RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62] (225 letters) >gnl|CDD|30474 COG0125, Tmk, Thymidylate kinase [Nucleotide transport and metabolism]. Length = 208 Score = 194 bits (495), Expect = 2e-50 Identities = 86/205 (41%), Positives = 130/205 (63%), Gaps = 6/205 (2%) Query: 4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFG 63 G+FI EGI+GAGKTT LLK L+ + V +TREPGGTP E R +LL+ G ++ Sbjct: 3 GMFIVIEGIDGAGKTTQAELLKERLEERGIKVVLTREPGGTPIGEKIRELLLN-GEEKLS 61 Query: 64 AEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEI 123 +AEA++FAA R H+E VI+PAL EGK+++CDR++DSS AYQG ++ +L E Sbjct: 62 PKAEALLFAADRAQHLEEVIKPALKEGKVVICDRYVDSSLAYQGGGRGLDLDWVLALNEF 121 Query: 124 SVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARN 183 + + PD T+ LD+P ++ L+R++ R LR D FE++D EK R+ +L++A Sbjct: 122 APGGLKPDLTLYLDVPPEVALERIRKRGELR-----DRFEKEDDEFLEKVREGYLELAAK 176 Query: 184 QPDRCHIVDSAHSFQSVATNILNIV 208 P+R ++D++ + V IL I+ Sbjct: 177 FPERIIVIDASRPLEEVHEEILKIL 201 >gnl|CDD|30190 cd01672, TMPK, Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).. Length = 200 Score = 192 bits (488), Expect = 9e-50 Identities = 82/204 (40%), Positives = 125/204 (61%), Gaps = 6/204 (2%) Query: 5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64 +FI FEGI+GAGKTT I LL L+ + Y+V +TREPGGTP EA R +LL ++ Sbjct: 1 MFIVFEGIDGAGKTTLIELLAERLEARGYEVVLTREPGGTPIGEAIRELLLDPEDEKMDP 60 Query: 65 EAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEIS 124 AE ++FAA R HVE VI+PAL GKI+L DRF+DSS AYQG +++L +++ Sbjct: 61 RAELLLFAADRAQHVEEVIKPALARGKIVLSDRFVDSSLAYQGAGRGLGEALIEALNDLA 120 Query: 125 VQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQ 184 + PD TI+LD+ ++GL R++ R E++ + HE+ R+ +L++A + Sbjct: 121 TGGLKPDLTILLDIDPEVGLARIEARGRDDR------DEQEGLEFHERVREGYLELAAQE 174 Query: 185 PDRCHIVDSAHSFQSVATNILNIV 208 P+R ++D++ + V IL + Sbjct: 175 PERIIVIDASQPLEEVLAEILKAI 198 >gnl|CDD|145402 pfam02223, Thymidylate_kin, Thymidylate kinase. Length = 186 Score = 151 bits (383), Expect = 2e-37 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 10/196 (5%) Query: 9 FEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEA 68 EG++GAGKTT LLK L+ + V +TREPGGTP E R +LL EA Sbjct: 1 IEGLDGAGKTTQAELLKERLKEQGIKVVLTREPGGTPIGEKIRELLLRNEELSP--LTEA 58 Query: 69 IVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEV 128 ++FAA R++H+E I+PAL +GK ++CDR+L SS AYQG + SL V Sbjct: 59 LLFAADRIEHLEEKIKPALKQGKTVICDRYLFSSIAYQGAAGGLGLDLVLSLNP-DVPGP 117 Query: 129 MPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRC 188 PD T +LD+ ++ LKR++ R L E FE + + K R+ +L++A+ +R Sbjct: 118 KPDLTFLLDVDPEVALKRLRRRGELDE------FEFEQLDFLRKVRERYLELAK-DDERI 170 Query: 189 HIVDSAHSFQSVATNI 204 I+D+++S + V I Sbjct: 171 LIIDASNSIEEVHEEI 186 >gnl|CDD|38537 KOG3327, KOG3327, KOG3327, Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism]. Length = 208 Score = 51.5 bits (123), Expect = 2e-07 Identities = 53/221 (23%), Positives = 85/221 (38%), Gaps = 42/221 (19%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPA-AEAARHVLLSCG- 58 M G I EG++ +GK+T L L PG PA S G Sbjct: 2 MIRGALIVLEGLDRSGKSTQCGKLVESLI-----------PGLDPAELLRFPERSTSIGK 50 Query: 59 ------VDEFGAEAEAI--VFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERD 110 + I +F+A R +HV ++I+ L +G L+ DR+ S AY Sbjct: 51 LIDGYLRKKSDLPDHTIHLLFSANRWEHV-SLIKEKLAKGTTLIVDRYSFSGVAYSA--- 106 Query: 111 SSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQ---NRYSLRESACLDYFERKDV 167 ++ L LD ++ V PD + LD+ + +R RY + V Sbjct: 107 -AKGLDLDWCKQPDVGLPKPDLVLFLDVSPEDAARRGGFGEERY-------------ETV 152 Query: 168 MIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIV 208 EK F + R + H+VD++ S + V + ++V Sbjct: 153 AFQEKVLVFFQKLLRKEDLNWHVVDASKSVEKVHQQVRSLV 193 >gnl|CDD|30191 cd01673, dNK, Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.. Length = 193 Score = 36.4 bits (84), Expect = 0.007 Identities = 42/187 (22%), Positives = 69/187 (36%), Gaps = 21/187 (11%) Query: 6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAE 65 I EG GAGK+T L K + Y V EP + L ++ Sbjct: 1 VIVVEGNIGAGKST---LAKELAEHLGY--EVVPEPVEPDVEG---NPFLEKFYEDPKRW 52 Query: 66 AEA--IVFAAARLDHVENVI------RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFL 117 A + F +RL ++ + + ++E I F +++ G + L+ Sbjct: 53 AFPFQLYFLLSRLKQYKDALEHLSTGQGVILERSIFSDRVFAEANLKEGGIMKTEYDLYN 112 Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESAC-LDYFERKDVMIHEKRRQI 176 + + + + PD I LD + LKR++ R E LDY E +HE + Sbjct: 113 ELFDNLIPELLPPDLVIYLDASPETCLKRIKKRGRPEEQGIPLDYLED----LHEAYEKW 168 Query: 177 FLDIARN 183 FL Sbjct: 169 FLPQMYE 175 >gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.. Length = 173 Score = 35.5 bits (82), Expect = 0.013 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 14/88 (15%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHV----TREPGGTPAAEAARHVLLSCGVDEF 62 I G++G GKTT + L +L++K V + T P A E R + GV F Sbjct: 3 ILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPA---AIEQLRVLGEQVGVPVF 59 Query: 63 ----GAEAEAIVFAA---ARLDHVENVI 83 G + +I A AR ++ + VI Sbjct: 60 EEGEGKDPVSIAKRAIEHAREENFDVVI 87 >gnl|CDD|30887 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 451 Score = 34.7 bits (80), Expect = 0.019 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 14/88 (15%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHV----TREPGGTPAAEAARHVLLSCGVDEF 62 I G++G+GKTT L ++L++K V + T P A E + + GV F Sbjct: 103 ILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPA---AIEQLKQLAEQVGVPFF 159 Query: 63 GAEAEA----IVFAA---ARLDHVENVI 83 G+ E I AA A+ + + VI Sbjct: 160 GSGTEKDPVEIAKAALEKAKEEGYDVVI 187 >gnl|CDD|144151 pfam00448, SRP54, SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins. Length = 196 Score = 32.1 bits (74), Expect = 0.14 Identities = 11/29 (37%), Positives = 19/29 (65%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDV 35 I G++G+GKTT I+ L +L+++ V Sbjct: 4 ILLVGLQGSGKTTTIAKLAAYLKKQGKKV 32 >gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 340 Score = 31.8 bits (72), Expect = 0.17 Identities = 12/29 (41%), Positives = 19/29 (65%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDV 35 I F G+ G GKTT I+ L ++L+++ V Sbjct: 142 ILFVGVNGVGKTTTIAKLAKYLKQQGKSV 170 >gnl|CDD|35999 KOG0780, KOG0780, KOG0780, Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]. Length = 483 Score = 31.4 bits (71), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDV 35 I F G++G+GKTT + L + ++K Y V Sbjct: 104 IMFVGLQGSGKTTTCTKLAYYYKKKGYKV 132 >gnl|CDD|39383 KOG4181, KOG4181, KOG4181, Uncharacterized conserved protein [Function unknown]. Length = 491 Score = 30.9 bits (69), Expect = 0.33 Identities = 37/196 (18%), Positives = 66/196 (33%), Gaps = 21/196 (10%) Query: 5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64 I G +G+GK+T +SLL +Y +V R P