RPSBLAST alignment for GI: 254780218 and conserved domain: KOG3327

>gnl|CDD|38537 KOG3327, KOG3327, KOG3327, Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism]. Length = 208
 Score = 51.5 bits (123), Expect = 2e-07
 Identities = 53/221 (23%), Positives = 85/221 (38%), Gaps = 42/221 (19%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-AEAARHVLLSCG- 58
           M  G  I  EG++ +GK+T    L   L            PG  PA          S G 
Sbjct: 2   MIRGALIVLEGLDRSGKSTQCGKLVESLI-----------PGLDPAELLRFPERSTSIGK 50

Query: 59  ------VDEFGAEAEAI--VFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERD 110
                   +       I  +F+A R +HV ++I+  L +G  L+ DR+  S  AY     
Sbjct: 51  LIDGYLRKKSDLPDHTIHLLFSANRWEHV-SLIKEKLAKGTTLIVDRYSFSGVAYSA--- 106

Query: 111 SSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQ---NRYSLRESACLDYFERKDV 167
            ++ L LD  ++  V    PD  + LD+  +   +R      RY             + V
Sbjct: 107 -AKGLDLDWCKQPDVGLPKPDLVLFLDVSPEDAARRGGFGEERY-------------ETV 152

Query: 168 MIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208
              EK    F  + R +    H+VD++ S + V   + ++V
Sbjct: 153 AFQEKVLVFFQKLLRKEDLNWHVVDASKSVEKVHQQVRSLV 193