC4 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|218159030|gb|ACK59022.1| dTMP kinase [Bacillus cereus B4264]
          Length = 208

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNEKYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|238897674|ref|YP_002923353.1| thymidylate kinase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259494273|sp|C4K3R2|KTHY_HAMD5 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|229465431|gb|ACQ67205.1| thymidylate kinase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 210

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 124/215 (57%), Gaps = 11/215 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQR-KNYDVHVTREPGGTPAAEAARHVLLSCGVDE- 61
           G FI  EG+EGAGK+T ++ +++FL+  K  DV  TREPGGT  +E  RH++     +E 
Sbjct: 3   GKFIVIEGLEGAGKSTAVNTVQQFLRHFKIQDVICTREPGGTALSEEIRHLIKKKSQNEE 62

Query: 62  -FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
               +AE ++  AAR+  +EN+I+PAL  G  ++ DR   SS AYQG     +  F+ SL
Sbjct: 63  ILTDKAELLLLYAARVQLLENIIKPALSSGTWVIGDRHDLSSQAYQGGGRGIKSEFIKSL 122

Query: 121 QEISV-QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
            + ++     PD T+ LDLP ++GL+R + R        LD  E++ ++  E+ R  +L+
Sbjct: 123 ADFTLGSSFRPDLTLYLDLPPELGLQRARKR------GHLDRIEQQSLVFFERIRARYLE 176

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           +  + P R  ++D++   + V  +I N +  L++K
Sbjct: 177 LTYDDP-RIKMIDASKPIKKVTVDIQNALLSLLEK 210


>gi|256827903|ref|YP_003156631.1| thymidylate kinase [Desulfomicrobium baculatum DSM 4028]
 gi|256577079|gb|ACU88215.1| thymidylate kinase [Desulfomicrobium baculatum DSM 4028]
          Length = 211

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 111/202 (54%), Gaps = 1/202 (0%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +F++FEG+EG GK+T    L     R+ +DV  T EPGG+   +  R +LL     +  +
Sbjct: 1   MFLTFEGMEGCGKSTQCKKLIEHFVRQGHDVLHTLEPGGSRLGKELRRILLDPKNSDLSS 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            +E  ++ A R  HV +VIRPA+ +G+ ++CDRF DS+  YQG         L  L +++
Sbjct: 61  TSELFLYLADRAQHVSSVIRPAMEDGRTVICDRFADSTVVYQGYGRGLDPSLLHHLNDVA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNR-YSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           VQ + PD TI+LD+  +IGL+R   R     ++A    FE + +  H + R+ +L  A  
Sbjct: 121 VQGLWPDMTILLDVEPEIGLRRALTRNMQDNKTATEGRFEAESMAFHTRIREGYLTWAAL 180

Query: 184 QPDRCHIVDSAHSFQSVATNIL 205
              R  +VD+  +  +V  +IL
Sbjct: 181 HRGRFLVVDAGRNPDAVFDSIL 202


>gi|227513699|ref|ZP_03943748.1| thymidylate kinase [Lactobacillus buchneri ATCC 11577]
 gi|227522511|ref|ZP_03952560.1| thymidylate kinase [Lactobacillus hilgardii ATCC 8290]
 gi|227083018|gb|EEI18330.1| thymidylate kinase [Lactobacillus buchneri ATCC 11577]
 gi|227090333|gb|EEI25645.1| thymidylate kinase [Lactobacillus hilgardii ATCC 8290]
          Length = 216

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 119/210 (56%), Gaps = 4/210 (1%)

Query: 3   SGLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKT+ ++ ++ +F ++    + VTREPGG   +E  R V+L     E
Sbjct: 2   TGKFITFEGPDGAGKTSVMNEVVNQFQKQLGDHLIVTREPGGNKISEQIRRVILDRKNTE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+   I PAL   K++LCDR++DSS AYQG         +  + 
Sbjct: 62  MDYRTEALLYAAARRQHLVETILPALQADKLVLCDRYVDSSVAYQGAGREIGMQAVARMN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           E + ++++P  TI  ++PV++GL R+      R+S+ +D  + +    H++  Q ++ + 
Sbjct: 122 EFATEKILPYKTIYFEIPVEVGLNRIAKH---RDSSKIDRLDVETTAFHKRVHQGYMKLI 178

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWEL 211
               DR  I+D+    + V  +  +++ ++
Sbjct: 179 DEYNDRFIIIDATQPIEKVIQDTTDVIHQI 208


>gi|30018302|ref|NP_829933.1| thymidylate kinase [Bacillus cereus ATCC 14579]
 gi|229125548|ref|ZP_04254581.1| Thymidylate kinase [Bacillus cereus BDRD-Cer4]
 gi|229142836|ref|ZP_04271279.1| Thymidylate kinase [Bacillus cereus BDRD-ST24]
 gi|296500863|ref|YP_003662563.1| thymidylate kinase [Bacillus thuringiensis BMB171]
 gi|46576501|sp|Q81JB5|KTHY_BACCR RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|29893842|gb|AAP07134.1| Thymidylate kinase [Bacillus cereus ATCC 14579]
 gi|228640599|gb|EEK96986.1| Thymidylate kinase [Bacillus cereus BDRD-ST24]
 gi|228657865|gb|EEL13670.1| Thymidylate kinase [Bacillus cereus BDRD-Cer4]
 gi|296321915|gb|ADH04843.1| thymidylate kinase [Bacillus thuringiensis BMB171]
          Length = 208

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQG---YARGLGMDKIFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|103486743|ref|YP_616304.1| thymidylate kinase [Sphingopyxis alaskensis RB2256]
 gi|98976820|gb|ABF52971.1| thymidylate kinase [Sphingopyxis alaskensis RB2256]
          Length = 207

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 101/193 (52%), Gaps = 6/193 (3%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+ EG EG GK+T +  L   L  ++ +V  TREPGG+  AEA R +L+    D
Sbjct: 1   MIRGRFITLEGGEGVGKSTQLRALSEALAARSIEVVATREPGGSVGAEAIRTLLMEGSDD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + A +EA++FAAAR DHV   IRPAL  G  +LCDRF+DSS AYQG         + +L
Sbjct: 61  RWDARSEALLFAAARADHVARTIRPALARGAWVLCDRFVDSSRAYQGGGGGITDADILAL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
                + ++PD T +L +  D   +R+  R         D    K      +    F ++
Sbjct: 121 HRFGSRGLLPDRTFLLTVRPDEAARRLAARGD------RDRMGSKPADYQARLAARFAEM 174

Query: 181 ARNQPDRCHIVDS 193
           A  +P R  ++D+
Sbjct: 175 AATEPQRWRLIDA 187


>gi|259501361|ref|ZP_05744263.1| dTMP kinase [Lactobacillus iners DSM 13335]
 gi|315653112|ref|ZP_07906037.1| thymidylate kinase [Lactobacillus iners ATCC 55195]
 gi|259167214|gb|EEW51709.1| dTMP kinase [Lactobacillus iners DSM 13335]
 gi|315489477|gb|EFU79114.1| thymidylate kinase [Lactobacillus iners ATCC 55195]
          Length = 234

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 117/213 (54%), Gaps = 11/213 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FISFEG +GAGKTT I+ L + L  K    + VTREPGG+  +E  R ++L     E 
Sbjct: 24  GYFISFEGPDGAGKTTIINELVQQLSSKTIAPILVTREPGGSKISENIRKIILDPKNKEM 83

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE EA+++AAAR  HV   I PAL  GKI+  DRF+DSS AYQG     + L +D +++
Sbjct: 84  NAETEALLYAAARSQHVIETIIPALNAGKIVFSDRFIDSSLAYQG---IGRDLGIDEIKQ 140

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + + + PD T+  D+    GL+R+Q      E    D  E+++ + H+K    +  
Sbjct: 141 INEFATRHITPDLTLFFDIDPLKGLQRIQKVRPENE----DRLEQENNLFHQKVYTGYKQ 196

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +    P+R   VD+  S   V +  + I+ E +
Sbjct: 197 LLSAYPERIKRVDAELSIAEVVSQSVKILEEYM 229


>gi|332157932|ref|YP_004423211.1| thymidylate kinase [Pyrococcus sp. NA2]
 gi|331033395|gb|AEC51207.1| thymidylate kinase [Pyrococcus sp. NA2]
          Length = 205

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 116/211 (54%), Gaps = 19/211 (9%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGV--- 59
            G FI FEGI+G+GKTT   LL ++ +   Y+V +T+EP  T   +  R ++L   +   
Sbjct: 2   KGYFIVFEGIDGSGKTTQAKLLAKWFRDNGYEVLLTKEPTDTEFGKLIRKLVLEGSIIDG 61

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDS 119
                EAEA++FAA R +HV+ +I PAL EGKI++CDR+L SS AYQ  R       LD 
Sbjct: 62  SRISYEAEALLFAADRAEHVKKIILPALREGKIVICDRYLYSSLAYQWARG------LDL 115