A E + +D Sbjct: 189 TVIGVLGGQGSGKSTLLSLLAANSLDYDYRQYVFR-PVSPEADECIFAQ--THKIDPNIG 245 Query: 65 EAEAIVFAAAR-------LDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFL 117 + ++I+F + + + P LM DS + + L Sbjct: 246 Q-KSILFLDTQPLQSFSIRERHILLDTPPLMPVG-------KDSDHQDLYSLGTMAFLLS 297 Query: 118 DSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIF 177 I V + + D +I L L+ + + D+ + V + K +I Sbjct: 298 VCHIVIVVIDGLADEQLIRLLNAAERLRPTLAIFRHCKGYVRDHMPQL-VFVRAKAHRI- 355 Query: 178 LDIARNQPDRCHIVDS 193 D Q +R + Sbjct: 356 -DFEPRQRERLDKKLA 370 >gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 229 Score = 30.2 bits (68), Expect = 0.48 Identities = 13/28 (46%), Positives = 16/28 (57%) Query: 2 NSGLFISFEGIEGAGKTTHISLLKRFLQ 29 G ++ G GAGKTT I+LL RF Sbjct: 27 KPGETVAIVGPTGAGKTTLINLLMRFYD 54 >gnl|CDD|31833 COG1647, COG1647, Esterase/lipase [General function prediction only]. Length = 243 Score = 30.2 bits (68), Expect = 0.50 Identities = 13/56 (23%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Query: 15 AGKTTHISLLKRFLQRKNYDVHVTREPG-GTPAAEAARHVLLSCGVDEFGAEAEAI 69 G + +L R+L Y V+ R PG GT + L ++ + E Sbjct: 25 TGTPRDVRMLGRYLNENGYTVYAPRYPGHGTLPED-----FLKTTPRDWWEDVEDG 75 >gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.. Length = 238 Score = 29.7 bits (67), Expect = 0.60 Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRF 27 + G ++ G G GK+T +SLL+RF Sbjct: 26 IPPGKTVALVGSSGCGKSTVVSLLERF 52 >gnl|CDD|80342 cd02120, PA_subtilisin_like, PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases. This group contains various PA domain-containing subtilisin-like proteases including melon cucumisin, Arabidopsis thaliana Ara12, a nodule specific serine protease from Alnus glutinosa ag12, members of the tomato P69 family, and tomato LeSBT2. These proteins belong to the peptidase S8 family. Cucumisin from the juice of melon fruits is a thermostable serine peptidase, with a broad substrate specificity for oligopeptides and proteins. A. thaliana Ara12 is a thermostable, extracellular serine protease, found chiefly in silique tissue and stem tissue. Ara12 is stimulated by Ca2+ ions. A. glutinosa ag12 is expressed at high levels in the nodules, and at low levels in the shoot tips; it is implicated in both symbiotic and non-symbiotic processes in plant development. The tomato P69 protease family is comprised of various protein isoforms of approximately 69KDa. These isoforms accumulate extracellularly. Some of the P69 genes are tightly regulated in a tissue specific fashion, and by environmental and developmental signals. For example: infection with avirulent bacteria activates transcription of the genes for the P69 B and C isoforms, the P69 E transcript was detected only in roots, and the P69F transcript only in hydathodes. The Tomato LeSBT2 subtilase transcript was not detected in flowers and roots, but was present in cotyledons and leaves. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.. Length = 126 Score = 28.9 bits (64), Expect = 1.1 Identities = 10/24 (41%), Positives = 18/24 (75%) Query: 85 PALMEGKILLCDRFLDSSYAYQGE 108 P+ ++GKI+LCDR ++S +G+ Sbjct: 47 PSKVKGKIVLCDRGGNTSRVAKGD 70 >gnl|CDD|72905 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 121 Score = 28.7 bits (64), Expect = 1.2 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Query: 20 HISLLKRFLQRKNYDVHV--TREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLD 77 I L++R K Y V E G TP A R L G+D E IV R + Sbjct: 13 EILLIRRIKPGKTYYVFPGGGIEEGETPEEAAKREALEELGLDVRVEEIFLIVNQNGRTE 72 Query: 78 HV 79 H Sbjct: 73 HY 74 >gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228 Score = 29.0 bits (65), Expect = 1.2 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRF 27 + +G ++ G G+GK+T ISLL+RF Sbjct: 1013 IRAGQTVALVGPSGSGKSTVISLLERF 1039 Score = 27.9 bits (62), Expect = 2.