Query: 120 LQEISVQEVMP--DCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177
              I V    P  D  I+LDLP+   L+R++ R    E      F+ K V +  K R+ +
Sbjct: 116 EWLIKVNSFAPRADLVILLDLPITKSLERIRGRVIKTE------FD-KLVELQRKVRENY 168

Query: 178 LDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           L +A   P+   +VD+  + + V  N++ +V
Sbjct: 169 LKLAEMFPE-IRVVDAMANIEDVHNNVVTLV 198


>gi|302535280|ref|ZP_07287622.1| integral membrane protein with kinase activity [Streptomyces sp. C]
 gi|302444175|gb|EFL15991.1| integral membrane protein with kinase activity [Streptomyces sp. C]
          Length = 1094

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 117/218 (53%), Gaps = 13/218 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+ EG +GAGK+T +  L  +++ K ++V VTREPG TP  +  R +LL       
Sbjct: 515 TGFFIALEGGDGAGKSTQVQALAEWIRGKGHEVVVTREPGATPVGKRLRSILLDISSAGL 574

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R +HV++++RPAL  G +++ DR++DSS AYQG         +  +  
Sbjct: 575 SNRAEALLYAADRAEHVDSLVRPALERGAVVITDRYIDSSVAYQGAGRDLSPTEIARISR 634

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P+ T++LD+  +   +R         +   D  E +    H++ R  FL +A 
Sbjct: 635 WATGGLVPNLTVLLDVSPETARERF--------TEAPDRLESEPTEFHQRVRAGFLTLAA 686

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLS 220
             P R  +VD+     SV T +L+ +      R+ PLS
Sbjct: 687 ADPGRYLVVDAGQDPGSVTTVVLHRL-----DRMLPLS 719


>gi|169824826|ref|YP_001692437.1| thymidylate kinase [Finegoldia magna ATCC 29328]
 gi|238687760|sp|B0S2F7|KTHY_FINM2 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|167831631|dbj|BAG08547.1| thymidylate kinase [Finegoldia magna ATCC 29328]
          Length = 203

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG +G+GK+T I  +  +L   NYDV  TREPGG+P AE  R+++L     + G 
Sbjct: 1   MFITFEGPDGSGKSTIIQKVYDYLIENNYDVIKTREPGGSPIAEKIRNLILDTENIKMGY 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA+++AA+R  HVE  I PAL E KI+LCDRFL SS AYQG         + ++ E +
Sbjct: 61  RTEALLYAASRAQHVEETILPALNENKIVLCDRFLISSLAYQGVGRGLGIENVRNINEFA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +  V PD  +  D+     LKR   + SL  +   D  E++    HE+    + +I  N 
Sbjct: 121 INGVFPDFVLFFDVDPITTLKR---KSSLDTA---DRLEKEGNNFHERVYNGYKEIL-NS 173

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
                I+D+  S + V +  + ++
Sbjct: 174 EKNIEIIDATQSVEDVFSQCIEVL 197


>gi|12722080|gb|AAK03757.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 243

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 116/206 (56%), Gaps = 10/206 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKN-YDVHVTREPGGTPAAEAARHVLLSCGV 59
           M +G FI  EGIEGAGKTT    + R L     +D+  TREPGGTP AE  R ++     
Sbjct: 35  MTTGKFIVLEGIEGAGKTTARDSIVRALHAHGIHDIVFTREPGGTPLAEKLRQLIKHETE 94

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLD 118
           +    +AE ++  AAR+  VENVI+PAL +GK ++ DR   SS AYQ G R   QHL L 
Sbjct: 95  EPVTDKAELLMLYAARIQLVENVIKPALAQGKWVIGDRHDMSSQAYQGGGRQLDQHL-LH 153

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +L++  + E  PD T+ LD+   +GL R + R        LD  E++++    + RQ + 
Sbjct: 154 TLKQTILGEFEPDLTLYLDIDPVLGLSRAKGR------GALDRIEQQNLDFFHRTRQRYQ 207

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNI 204
           ++ R+ P +   +D++ +   VA ++
Sbjct: 208 ELVRHNP-KAVTIDASQTMSKVAEDV 232


>gi|163839161|ref|YP_001623566.1| thymidylate kinase [Renibacterium salmoninarum ATCC 33209]
 gi|162952637|gb|ABY22152.1| thymidylate kinase [Renibacterium salmoninarum ATCC 33209]
          Length = 221

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 117/210 (55%), Gaps = 7/210 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+FEG +GAGK+T   LL   L+     V +TREPGGTP  E  R ++L  G  + 
Sbjct: 19  SGFFIAFEGGDGAGKSTQARLLAAALKDLGRQVVLTREPGGTPVGEKLRSLVLDHGQGQI 78

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA++FAAAR  H E VIRPAL EGK+++ DR++DSS AYQG         +  + E
Sbjct: 79  DARTEALLFAAARAAHAEQVIRPALAEGKVVITDRYIDSSIAYQGAGRDLGEDEVRKVNE 138

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P+ TI+LD+  + G  R       R  A  D  E +    H++ RQ FL++A 
Sbjct: 139 WATAGLLPELTILLDVAANEGRNR-------RAGARPDRLESEPDNFHDRIRQAFLNLAS 191

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELV 212
            +P +  I+++  S   +   IL    EL+
Sbjct: 192 ARPKQYLILNARLSIDELQQAILQRAKELL 221


>gi|309805418|ref|ZP_07699465.1| dTMP kinase [Lactobacillus iners LactinV 09V1-c]
 gi|312872145|ref|ZP_07732218.1| dTMP kinase [Lactobacillus iners LEAF 2062A-h1]
 gi|329921009|ref|ZP_08277537.1| dTMP kinase [Lactobacillus iners SPIN 1401G]
 gi|308165236|gb|EFO67472.1| dTMP kinase [Lactobacillus iners LactinV 09V1-c]
 gi|311092229|gb|EFQ50600.1| dTMP kinase [Lactobacillus iners LEAF 2062A-h1]
 gi|328935285|gb|EGG31765.1| dTMP kinase [Lactobacillus iners SPIN 1401G]
          Length = 229

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 117/213 (54%), Gaps = 11/213 (5%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNY-DVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G FISFEG +GAGKTT I+ L + L  K    + VTREPGG+  +E  R ++L     E 
Sbjct: 19  GYFISFEGPDGAGKTTIINELVQQLSSKTIAPILVTREPGGSKISENIRKIILDPKNKEM 78

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            AE EA+++AAAR  HV   I PAL  GKI+  DRF+DSS AYQG     + L +D +++
Sbjct: 79  NAETEALLYAAARSQHVIETIIPALNAGKIVFSDRFIDSSLAYQG---IGRDLGIDEIKQ 135

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + + + PD T+  D+    GL+R+Q      E    D  E+++ + H+K    +  
Sbjct: 136 INEFATRHITPDLTLFFDIDPLKGLQRIQKVRPENE----DRLEQENNLFHQKVYTGYKQ 191

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           +    P+R   VD+  S   V +  + I+ E +
Sbjct: 192 LLSAYPERIKRVDAELSIAEVVSQSVKILEEYM 224


>gi|261377929|ref|ZP_05982502.1| dTMP kinase [Neisseria cinerea ATCC 14685]
 gi|269145789|gb|EEZ72207.1| dTMP kinase [Neisseria cinerea ATCC 14685]
          Length = 206

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 117/203 (57%), Gaps = 7/203 (3%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+ +GI+GAGK+T+++ +K + +R+   V  TREPGGT   EA R +LL+    + G  
Sbjct: 5   FITLDGIDGAGKSTNLAAIKAWFERRRLPVLFTREPGGTALGEALREILLNPAT-KAGLR 63

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISV 125
           AE ++  A+R+ H+E VI PAL +G  ++ DRF D+++AYQG         ++ L+    
Sbjct: 64  AETLMMFASRMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQ 123

Query: 126 QEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQP 185
             + PD T++LD+P+++ + R+      RE    D FE++      + R ++L+ A   P
Sbjct: 124 GSLKPDLTLLLDVPLEVSMARIGQ---AREK---DRFEQEQADFFMRVRGVYLNRATACP 177

Query: 186 DRCHIVDSAHSFQSVATNILNIV 208
           +R  ++D   S + V  +I  ++
Sbjct: 178 ERYAVIDGNRSVEEVRNSIEKVL 200


>gi|319939588|ref|ZP_08013947.1| thymidylate kinase [Streptococcus anginosus 1_2_62CV]
 gi|319811177|gb|EFW07483.1| thymidylate kinase [Streptococcus anginosus 1_2_62CV]
          Length = 212