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Query: 2 NSGLFISFEGIEGAGKTTHISLLKRF 27 SG ++ G G+GK+T I LL RF Sbjct: 377 PSGQTVALVGPSGSGKSTLIQLLARF 402 >gnl|CDD|33963 COG4240, COG4240, Predicted kinase [General function prediction only]. Length = 300 Score = 28.4 bits (63), Expect = 1.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 5 LFISFEGIEGAGKTTHISLLKRFLQRKN 32 L + G +G+GK+T +L+ R L K Sbjct: 51 LIVGISGPQGSGKSTLSALIVRLLAAKG 78 >gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.. Length = 116 Score = 28.6 bits (64), Expect = 1.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDV 35 I+ G G GKTT +LL R+L K V Sbjct: 2 IAITGKGGVGKTTIAALLARYLAEKGKPV 30 >gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]. Length = 567 Score = 28.1 bits (62), Expect = 1.9 Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQ 29 + G ++ G G+GK+T I LL R Sbjct: 352 IEPGEKVAIVGPSGSGKSTLIKLLLRLYD 380 >gnl|CDD|32268 COG2085, COG2085, Predicted dinucleotide-binding enzymes [General function prediction only]. Length = 211 Score = 28.0 bits (62), Expect = 2.2 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 6/88 (6%) Query: 11 GIEGAGKTTHISLLKRFLQRKNYDVHV--TREPGGTPAAEAARHVLLSCGVDEFGAEAEA 68 I G G S L L + ++V + +R P AA AA L++ G +E A Sbjct: 5 AIIGTGNIG--SALALRLAKAGHEVIIGSSRGPKALAAAAAALGPLITGGSNEDAAALAD 62 Query: 69 IVFAAARLDHVENVIRP--ALMEGKILL 94 +V A + + +V+ + GKI++ Sbjct: 63 VVVLAVPFEAIPDVLAELRDALGGKIVI 90 >gnl|CDD|39379 KOG4177, KOG4177, KOG4177, Ankyrin [Cell wall/membrane/envelope biogenesis]. Length = 1143 Score = 27.6 bits (61), Expect = 2.7 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 10/72 (13%) Query: 20 HISLLKRFLQRKNYDVHVTREPGGTPAAEAARH-------VLLSCG--VDEFGAEAEAIV 70 ++ L+K L+ DV+ + G TP +AA+ +LL G V+ + + Sbjct: 552 NVDLVKFLLEHG-ADVNAKDKLGYTPLHQAAQQGHNDIAELLLKHGASVNAADLDGFTPL 610 Query: 71 FAAARLDHVENV 82 A RL ++ V Sbjct: 611 HIAVRLGYLSVV 622 >gnl|CDD|30875 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]. Length = 197 Score = 27.5 bits (61), Expect = 3.1 Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV 37 G I F G+ G+GK+T + L+ L K Y V++ Sbjct: 20 GQKGAVIWFTGLSGSGKSTIANALEEKLFAKGYHVYL 56 >gnl|CDD|36394 KOG1179, KOG1179, KOG1179, Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism]. Length = 649 Score = 27.6 bits (61), Expect = 3.1 Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 6/61 (9%) Query: 138 LPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQ------IFLDIARNQPDRCHIV 191 L GL+ + Y R+ L + + I RR+ +FL R QPD+ I+ Sbjct: 38 LGWLFGLRALATPYLPRDLWGLLKYILVKIFIRGSRRERRTIAELFLSQVRRQPDKPAII 97 Query: 192 D 192 Sbjct: 98 Y 98 >gnl|CDD|30543 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism]. Length = 191 Score = 27.4 bits (61), Expect = 3.3 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV---HVTREP 41 M+ GL I G G GK+T L+K L+ TR+P Sbjct: 1 MSKGLLIVLSGPSGVGKST---LVKALLEDDKLRFSVSATTRKP 41 >gnl|CDD|33889 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]. Length = 209 Score = 27.2 bits (60), Expect = 4.0 Identities = 15/54 (27%), Positives = 25/54 (46%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVL 54 +N+G + G GAGKTT + +L L+ +V+ EP + +L Sbjct: 25 LNAGEALQITGPNGAGKTTLLRILAGLLRPDAGEVYWQGEPIQNVRESYHQALL 78 >gnl|CDD|31301 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism]. Length = 386 Score = 27.1 bits (60), Expect = 4.1 Identities = 18/80 (22%), Positives = 29/80 (36%), Gaps = 10/80 (12%) Query: 5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGA 64 L SF G+EG + L + V+ + + HVL + G+ E A Sbjct: 297 LNFSFPGVEGESLLLALDL---------AGIAVSTGSACSSGSLEPSHVLRAMGISEELA 347 Query: 65 EAEAIVFAAARLDHVENVIR 84 +I F+ R E + Sbjct: 348 HG-SIRFSLGRFTTEEEIDA 366 >gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 252 Score = 27.1 bits (60), Expect = 4.2 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query: 3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT-REPGGTPAAEAAR 51 G S G GAGK+T +S++ R L++ + ++ + E TP+ E A+ Sbjct: 26 KGGITSIIGPNGAGKSTLLSMMSRLLKKDSGEITIDGLELTSTPSKELAK 75 >gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 716 Score = 26.8 bits (59), Expect = 4.5 Identities = 22/91 (24%), Positives = 34/91 (37%), Gaps = 20/91 (21%) Query: 11 GIEGAGKTTHISLLKRFLQR------------KNYDVHVTREPGGTPAAEAARHVLLSCG 58 G G+GK+T SLL RF + + R G E VL S Sbjct: 501 GPSGSGKSTIASLLLRFYDPTSGRILLDGVPISDINHKYLRRKIGLVGQEP---VLFSGS 557 Query: 59 VDE---FGAEA--EAIVFAAARLDHVENVIR 84 + E +G + + + AAA++ + I Sbjct: 558 IRENIAYGLDNATDEEIEAAAKMANAHEFIT 588 >gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.. Length = 99 Score = 27.0 bits (59), Expect = 4.6 Identities = 18/82 (21%), Positives = 27/82 (32%), Gaps = 12/82 (14%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEA 66 I G G GKTT + L L ++ V + + +VL+ G Sbjct: 2 IVVTGKGGVGKTTLAANLAAALAKRGKRVLLIDD-----------YVLIDTPPG-LGLLV 49 Query: 67 EAIVFAAARLDHVENVIRPALM 88 + A D V V P + Sbjct: 50 LLCLLALLAADLVIIVTTPEAL 71 >gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.. Length = 180 Score = 26.9 bits (60), Expect = 4.8 Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP-GGTPAAEAARHV 53 +G + G GAGK+T + L L+ + ++ + + E AR + Sbjct: 23 EAGEIVGILGPNGAGKSTLLKTLAGLLKPSSGEILLDGKDLASLSPKELARKI 75 >gnl|CDD|48380 cd03116, MobB, Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.. Length = 159 Score = 26.7 bits (59), Expect = 4.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHV 37 I F G G+GKTT + L L + V V Sbjct: 4 IGFVGYSGSGKTTLLEKLIPALSARGLRVAV 34 >gnl|CDD|133067 cd03855, M14_ASTE, Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3.5.1.96) belongs to the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily of the M14 family of metallocarboxypeptidases. This group includes succinylglutamate desuccinylase that catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway. It hydrolyzes N-succinyl-L-glutamate to succinate and L-glutamate. Length = 322 Score = 26.7 bits (60), Expect = 5.