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 115/213 (53%), Gaps = 4/213 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M+ G+FIS EG +GAGK++ +  L   L+ K      TREPGG   AE  R V+L     
Sbjct: 1   MSKGIFISLEGPDGAGKSSVLEALIPILEAKGQAFVTTREPGGVAVAEKIRDVVLDPKHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           E   + E +++ A+R  H+   I PAL  G+++L DRF+DSS AYQG     +   +D L
Sbjct: 61  EIDEKTELLLYIASRRQHLVERILPALDRGEMVLVDRFIDSSVAYQGFGRGLKVADIDWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+  + GL R+      +E    D  +R+ V  H++ R+ +L I
Sbjct: 121 NDFATDGLKPDLTLYFDIEAEEGLARIAKS---KERGA-DRLDRESVEWHQRVREGYLSI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            + +P+R   +D++   + V  + L ++ E V+
Sbjct: 177 LKKEPNRVRKIDASQPLEKVVADTLAVLAEHVE 209


>gi|119025180|ref|YP_909025.1| thymidylate kinase [Bifidobacterium adolescentis ATCC 15703]
 gi|154486549|ref|ZP_02027956.1| hypothetical protein BIFADO_00364 [Bifidobacterium adolescentis
           L2-32]
 gi|166221721|sp|A0ZZR0|KTHY_BIFAA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|118764764|dbj|BAF38943.1| thymidylate kinase [Bifidobacterium adolescentis ATCC 15703]
 gi|154084412|gb|EDN83457.1| hypothetical protein BIFADO_00364 [Bifidobacterium adolescentis
           L2-32]
          Length = 217

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 111/209 (53%), Gaps = 17/209 (8%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD--- 60
           G FISFEG++G GKTT +  L+ +++ +  +  VTREPGGT    A R +LL  GVD   
Sbjct: 3   GTFISFEGVDGVGKTTQVERLRAYVESQGRECVVTREPGGTALGVAIRKMLLH-GVDTGD 61

Query: 61  -----EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHL 115
                +     EA++FAA R  HV  VI PAL  G +++ DR+LDSS AYQ         
Sbjct: 62  ENDCADIAPRTEALLFAADRAQHVAEVILPALQRGAVVITDRYLDSSLAYQAGGRELTAA 121

Query: 116 FLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ 175
            + +L   +   ++P+ T +LD+       R+Q+     E+A  D+  R         R 
Sbjct: 122 EIRNLSMWATNGLLPERTYLLDMDPAQSHARLQHAEDRMEAAGNDFQRRT--------RV 173

Query: 176 IFLDIARNQPDRCHIVDSAHSFQSVATNI 204
            FLD+A  +P+R H++D++ S + V   I
Sbjct: 174 AFLDLAEREPERFHVIDASQSIEDVWARI 202


>gi|322390021|ref|ZP_08063559.1| thymidylate kinase [Streptococcus parasanguinis ATCC 903]
 gi|321143275|gb|EFX38715.1| thymidylate kinase [Streptococcus parasanguinis ATCC 903]
          Length = 212

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G  ISFEG EGAGK++ +  +   L+ K      TREPGG   AE  R V+L     
Sbjct: 1   MVNGTLISFEGPEGAGKSSVLEAVLPLLEEKGIPFITTREPGGVDIAEKIRQVILDPDHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL  GKI+L DRF+DSS AYQG         ++ L
Sbjct: 61  SMDAKTELLLYIASRRQHLVERVLPALAAGKIVLMDRFIDSSVAYQGYGRGLSVEDIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+      RE   LD    + + +H+K RQ +L +
Sbjct: 121 NQFATDGLKPDLTLYFDVDVEEGLARIAKNQE-REVNRLDL---EGLELHQKVRQGYLAL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIV 208
              +P+R   +D++ SF++V  ++L ++
Sbjct: 177 YEKEPERIVKIDASQSFEAVFADVLAVL 204


>gi|254785815|ref|YP_003073244.1| dTMP kinase [Teredinibacter turnerae T7901]
 gi|259494282|sp|C5BU64|KTHY_TERTT RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|237685419|gb|ACR12683.1| dTMP kinase [Teredinibacter turnerae T7901]
          Length = 205

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 119/205 (58%), Gaps = 12/205 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+ EG EG GK+T+++ ++ FL+ +  DV  TREPGGTP AE  R +LL+   +  
Sbjct: 2   TGRFITVEGTEGVGKSTNLAFIEGFLRSRAIDVITTREPGGTPLAEELRELLLAKREEPV 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ- 121
            A AE ++  AAR  H+  ++ PAL  G+ +LCDRF D++YAYQG   + + L L+++  
Sbjct: 62  DACAELLMVFAARAQHLNQLVAPALARGQWVLCDRFTDATYAYQG---AGRGLSLETISK 118

Query: 122 -EISVQ-EVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
            E  VQ  + PD T+ LD+ V +GL+R + R      A LD FE +DV   E+ R  +  
Sbjct: 119 LEFLVQGSLQPDITVWLDIDVRLGLERARAR------ADLDRFEEEDVSFFERVRAGYRA 172

Query: 180 IARNQPDRCHIVDSAHSFQSVATNI 204
            A   P R   +++      V T+I
Sbjct: 173 RAEEAPARFCRINAGQPLAQVQTDI 197


>gi|297201354|ref|ZP_06918751.1| thymidylate kinase [Streptomyces sviceus ATCC 29083]
 gi|297147859|gb|EFH28761.1| thymidylate kinase [Streptomyces sviceus ATCC 29083]
          Length = 1065

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 66/201 (32%), Positives = 108/201 (53%), Gaps = 8/201 (3%)

Query: 2   NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           ++G FI+ EG +GAGK+T    L  +++ K ++V VTREPG TP  +  R +LL      
Sbjct: 507 DAGFFIALEGGDGAGKSTQAEALAEWIRAKGHEVVVTREPGATPVGKRLRSILLDVSSAG 566

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
               AEA+++AA R +HV+ V+RPAL  G +++ DR++DSS AYQG         +  + 
Sbjct: 567 LSHRAEALLYAADRAEHVDTVVRPALERGAVVISDRYIDSSVAYQGAGRDLSPTEIARIN 626

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
             +   ++P  T++LD+  +I  +R         +   D  E +    H + R  FL +A
Sbjct: 627 RWATNGLVPHLTVLLDVSPEIARERF--------TEAPDRLESEPAEFHARVRSGFLTLA 678

Query: 182 RNQPDRCHIVDSAHSFQSVAT 202
              P R  +VD+    ++V+T
Sbjct: 679 AADPGRYLVVDAGQEPEAVST 699


>gi|297587209|ref|ZP_06945854.1| thymidylate kinase [Finegoldia magna ATCC 53516]
 gi|297575190|gb|EFH93909.1| thymidylate kinase [Finegoldia magna ATCC 53516]
          Length = 203

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG +G+GK+T I  +  +L   NYDV  TREPGG+P AE  R+++L     + G 
Sbjct: 1   MFITFEGPDGSGKSTIIQKVYDYLIENNYDVIKTREPGGSPIAEKIRNLILDTENTKMGY 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA+++AA+R  HVE  I PAL E KI+LCDRFL SS AYQG         +  + E +
Sbjct: 61  RTEALLYAASRAQHVEETILPALNENKIVLCDRFLISSLAYQGVGRDLGIENVRKINEFA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +  V PD  +  D+     LKR   + SL  +   D  E++    HE+    + +I  N 
Sbjct: 121 INGVYPDFVLFFDVDPITTLKR---KSSLDTA---DRLEKEGNNFHERVYNGYKEIL-NS 173

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
                I+D+  S + V +  + ++
Sbjct: 174 EKNIEIIDATQSVEDVFSQCIKVL 197


>gi|295676547|ref|YP_003605071.1| thymidylate kinase [Burkholderia sp. CCGE1002]
 gi|295436390|gb|ADG15560.1| thymidylate kinase [Burkholderia sp. CCGE1002]
          Length = 206

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 109/212 (51%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH+   +  L+ K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLGWFRERLEAKLAPSGRSVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+ +VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QQMD---LETEALLMFALRRQHLADVIEPALTRGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DLP  +  +R   R + R     D FE +     E+ R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLPPAVANER---RSAARNP---DRFESESAAFFERTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           ++  A   P R  I+DS+ S   +   +  ++
Sbjct: 172 YMRRAEEAPYRFAIIDSSQSVARIQKQLEELI 203


>gi|301051766|ref|YP_003789977.1| thymidylate kinase [Bacillus anthracis CI]
 gi|300373935|gb|ADK02839.1| thymidylate kinase [Bacillus cereus biovar anthracis str. CI]
          Length = 208

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP+ TI LD+  ++GL R+      RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPNLTIYLDIEPEVGLARIAKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ ++
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVIQVI 203


>gi|182437093|ref|YP_001824812.1| putative thymidylate kinase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326777708|ref|ZP_08236973.1| Thymidylate kinase [Streptomyces cf. griseus XylebKG-1]
 gi|178465609|dbj|BAG20129.1| putative thymidylate kinase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326658041|gb|EGE42887.1| Thymidylate kinase [Streptomyces cf. griseus XylebKG-1]
          Length = 1084

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 69/200 (34%), Positives = 108/200 (54%), Gaps = 8/200 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G F++ EG +GAGK+T +  L  +++ K ++V VTREPG TP  +  R +LL       
Sbjct: 506 TGFFLALEGGDGAGKSTQVEALADWIRSKGHEVVVTREPGATPIGKRLRSILLDVSSAGL 565

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R +HV++V+RPAL  G I++ DR++DSS AYQG         +  +  
Sbjct: 566 SNRAEALLYAADRAEHVDSVVRPALERGAIVISDRYIDSSVAYQGAGRDLAPTEIARISR 625

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P  T++LD  VD    R       R +   D  E +    HE+ R  FL +A 
Sbjct: 626 WATSGLVPHLTVLLD--VDPATARE------RFTEAPDRLESEPAAFHERVRSGFLTLAA 677

Query: 183 NQPDRCHIVDSAHSFQSVAT 202
             P R  +VD+    +S+ T
Sbjct: 678 ADPTRYLVVDAGQEPESITT 697


>gi|239989562|ref|ZP_04710226.1| putative thymidylate kinase [Streptomyces roseosporus NRRL 11379]
          Length = 1070

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 69/200 (34%), Positives = 108/200 (54%), Gaps = 8/200 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G F++ EG +GAGK+T +  L  +++ K ++V VTREPG TP  +  R +LL       
Sbjct: 497 TGFFLALEGGDGAGKSTQVEALADWIRSKGHEVVVTREPGATPIGKRLRSILLDVSSAGL 556

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R +HV++V+RPAL  G I++ DR++DSS AYQG         +  +  
Sbjct: 557 SNRAEALLYAADRAEHVDSVVRPALERGAIVISDRYIDSSVAYQGAGRDLAPTEIARISR 616

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P  T++LD  VD    R       R +   D  E +    HE+ R  FL +A 
Sbjct: 617 WATSGLVPHLTVLLD--VDPATARE------RFTEAPDRLESEPAEFHERVRSGFLTLAA 668

Query: 183 NQPDRCHIVDSAHSFQSVAT 202
             P R  +VD+    +S+ T
Sbjct: 669 ADPTRYLVVDAGQEPESITT 688


>gi|212635620|ref|YP_002312145.1| thymidylate kinase [Shewanella piezotolerans WP3]
 gi|212557104|gb|ACJ29558.1| Thymidylate kinase [Shewanella piezotolerans WP3]
          Length = 214

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 116/205 (56%), Gaps = 10/205 (4%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHV-TREPGGTPAAEAARHVL-LSCGVDEFG 63
           F+  EG+EGAGK++ I+L++ F+++      V TREPGGTP AE  R ++ ++   D   
Sbjct: 13  FVVIEGLEGAGKSSAIALVRDFIEKHTGQAPVCTREPGGTPLAEQMRDLVKVANESDPLC 72

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            EAE ++F AAR   V NVI+P+L EGK +L DR   SS AYQG       L + S+ E 
Sbjct: 73  DEAECLIFYAARAQLVANVIKPSLAEGKWVLGDRHNLSSLAYQGGGRGLMPL-VSSISEA 131

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           +++   PD T+ LD+   +GL R  NR        LD  E++++    + R  FL  A N
Sbjct: 132 TLKGFKPDLTLYLDIDPKLGLARAANR------GALDRIEQQELAFFNRTRATFLSYADN 185

Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208
             D   I+D++ S  +V  +I+ ++
Sbjct: 186 D-DSIMIIDASQSMAAVHKDIIAVL 209


>gi|161723306|ref|NP_246612.2| thymidylate kinase [Pasteurella multocida subsp. multocida str.
           Pm70]
 gi|14285512|sp|Q9CKE9|KTHY_PASMU RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
          Length = 209

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 116/206 (56%), Gaps = 10/206 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKN-YDVHVTREPGGTPAAEAARHVLLSCGV 59
           M +G FI  EGIEGAGKTT    + R L     +D+  TREPGGTP AE  R ++     
Sbjct: 1   MTTGKFIVLEGIEGAGKTTARDSIVRALHAHGIHDIVFTREPGGTPLAEKLRQLIKHETE 60

Query: 60  DEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ-GERDSSQHLFLD 118
           +    +AE ++  AAR+  VENVI+PAL +GK ++ DR   SS AYQ G R   QHL L 
Sbjct: 61  EPVTDKAELLMLYAARIQLVENVIKPALAQGKWVIGDRHDMSSQAYQGGGRQLDQHL-LH 119

Query: 119 SLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           +L++  + E  PD T+ LD+   +GL R + R        LD  E++++    + RQ + 
Sbjct: 120 TLKQTILGEFEPDLTLYLDIDPVLGLSRAKGR------GALDRIEQQNLDFFHRTRQRYQ 173

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNI 204
           ++ R+ P +   +D++ +   VA ++
Sbjct: 174 ELVRHNP-KAVTIDASQTMSKVAEDV 198


>gi|229107717|ref|ZP_04237354.1| Thymidylate kinase [Bacillus cereus Rock1-15]
 gi|228675690|gb|EEL30897.1| Thymidylate kinase [Bacillus cereus Rock1-15]
          Length = 208

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 115/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H+  R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKSVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|74317561|ref|YP_315301.1| thymidylate kinase [Thiobacillus denitrificans ATCC 25259]
 gi|123611774|sp|Q3SIM9|KTHY_THIDA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|74057056|gb|AAZ97496.1| thymidylate kinase [Thiobacillus denitrificans ATCC 25259]
          Length = 204

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 119/211 (56%), Gaps = 13/211 (6%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK+TH+  +  +L+ +  +V VTREPGGT   E  R +LL     E  
Sbjct: 5   GKFITLEGVDGAGKSTHVGFVAEWLRGQGREVIVTREPGGTALGETLRELLLH---REMA 61

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQ--GERDSSQHLFLDSLQ 121
           A+ E ++  AAR  H+  +I PAL  G  ++ DRF D+SYAYQ  G R +++   + +L+
Sbjct: 62  ADTELLLMFAARQQHLAELILPALARGAWVVSDRFTDASYAYQCGGRRIAAER--IAALE 119

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
           +   +   PD T++ D+P  +  +R   R S+R +   D FE++      + R  +L  A
Sbjct: 120 DWVQRGFAPDLTLLFDVPPAVAEER---RSSVRAA---DRFEQEAGSFFARVRDAYLVRA 173

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELV 212
           R +P R H++D+  +  +V   I  ++ +L 
Sbjct: 174 RAEPHRIHVLDARQTIDAVQAEIARLLQDLT 204


>gi|302379541|ref|ZP_07268026.1| dTMP kinase [Finegoldia magna ACS-171-V-Col3]
 gi|303234538|ref|ZP_07321175.1| dTMP kinase [Finegoldia magna BVS033A4]
 gi|302312448|gb|EFK94444.1| dTMP kinase [Finegoldia magna ACS-171-V-Col3]
 gi|302494372|gb|EFL54141.1| dTMP kinase [Finegoldia magna BVS033A4]
          Length = 203

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEG +G+GK+T I  +  +L   NYDV  TREPGG+P AE  R+++L     + G 
Sbjct: 1   MFITFEGPDGSGKSTIIQKVYDYLIENNYDVIKTREPGGSPIAEKIRNLILDTENIKMGY 60

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
             EA+++AA+R  HVE  I PAL E KI+LCDRFL SS AYQG         + ++ E +
Sbjct: 61  RTEALLYAASRAQHVEETILPALNENKIVLCDRFLISSLAYQGVGRGLGIENVRNINEFA 120

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
           +  + PD  +  D+     LKR   + SL  +   D  E++    HE+    + +I  N 
Sbjct: 121 INGIFPDFVLFFDVDPITTLKR---KSSLDTA---DRLEKEGNNFHERVYNGYKEIL-NS 173

Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208
                I+D+  S + V +  + ++
Sbjct: 174 EKNIEIIDATQSVEDVFSQCIEVL 197


>gi|110003916|emb|CAK98256.1| thymidylate kinase protein [Spiroplasma citri]
          Length = 215

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 10/213 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLS---CGVDE 61
           LFI+ EGI+G+GKTT   LLK  L+ + Y V +TREPGG   AE  R+V+LS    G+D 
Sbjct: 3   LFITLEGIDGSGKTTISKLLKEKLRSEGYQVVLTREPGGNEIAEQIRNVILSKHNLGMDP 62

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
           +    EA+++ AAR  HV   I PAL  G+I++CDRF+DS+ AYQG         LD +Q
Sbjct: 63  W---TEALLYIAARRQHVVEDILPALKRGEIVICDRFMDSTSAYQGYARGLGIWTLDEVQ 119