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 44 TPAAEAARHVLLSCGV 59 TPAA A + +++S GV Sbjct: 36 TPAAPATKAIVISAGV 51 >gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 234 Score = 26.7 bits (59), Expect = 5.2 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDV 35 + +G ++ G G+GK+T ++L+ RF YDV Sbjct: 25 IPAGETVALVGPSGSGKSTLVNLIPRF-----YDV 54 >gnl|CDD|39436 KOG4235, KOG4235, KOG4235, Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism]. Length = 244 Score = 26.6 bits (58), Expect = 6.0 Identities = 11/32 (34%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Query: 10 EGIEGAGKTTHISLLKRFLQRKNYDVHVTREP 41 EG GK+T L FL + + V EP Sbjct: 28 EGNIAVGKST---FLNFFLNKTYEEWEVLTEP 56 >gnl|CDD|31889 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]. Length = 323 Score = 26.4 bits (58), Expect = 6.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHV 37 I G+ GAGK+T I L R L+ + + V V Sbjct: 54 IGITGVPGAGKSTLIEALGRELRERGHRVAV 84 >gnl|CDD|38125 KOG2914, KOG2914, KOG2914, Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]. Length = 222 Score = 26.4 bits (58), Expect = 6.5 Identities = 17/61 (27%), Positives = 22/61 (36%), Gaps = 6/61 (9%) Query: 13 EGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVL----LSCGVDEFGAEAEA 68 E LL R+ K Y V + G +EAAR + +EF E E Sbjct: 25 EDLYTEAWQELLDRY--GKPYPWDVKVKSMGKRTSEAARLFVKKLPDPVSREEFNKEEEE 82 Query: 69 I 69 I Sbjct: 83 I 83 >gnl|CDD|48378 cd03114, ArgK-like, The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.. Length = 148 Score = 26.3 bits (58), Expect = 6.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHV 37 I G+ GAGK+T I L L+ + V V Sbjct: 2 IGITGVPGAGKSTLIDALITALRARGKRVAV 32 >gnl|CDD|110005 pfam00972, Flavi_NS5, Flavivirus RNA-directed RNA polymerase. Flaviviruses produce a polyprotein from the ssRNA genome. This protein is also known as NS5. This RNA-directed RNA polymerase possesses a number of short regions and motifs homologous to other RNA-directed RNA polymerases. Length = 649 Score = 26.3 bits (58), Expect = 7.4 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 12/37 (32%) Query: 142 IGLKRVQ--NRYSLRESACLD----------YFERKD 166 IG R+ +S+RE+ACL YF R+D Sbjct: 488 IGRARISPGAGWSIRETACLSKAYAQMWSLMYFHRRD 524 >gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 26.3 bits (58), Expect = 7.7 Identities = 18/87 (20%), Positives = 33/87 (37%), Gaps = 6/87 (6%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60 +N G ++ G GAGK+T + L + + ++ + R + G Sbjct: 27 INQGEMVAIIGPSGAGKSTLLRSLNGLVDPTSGEILFNGVQITKLKGKELRKLRRDIG-- 84 Query: 61 EFGAEAEAIVFAAARLDHVENVIRPAL 87 + +V RL +ENV+ L Sbjct: 85 -MIFQQFNLV---PRLSVLENVLLGRL 107 >gnl|CDD|143502 cd06829, PLPDE_III_CANSDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Carboxynorspermidine Decarboxylase. Carboxynorspermidine decarboxylase (CANSDC) catalyzes the decarboxylation of carboxynorspermidine, the last step in the biosynthesis of norspermidine. It is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC), which are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. Based on this similarity, CANSDC may require homodimer formation and the presence of the PLP cofactor for its catalytic activity. Length = 346 Score = 26.0 bits (58), Expect = 7.8 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Query: 21 ISLLKRFLQRKNYDVHVTREPG 42 I+L+KRF ++ Y V V EPG Sbjct: 211 IALIKRFKEK--YGVEVYLEPG 230 >gnl|CDD|176119 cd08428, PBP2_IciA_ArgP, The C-terminal substrate binding domain of LysR-type transcriptional regulator, ArgP (IciA), for arginine exporter (ArgO); contains the type 2 periplasmic binding fold. The inhibitor of chromosomal replication (iciA) protein encoded by Mycobacterium tuberculosis, which is implicated