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I +    PD T+  D+   +  +R++    +R    ++  + +    H+K  + +  + 
Sbjct: 120 SIVLGTTKPDLTLFFDIEPTMASERMK----VRNEVEMNRLDLEKNSFHKKVYEGYQVLI 175

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
               +R  ++D++     V   +   V E++QK
Sbjct: 176 SENAERIKVIDASKPVNEVLEQVYYYVDEIIQK 208


>gi|298491750|ref|YP_003721927.1| thymidylate kinase ['Nostoc azollae' 0708]
 gi|298233668|gb|ADI64804.1| thymidylate kinase ['Nostoc azollae' 0708]
          Length = 209

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (53%), Gaps = 7/207 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG  I FEG+EG GKTT + L  ++L+  +    +T EPGGT      R +LL    D+ 
Sbjct: 2   SGKLIVFEGVEGCGKTTQMHLCSQWLRDLSVSFSLTCEPGGTELGTHLRQLLLENSEDKP 61

Query: 63  GAE-AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
            +E  E +++ A R  H+E  ++P L +GK +LCDR+ DS+ AYQG         ++ L 
Sbjct: 62  ISEITELLLYGADRAQHIEQELKPNLADGKYILCDRYTDSTIAYQGYGRGLSMSIINQLN 121

Query: 122 EISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            I+   +  D TI LD+ V++GL R       R+ A LD  E++ +  H + +Q + ++A
Sbjct: 122 YIATGGLESDLTIWLDIDVEVGLARK------RDQATLDRIEQETIAFHRRVQQGYTELA 175

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
              P R   VD + S ++V   I  I+
Sbjct: 176 ATHPSRIFRVDGSLSKETVQQRIQEIL 202


>gi|228918981|ref|ZP_04082361.1| Thymidylate kinase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228840630|gb|EEM85891.1| Thymidylate kinase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 208

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ ++
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQLI 203


>gi|296157859|ref|ZP_06840693.1| thymidylate kinase [Burkholderia sp. Ch1-1]
 gi|295892105|gb|EFG71889.1| thymidylate kinase [Burkholderia sp. Ch1-1]
          Length = 206

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 110/212 (51%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH+S  +  L++K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLSWFRERLEQKVASTGRSVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QKMD---LETEALLMFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DL  +I  +R   R + R+    D FE +      + R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLDPEIASER---RSAARDP---DRFESESEAFFSRTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +L  A   P R  I+DSA S   +   +  ++
Sbjct: 172 YLRRAEEAPYRFAIIDSAQSITQIQRRLEELI 203


>gi|323351073|ref|ZP_08086730.1| thymidylate kinase [Streptococcus sanguinis VMC66]
 gi|322122797|gb|EFX94506.1| thymidylate kinase [Streptococcus sanguinis VMC66]
          Length = 212

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 113/210 (53%), Gaps = 4/210 (1%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ IS EG EGAGK++ +  L  FL+     +  TREPGG   AE  R V+L     
Sbjct: 1   MKNGILISLEGPEGAGKSSVLEALLPFLKNYGTGLITTREPGGVQIAETIREVILEPSHT 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              A+ E +++ A+R  H+   + PAL +GK++L DRF+DSS AYQG         ++ L
Sbjct: 61  AMDAKTELLLYIASRRQHLTERVLPALAQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +   + PD T+  D+ V+ GL R+    S RE   LD    + + +H++ RQ +L I
Sbjct: 121 NQFATDGLKPDLTLYFDIDVEEGLARIAKSES-REVNRLDL---EGLDLHQRVRQGYLAI 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
              +P+R   VD++     V  + L I+ E
Sbjct: 177 LDKEPERFVKVDASQPLDKVVADSLAIIQE 206


>gi|125623282|ref|YP_001031765.1| thymidylate kinase [Lactococcus lactis subsp. cremoris MG1363]
 gi|166221749|sp|A2RIC4|KTHY_LACLM RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|12483716|gb|AAG53731.1|AF178425_1 TcsCorf1 [Lactococcus lactis subsp. cremoris MG1363]
 gi|124492090|emb|CAL97019.1| Tmk protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|300070033|gb|ADJ59433.1| thymidylate kinase [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 211

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 116/207 (56%), Gaps = 6/207 (2%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G+ IS EG +GAGKTT +  +   +Q+   +V  TREPGG   AE  R ++L     E 
Sbjct: 2   NGILISLEGPDGAGKTTVLQEILPEIQKMKREVVPTREPGGVRVAEEIRQIILDPKNTEI 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            ++ E ++FAAAR  H++  + PAL  GK+++ DRF+DSS AYQG         +D L  
Sbjct: 62  DSKTELMLFAAARRLHMQEKMLPALRAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNY 121

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRV-QNRYSLRESACLDYFERKDVMIHEKRRQIFLDIA 181
            +   + PD T+  D+  D+ L+R+ +NR    E   LD  ER +  +H K R+ +L+I 
Sbjct: 122 FATDGLKPDLTLYFDIDTDVALERIMKNRAD--EVNRLD-LERAE--MHRKVREGYLEIV 176

Query: 182 RNQPDRCHIVDSAHSFQSVATNILNIV 208
             +P R   +D++ S + V  + L ++
Sbjct: 177 AKEPGRFVKIDASQSLEKVVADTLEVL 203


>gi|288905947|ref|YP_003431169.1| thymidylate kinase [Streptococcus gallolyticus UCN34]
 gi|288732673|emb|CBI14245.1| thymidylate kinase [Streptococcus gallolyticus UCN34]
          Length = 211

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 114/214 (53%), Gaps = 5/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ ISFEG +GAGKTT +  +   LQ K YD+  TREPGG   AE  R V+L     
Sbjct: 1   MKNGIIISFEGPDGAGKTTVLEQVLPVLQEKGYDIVTTREPGGVEIAERIRDVILDVNHV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              ++ E +++ AAR  H    + PAL  GK++L DRF+DSS AYQG         +  L
Sbjct: 61  AMDSKTELLLYMAARRQHYVEKVLPALEAGKVVLIDRFIDSSIAYQGAGRGLDKDIITRL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            + +     PD T+  D+  +IGL R+  + + RE   LD  E+ D  +H++ R+ +L +
Sbjct: 121 NDFATDGRKPDLTLYFDVESEIGLARIA-KNAEREVNRLD-LEKLD--MHKRVRKGYLAL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A  Q  R   +D++     V    L+ + E + K
Sbjct: 177 A-EQEKRIVTIDASRELADVVLETLHTILEQLAK 209


>gi|329910241|ref|ZP_08275259.1| Thymidylate kinase [Oxalobacteraceae bacterium IMCC9480]
 gi|327546227|gb|EGF31265.1| Thymidylate kinase [Oxalobacteraceae bacterium IMCC9480]
          Length = 205

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 110/209 (52%), Gaps = 15/209 (7%)

Query: 6   FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65
           FI+FEGI+GAGK++H+S +   L  +   V  TREPGGTP  E  R VLL     +   E
Sbjct: 9   FITFEGIDGAGKSSHLSFVADLLVARGIRVTSTREPGGTPLGEQLRSVLLH---QKMHLE 65

Query: 66  AEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHL---FLDSLQE 122
            EA++  A+R +H+  VI PAL  G  ++ DRF D+++AYQG     +HL    L+ L++
Sbjct: 66  TEALLMFASRREHLAQVIEPALARGDWVISDRFTDATFAYQG---GGRHLPVAKLEQLEQ 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
                + PD T++ D+P+D+       R  L  +  LD FE++        R  +L  A 
Sbjct: 123 WVHPHLQPDLTLLFDVPLDVA------RARLDATRSLDKFEQEQSDFFAGVRGEYLRRAA 176

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWEL 211
             P R  IVDS  S   V   +  I+  L
Sbjct: 177 QFPARFRIVDSTQSMAQVRAALTAIMASL 205


>gi|170692442|ref|ZP_02883605.1| dTMP kinase [Burkholderia graminis C4D1M]
 gi|170142872|gb|EDT11037.1| dTMP kinase [Burkholderia graminis C4D1M]
          Length = 206

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 111/212 (52%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH++  +  L++K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLAWFRERLEQKVAATGRAVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QKMD---LETEALLMFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DL  +I  +R   R + R+    D FE +     E+ R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLAPEIANER---RSAARDP---DRFESESAAFFERTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +L  A   P R  I+DS+ S   +   +  ++
Sbjct: 172 YLRRAEEAPYRFAIIDSSQSIVRIQKQLEELI 203


>gi|89070236|ref|ZP_01157560.1| thymidylate kinase [Oceanicola granulosus HTCC2516]
 gi|89044156|gb|EAR50314.1| thymidylate kinase [Oceanicola granulosus HTCC2516]
          Length = 202

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 101/193 (52%), Gaps = 10/193 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G FI+FEGI+G+GK+T   LL   L     D  +TREPGG+  AE  R ++L+    
Sbjct: 1   MAPGRFITFEGIDGSGKSTQARLLAERLP----DALLTREPGGSAGAEEIRALVLNGDPG 56