in chromosome replication initiation in vitro, has been identified as arginine permease (ArgP), a LysR-type transcriptional regulator for arginine outward transport, based on the same amino sequence and similar DNA binding targets. Arp has been shown to regulate various targets including DnaA (replication), ArgO (arginine export), dapB (lysine biosynthesis), and gdhA (glutamate biosynthesis). With abundant nutrition, ArgP activates the DnaA gene (to increase replication) and the ArgO (to export redundant molecules). However, when nutrition supply is limited, it is suggested that ArgP might function as an inhibitor of chromosome replication in order to slow replication. This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Length = 195 Score = 26.1 bits (58), Expect = 7.9 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Query: 162 FERKDVMIHEKRRQIFLDIA-RNQPDRCHIVDSAHSFQSVA 201 F RKD + H+ Q + + P CH V S+ +F +A Sbjct: 103 FNRKDDL-HQSFLQQHFGLPPGSYP--CHYVPSSEAFVDLA 140 >gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.. Length = 236 Score = 26.0 bits (57), Expect = 7.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 3 SGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHV 37 G + F G GAGKTT + +L LQ + +V V Sbjct: 46 KGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRV 80 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 26.1 bits (58), Expect = 8.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 2 NSGLFISFEGIEGAGKTTHISLLKRFLQ 29 G ++ G G+GK+T + LL R Sbjct: 26 KPGEKVAIVGPSGSGKSTLLKLLLRLYD 53 >gnl|CDD|112137 pfam03308, ArgK, ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems. Length = 267 Score = 26.2 bits (58), Expect = 8.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHV 37 + G+ GAGK+T I L L+R+ + V V Sbjct: 32 VGITGVPGAGKSTLIEALGMELRRRGHRVAV 62 >gnl|CDD|177083 CHL00181, cbbX, CbbX; Provisional. Length = 287 Score = 26.2 bits (58), Expect = 8.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Query: 2 NSGLFISFEGIEGAGKTT 19 N GL +SF G G GKTT Sbjct: 57 NPGLHMSFTGSPGTGKTT 74 >gnl|CDD|145008 pfam01637, Arch_ATPase, Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family. Length = 223 Score = 26.1 bits (58), Expect = 8.8 Identities = 9/28 (32%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Query: 11 GIEGAGKTTHISLLKRFLQR-KNYDVHV 37 G GKT +LL+ FL+ + V Sbjct: 27 GPRRCGKT---ALLREFLEELRELGYRV 51 >gnl|CDD|37264 KOG2053, KOG2053, KOG2053, Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]. Length = 932 Score = 25.7 bits (56), Expect = 9.3 Identities = 11/60 (18%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Query: 152 SLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWEL 211 LRE L + V+I I + +Q R + ++ F ++ +W + Sbjct: 691 VLRELELLL-EQYTSVLIPSASFLIQFPLLESQGVRLGDLLNSLEFLMAVPLLVKDLWSV 749 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.137 0.397 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,683,254 Number of extensions: 139658 Number of successful extensions: 545 Number of sequences better than 10.0: 1 Number of HSP's gapped: 536 Number of HSP's successfully gapped: 65 Length of query: 225 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 135 Effective length of database: 4,318,927 Effective search space: 583055145 Effective search space used: 583055145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.4 bits)