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
            + AE E ++F AAR DH+E  I PAL  G+ ++CDRF DS+  YQG         +D L
Sbjct: 57  RWSAETELLLFTAARRDHLEKTIEPALAAGRTVICDRFADSTRVYQGATRGDLRATVDKL 116

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
             +++    PD T I+D+  +  L R   R           FE   + + E  R  FL +
Sbjct: 117 HALTIGR-EPDLTFIIDMDPETALARGVARPGAER-----RFEDFGLALQETVRHGFLSL 170

Query: 181 ARNQPDRCHIVDS 193
           AR   +RC ++D 
Sbjct: 171 ARQFSERCIVIDG 183


>gi|297205016|ref|ZP_06922412.1| thymidylate kinase [Lactobacillus jensenii JV-V16]
 gi|297149594|gb|EFH29891.1| thymidylate kinase [Lactobacillus jensenii JV-V16]
          Length = 215

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 120/212 (56%), Gaps = 11/212 (5%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRK-NYDVHVTREPGGTPAAEAARHVLLSCGVDE 61
           +G FI+FEG +GAGKTT +  L   +++K   ++ VTREPGG+  AEA R ++L+    E
Sbjct: 2   AGYFITFEGPDGAGKTTVLEKLVEEIKKKVTCEILVTREPGGSKIAEAIRDIILNPENTE 61

Query: 62  FGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQ 121
                EA+++AAAR  H+  V+ PAL  G+++  DRF+DSS AYQG     ++L ++ + 
Sbjct: 62  MDDRTEALLYAAARSQHMAEVVFPALEAGRLVFSDRFVDSSLAYQG---MGRNLGIEKVA 118

Query: 122 EI---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFL 178
           EI   +   + P+ T+ LD+    GL R+      +E    D  E++ +  H+K    + 
Sbjct: 119 EINQFATDGLNPNLTLFLDIDPKAGLARIAKVRPDKE----DRLEKEKLSFHQKVYTGYQ 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWE 210
           +I +  P+R  +VD++     V  + L I+ +
Sbjct: 175 EIVKRYPERIKVVDASQDIDQVVADCLAILKQ 206


>gi|306831966|ref|ZP_07465121.1| thymidylate kinase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|304425892|gb|EFM29009.1| thymidylate kinase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 211

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 114/214 (53%), Gaps = 5/214 (2%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M +G+ ISFEG +GAGKTT +  +   LQ K YD+  TREPGG   AE  R V+L     
Sbjct: 1   MKNGIIISFEGPDGAGKTTVLEQVLPVLQEKGYDIVTTREPGGVEIAERIRDVILDVNHV 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
              ++ E +++ AAR  H    + PAL  GK++L DRF+DSS AYQG         +  L
Sbjct: 61  AMDSKTELLLYMAARRQHYVEKVLPALEAGKVVLIDRFIDSSIAYQGAGRGLDKDIITRL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
            +       PD T+  D+  +IGL R+  + + RE   LD  E+ D  +H++ R+ +L +
Sbjct: 121 NDFVTDGRKPDLTLYFDVESEIGLARIA-KNAEREVNRLD-LEKLD--MHKRVREGYLAL 176

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
           A  Q  R   +D++     V +  L+ + E + K
Sbjct: 177 A-EQEKRIVTIDASRELADVVSETLHTILEQLAK 209


>gi|228905827|ref|ZP_04069725.1| Thymidylate kinase [Bacillus thuringiensis IBL 200]
 gi|228853767|gb|EEM98526.1| Thymidylate kinase [Bacillus thuringiensis IBL 200]
          Length = 208

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + +++   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQRAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ I+
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVVQII 203


>gi|184201527|ref|YP_001855734.1| thymidylate kinase [Kocuria rhizophila DC2201]
 gi|183581757|dbj|BAG30228.1| thymidylate kinase [Kocuria rhizophila DC2201]
          Length = 218

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G  I FEG +GAGK+T +S L + L+   + V  TREPGGTP AE+ R ++L        
Sbjct: 7   GALIVFEGGDGAGKSTQVSALVQALRAGGHTVTCTREPGGTPLAESVRALVLDPAHAPVA 66

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
              EA++FA+AR DHV  +IRPA+  G+I++CDRF+DSS AYQG         +  L + 
Sbjct: 67  PATEALLFASARADHVARLIRPAVERGEIVVCDRFVDSSVAYQGAGRGLGLARVADLNQW 126

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
           ++Q ++PD T++LD  VD   +        R  +  D  E +D+  H      F ++A  
Sbjct: 127 ALQGLVPDLTVLLD--VD---QTTAQARRRRRGSASDRMEAEDLAFHATVNAAFRELAAA 181

Query: 184 QPDRCHIVDSAHSFQSV 200
            P R  ++D+A S + +
Sbjct: 182 APQRYLVLDAAESAERI 198


>gi|163789941|ref|ZP_02184377.1| thymidylate kinase [Carnobacterium sp. AT7]
 gi|159874881|gb|EDP68949.1| thymidylate kinase [Carnobacterium sp. AT7]
          Length = 211

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 117/214 (54%), Gaps = 8/214 (3%)

Query: 4   GLFISFEGIEGAGKTTHIS-LLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           G+FI+ EG +GAGKT+ I  L+   ++    ++  TREPGG+  AE  R ++L+    E 
Sbjct: 3   GIFITIEGPDGAGKTSVIKKLIPMLVETIQQEIVATREPGGSRIAEEIRELILNPENIEM 62

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
               EA+++AA R  H+   I PAL  GK+++CDRF+DSS AYQG         +  + +
Sbjct: 63  DIRTEALLYAAGRRQHLVEKIIPALETGKVVICDRFVDSSLAYQGVARGIGISEVAEINQ 122

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   + PD T+ LD+   +GL+R+      R+    D  +++ +  HEK R  +L IA+
Sbjct: 123 FATDNLSPDLTLYLDIEAHLGLERINQNKDNRQ---FDRLDQETLEFHEKVRSAYLAIAK 179

Query: 183 NQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV 216
            Q +R   +D++   + V  +     +E + KR+
Sbjct: 180 EQSERIVQIDASQELEKVVAD----CYETIIKRI 209


>gi|228937333|ref|ZP_04099980.1| Thymidylate kinase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228970219|ref|ZP_04130879.1| Thymidylate kinase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228976789|ref|ZP_04137202.1| Thymidylate kinase [Bacillus thuringiensis Bt407]
 gi|228782885|gb|EEM31050.1| Thymidylate kinase [Bacillus thuringiensis Bt407]
 gi|228789454|gb|EEM37373.1| Thymidylate kinase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228822291|gb|EEM68272.1| Thymidylate kinase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|326937822|gb|AEA13718.1| thymidylate kinase [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 208

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R++     RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIEKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     +R  +V++    + +   ++ I+
Sbjct: 175 VVERFSERIVLVNADQPMEKLIEEVVQII 203


>gi|91775853|ref|YP_545609.1| thymidylate kinase [Methylobacillus flagellatus KT]
 gi|123078858|sp|Q1H169|KTHY_METFK RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|91709840|gb|ABE49768.1| thymidylate kinase [Methylobacillus flagellatus KT]
          Length = 203

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 110/208 (52%), Gaps = 9/208 (4%)

Query: 4   GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63
           G FI+ EG++GAGK++HI  +   L+ +  +V  TREPGGTP  E  R +LL    +   
Sbjct: 3   GRFITLEGMDGAGKSSHIESIVSVLEGRGLEVVSTREPGGTPLGEKLRELLLH---ERMH 59

Query: 64  AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123
            E E ++  AAR +H+  VI PAL  G  ++ DRF D+S+AYQ          +++L+  
Sbjct: 60  VETETLLMFAARREHIAEVIEPALARGAWVVSDRFTDASFAYQCGGRGVPCEKVEALEAW 119

Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183
              ++ PD T++ D+PV+I + R      L  +   D FER+      + R  +L  A  
Sbjct: 120 VHPDLQPDLTLLFDVPVEISVAR------LAAARTPDKFERESAEFFRRIRNGYLARAEA 173

Query: 184 QPDRCHIVDSAHSFQSVATNILNIVWEL 211
           QP R  ++D      +V   +L+I+ E 
Sbjct: 174 QPQRFRLIDGNRPMDTVRKEVLDIMREF 201


>gi|217077269|ref|YP_002334987.1| tmk thymidylate kinase [Thermosipho africanus TCF52B]
 gi|226732664|sp|B7IHT2|KTHY_THEAB RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|217037124|gb|ACJ75646.1| tmk thymidylate kinase [Thermosipho africanus TCF52B]
          Length = 201

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 116/209 (55%), Gaps = 9/209 (4%)

Query: 5   LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64
           +FI+FEGI+G+GK+T ++LL ++L+ K   V   REPGGT   E  R +LL   ++    
Sbjct: 1   MFIAFEGIDGSGKSTQLNLLSQYLKSKGKKVLNIREPGGTILGEKIREILLDNNLN-INK 59

Query: 65  EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124
            +E ++F A+R   VE VI+P L  G  +L DRF DSS AYQG   +     + +L + +
Sbjct: 60  RSELLLFLASRAQLVEEVIKPHLKRGFFVLADRFSDSSIAYQGGARNIGVETVSTLNDFA 119

Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184
              + PD    +D+P  I ++R++++        LD  E++  +  EK R  +L +++ +
Sbjct: 120 TDNIYPDIVFYIDIPTKIAMERLKDK-------NLDRLEKEGQIFLEKVRNTYLKLSKLR 172

Query: 185 PDRCHIVDSAHSFQSVATNILNIVWELVQ 213
            D   I+D   S  +V   I +IV + +Q
Sbjct: 173 -DNFFIIDGTKSIDNVFAEIKSIVEKHLQ 200


>gi|206977923|ref|ZP_03238810.1| thymidylate kinase [Bacillus cereus H3081.97]
 gi|206743829|gb|EDZ55249.1| thymidylate kinase [Bacillus cereus H3081.97]
 gi|324324020|gb|ADY19280.1| thymidylate kinase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 208

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 115/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAISEEIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALDEDYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R+      RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIAKDAG-REVNRLDM---EDITFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ ++
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVIQVI 203


>gi|289449651|ref|YP_003475316.1| dTMP kinase [Clostridiales genomosp. BVAB3 str. UPII9-5]
 gi|289184198|gb|ADC90623.1| dTMP kinase [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 212

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 115/216 (53%), Gaps = 10/216 (4%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  G  I+FEGI+G+GKTT ++LL  +L+R+N  V V REPGGT   EA R +LLS    
Sbjct: 1   MRKGQLITFEGIDGSGKTTQLNLLADYLRRQNEAVVVLREPGGTELGEAVRSLLLSSKYK 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           +    +E  +F AAR      VI PAL  GK +LCDRF+DS+ AYQG         L SL
Sbjct: 61  KMSDRSELYLFLAARAQLCNEVIAPALSLGKFVLCDRFIDSTIAYQGYGRGLDPATLKSL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNR-YSL-RESACLDYFERKDVMIHEKRRQIFL 178
             ++   + P+ T  L +PV   ++R+  R  +L R  A  D+F +  V  ++       
Sbjct: 121 NSMATAGISPNITFYLRIPVATAVERMMVRDIALDRMEAQADHFRQAVVKGYDV------ 174

Query: 179 DIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQK 214
            +A  +P R   + +  S +++   ILN V   + K
Sbjct: 175 -LAATEP-RFVTIKADQSIENIHEIILNEVRRFIYK 208


>gi|30260220|ref|NP_842597.1| thymidylate kinase [Bacillus anthracis str. Ames]
 gi|47525283|ref|YP_016632.1| thymidylate kinase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183064|ref|YP_026316.1| thymidylate kinase [Bacillus anthracis str. Sterne]
 gi|49480017|ref|YP_034384.1| thymidylate kinase [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52145185|ref|YP_081643.1| thymidylate kinase [Bacillus cereus E33L]
 gi|65317490|ref|ZP_00390449.1| COG0125: Thymidylate kinase [Bacillus anthracis str. A2012]
 gi|165872581|ref|ZP_02217213.1| thymidylate kinase [Bacillus anthracis str. A0488]
 gi|167635117|ref|ZP_02393434.1| thymidylate kinase [Bacillus anthracis str. A0442]
 gi|167641523|ref|ZP_02399771.1| thymidylate kinase [Bacillus anthracis str. A0193]
 gi|170688929|ref|ZP_02880131.1| thymidylate kinase [Bacillus anthracis str. A0465]
 gi|170707594|ref|ZP_02898047.1| thymidylate kinase [Bacillus anthracis str. A0389]
 gi|177655343|ref|ZP_02936872.1| thymidylate kinase [Bacillus anthracis str. A0174]
 gi|190568957|ref|ZP_03021858.1| thymidylate kinase [Bacillus anthracis Tsiankovskii-I]
 gi|196036358|ref|ZP_03103755.1| thymidylate kinase [Bacillus cereus W]
 gi|196041790|ref|ZP_03109080.1| dTMP kinase [Bacillus cereus NVH0597-99]
 gi|218901231|ref|YP_002449065.1| thymidylate kinase [Bacillus cereus AH820]
 gi|227812703|ref|YP_002812712.1| thymidylate kinase [Bacillus anthracis str. CDC 684]
 gi|228912770|ref|ZP_04076418.1| Thymidylate kinase [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228925284|ref|ZP_04088381.1| Thymidylate kinase [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228931533|ref|ZP_04094440.1| Thymidylate kinase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228943837|ref|ZP_04106223.1| Thymidylate kinase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|229089163|ref|ZP_04220445.1| Thymidylate kinase [Bacillus cereus Rock3-42]
 gi|229119693|ref|ZP_04248955.1| Thymidylate kinase [Bacillus cereus 95/8201]
 gi|229603011|ref|YP_002864681.1| dTMP kinase [Bacillus anthracis str. A0248]
 gi|254682343|ref|ZP_05146204.1| thymidylate kinase [Bacillus anthracis str. CNEVA-9066]
 gi|254724171|ref|ZP_05185956.1| thymidylate kinase [Bacillus anthracis str. A1055]
 gi|254733566|ref|ZP_05191287.1| thymidylate kinase [Bacillus anthracis str. Western North America
           USA6153]
 gi|254744666|ref|ZP_05202345.1| thymidylate kinase [Bacillus anthracis str. Kruger B]
 gi|254756371|ref|ZP_05208400.1| thymidylate kinase [Bacillus anthracis str. Vollum]
 gi|254762427|ref|ZP_05214269.1| thymidylate kinase [Bacillus anthracis str. Australia 94]
 gi|300119126|ref|ZP_07056827.1| thymidylate kinase [Bacillus cereus SJ1]
 gi|46576505|sp|Q81W11|KTHY_BACAN RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|59798175|sp|Q63HH8|KTHY_BACCZ RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|59798283|sp|Q6HPY6|KTHY_BACHK RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|254808275|sp|C3P9H5|KTHY_BACAA RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|254808276|sp|C3LJ02|KTHY_BACAC RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|30253541|gb|AAP24083.1| dTMP kinase [Bacillus anthracis str. Ames]
 gi|47500431|gb|AAT29107.1| thymidylate kinase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49176991|gb|AAT52367.1| thymidylate kinase [Bacillus anthracis str. Sterne]
 gi|49331573|gb|AAT62219.1| thymidylate kinase [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51978654|gb|AAU20204.1| thymidylate kinase [Bacillus cereus E33L]
 gi|164711709|gb|EDR17254.1| thymidylate kinase [Bacillus anthracis str. A0488]
 gi|167510508|gb|EDR85906.1| thymidylate kinase [Bacillus anthracis str. A0193]
 gi|167529591|gb|EDR92341.1| thymidylate kinase [Bacillus anthracis str. A0442]
 gi|170127590|gb|EDS96464.1| thymidylate kinase [Bacillus anthracis str. A0389]
 gi|170667153|gb|EDT17914.1| thymidylate kinase [Bacillus anthracis str. A0465]
 gi|172080184|gb|EDT65277.1| thymidylate kinase [Bacillus anthracis str. A0174]
 gi|190559881|gb|EDV13865.1| thymidylate kinase [Bacillus anthracis Tsiankovskii-I]
 gi|195990988|gb|EDX54959.1| thymidylate kinase [Bacillus cereus W]
 gi|196027410|gb|EDX66027.1| dTMP kinase [Bacillus cereus NVH0597-99]
 gi|218540056|gb|ACK92454.1| thymidylate kinase [Bacillus cereus AH820]
 gi|227003623|gb|ACP13366.1| dTMP kinase [Bacillus anthracis str. CDC 684]
 gi|228663718|gb|EEL19296.1| Thymidylate kinase [Bacillus cereus 95/8201]
 gi|228694126|gb|EEL47807.1| Thymidylate kinase [Bacillus cereus Rock3-42]
 gi|228815794|gb|EEM62029.1| Thymidylate kinase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228828085|gb|EEM73812.1| Thymidylate kinase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228834331|gb|EEM79871.1| Thymidylate kinase [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228846830|gb|EEM91834.1| Thymidylate kinase [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|229267419|gb|ACQ49056.1| dTMP kinase [Bacillus anthracis str. A0248]
 gi|298723448|gb|EFI64189.1| thymidylate kinase [Bacillus cereus SJ1]
          Length = 208

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 115/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R+      RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARIAKDAG-REVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     DR  +V++    + +   ++ ++
Sbjct: 175 VVERFSDRIVLVNADQPMEKLIEEVIQVI 203


>gi|254388750|ref|ZP_05003983.1| hypothetical protein SSCG_01563 [Streptomyces clavuligerus ATCC
           27064]
 gi|197702470|gb|EDY48282.1| hypothetical protein SSCG_01563 [Streptomyces clavuligerus ATCC
           27064]
          Length = 747

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 106/202 (52%), Gaps = 8/202 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           +G FI+ EG +GAGK+T    L  +++ K ++V VTREPG TP  +  R +LL       
Sbjct: 151 TGFFIALEGGDGAGKSTQAEALATWIRNKGHEVVVTREPGATPVGKRLRSILLDVASAGL 210

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R +HV +V+RPAL  G +++ DR++DSS AYQG         +  +  
Sbjct: 211 SNRAEALLYAADRAEHVGSVVRPALERGAVVISDRYIDSSVAYQGAGRDLSPTEIARISR 270

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P  T++LD+  +   +R         +   D  E +    H + R  FL +A 
Sbjct: 271 WATDGLVPHLTVLLDVSPETARERF--------TEAPDRLESEPAEFHRRVRSGFLTLAA 322

Query: 183 NQPDRCHIVDSAHSFQSVATNI 204
             P R  +VD+    ++V T +
Sbjct: 323 GDPARYLVVDAGQEPEAVTTVV 344


>gi|302559329|ref|ZP_07311671.1| dTMP kinase [Streptomyces griseoflavus Tu4000]
 gi|302476947|gb|EFL40040.1| dTMP kinase [Streptomyces griseoflavus Tu4000]
          Length = 854

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 66/202 (32%), Positives = 106/202 (52%), Gaps = 8/202 (3%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
           SG FI+ EG +GAGK+T    L  +++ K ++V +TREPG TP  +  R +LL       
Sbjct: 508 SGFFIALEGGDGAGKSTQAEALAEWIRAKGHEVVLTREPGATPVGKRLRSILLDVSSAGL 567

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
              AEA+++AA R +H++ V+RPAL  G +++ DR++DSS AYQG         +  +  
Sbjct: 568 SHRAEALLYAADRAEHIDTVVRPALERGAVVITDRYIDSSVAYQGAGRDLSPTEIARINR 627

Query: 123 ISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIAR 182
            +   ++P  T++LD+  +   +R         +   D  E +    H + R  FL +A 
Sbjct: 628 WATDGLVPHLTVLLDVAPETARERF--------TEAPDRLESEPAEFHARVRSGFLTLAA 679

Query: 183 NQPDRCHIVDSAHSFQSVATNI 204
             P R  +VD+    +SV T I
Sbjct: 680 ADPGRYLVVDAGQEPESVTTVI 701


>gi|186475808|ref|YP_001857278.1| thymidylate kinase [Burkholderia phymatum STM815]
 gi|229487611|sp|B2JGP7|KTHY_BURP8 RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|184192267|gb|ACC70232.1| dTMP kinase [Burkholderia phymatum STM815]
          Length = 206

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (51%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH+   +  L++K       V +TREPGGT   E+ R +LL 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLGWFRDRLEQKVAPAGRSVVMTREPGGTKLGESLRDILLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  AAR +H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  EAMD---LETEALLMFAARREHLAQVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ D+P D   +R   R + R     D FE +      + R  
Sbjct: 118 LEALERWVQGGFQPDLTVLFDVPPDTASER---RSAAR---APDRFESESDAFFARTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +L  A   P R  I+DS  S   +   + +++
Sbjct: 172 YLRRAEEAPYRFAIIDSTRSIADIQKQLEDLI 203


>gi|229009541|ref|ZP_04166768.1| Thymidylate kinase [Bacillus mycoides DSM 2048]
 gi|228751685|gb|EEM01484.1| Thymidylate kinase [Bacillus mycoides DSM 2048]
          Length = 208

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 117/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKKEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALEENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R+  + + RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARI-GKDAGREVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     +R  +V++    + +   ++ I+
Sbjct: 175 VVERFSNRIVLVNADQPMKKLIEEVVQII 203


>gi|91783552|ref|YP_558758.1| thymidylate kinase [Burkholderia xenovorans LB400]
 gi|123062899|sp|Q13YY3|KTHY_BURXL RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|91687506|gb|ABE30706.1| thymidylate kinase [Burkholderia xenovorans LB400]
          Length = 206

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (51%), Gaps = 13/212 (6%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRK----NYDVHVTREPGGTPAAEAARHVLLS 56
           M  G FI+FEGI+GAGKTTH+S  +  L++K       V +TREPGGTP  E  R ++L 
Sbjct: 1   MARGKFITFEGIDGAGKTTHLSWFRERLEQKVASTGRSVVMTREPGGTPLGEQIREIVLH 60

Query: 57  CGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLF 116
             +D    E EA++  A R  H+  VI PAL  G  +L DRF D+++AYQG         
Sbjct: 61  QKMD---LETEALLMFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDK 117

Query: 117 LDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQI 176
           L++L+        PD T++ DL  ++  +R   R + R+    D FE +      + R  
Sbjct: 118 LETLERWVQGGFQPDLTVLFDLDPEVASER---RSAARDP---DRFESESEAFFSRTRAE 171

Query: 177 FLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +L  A   P R  I+DSA S   +   +  ++
Sbjct: 172 YLRRAEEAPYRFAIIDSAQSIAQIQRRLEELI 203


>gi|84495036|ref|ZP_00994155.1| thymidylate kinase [Janibacter sp. HTCC2649]
 gi|84384529|gb|EAQ00409.1| thymidylate kinase [Janibacter sp. HTCC2649]
          Length = 210

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 104/193 (53%), Gaps = 10/193 (5%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           M  GLFI+FEG +GAGK+T + LL   L+    +V VTR+PGGTP     R ++L    D
Sbjct: 1   MTQGLFIAFEGGDGAGKSTQVRLLAAALESLGREVVVTRQPGGTPLGAQIRDLVLHG--D 58

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
                AEA++FAA +  HV+ +IRPA+  G +++ DR+ DS+ AYQG         +  L
Sbjct: 59  HVSPRAEALLFAADKAHHVDQLIRPAMDRGSVVITDRYTDSAVAYQGAGRDLGASEVHEL 118

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           Q  +V  ++PD T+I+D+    G +        R     D  E +    H+  R  FL +
Sbjct: 119 QMWAVGSLVPDLTVIVDVTAQEGRR--------RRGEVHDRLESEADAFHDAIRHHFLAM 170

Query: 181 ARNQPDRCHIVDS 193
           A+  P+R  +VD 
Sbjct: 171 AQGSPERYLVVDG 183


>gi|163938038|ref|YP_001642922.1| thymidylate kinase [Bacillus weihenstephanensis KBAB4]
 gi|229131038|ref|ZP_04259951.1| Thymidylate kinase [Bacillus cereus BDRD-ST196]
 gi|229165020|ref|ZP_04292816.1| Thymidylate kinase [Bacillus cereus AH621]
 gi|229487581|sp|A9VN43|KTHY_BACWK RecName: Full=Thymidylate kinase; AltName: Full=dTMP kinase
 gi|163860235|gb|ABY41294.1| dTMP kinase [Bacillus weihenstephanensis KBAB4]
 gi|228618405|gb|EEK75434.1| Thymidylate kinase [Bacillus cereus AH621]
 gi|228652375|gb|EEL08299.1| Thymidylate kinase [Bacillus cereus BDRD-ST196]
          Length = 208

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 117/209 (55%), Gaps = 10/209 (4%)

Query: 3   SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF 62
            GLF++ EG EG+GKTT I  L  + ++K   V  TREPGG   +E  R +L        
Sbjct: 2   KGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAISEDIRTILHKQEYTMM 61

Query: 63  GAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQE 122
            A  EA+++AAAR  H+   + PAL E  ++LCDRF+DSS AYQG    ++ L +D + E
Sbjct: 62  EARTEALLYAAARRQHLVEKVMPALEENYLVLCDRFIDSSLAYQG---YARGLGMDKVFE 118

Query: 123 I---SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLD 179
           I   + ++ MP  TI LD+  ++GL R+  + + RE   LD    +D+  H++ R+ +L 
Sbjct: 119 INRFATEDCMPSLTIYLDIEPEVGLARI-GKDAGREVNRLDM---EDISFHKRVREGYLQ 174

Query: 180 IARNQPDRCHIVDSAHSFQSVATNILNIV 208
           +     +R  +V++    + +   ++ I+
Sbjct: 175 VVERFSNRIVLVNADQPMKKLIEEVVQII 203


>gi|167755132|ref|ZP_02427259.1| hypothetical protein CLORAM_00636 [Clostridium ramosum DSM 1402]
 gi|237733442|ref|ZP_04563923.1| thymidylate kinase [Mollicutes bacterium D7]
 gi|167705182|gb|EDS19761.1| hypothetical