Query gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 117 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 18:34:19 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780219.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG4603 consensus 65.1 12 0.00031 18.9 4.3 40 58-97 87-126 (201) 2 PRK12699 flgH flagellar basal 55.7 7 0.00018 20.3 1.7 25 5-29 19-43 (246) 3 TIGR02706 P_butyryltrans phosp 39.6 23 0.00058 17.3 2.3 28 43-70 134-161 (295) 4 pfam10392 COG5 Golgi transport 36.2 39 0.00099 16.0 10.1 60 2-61 7-66 (132) 5 cd07664 BAR_SNX2 The Bin/Amphi 35.8 40 0.001 16.0 9.3 91 12-106 65-168 (234) 6 PRK12698 flgH flagellar basal 35.0 21 0.00054 17.5 1.5 24 6-29 2-26 (224) 7 TIGR00074 hypC_hupF hydrogenas 33.4 6 0.00015 20.7 -1.5 18 13-30 32-50 (88) 8 KOG1874 consensus 28.8 52 0.0013 15.3 4.8 45 39-85 550-594 (1477) 9 PRK12700 flgH flagellar basal 23.0 41 0.0011 15.9 1.2 28 4-31 5-34 (230) 10 KOG2191 consensus 22.0 22 0.00055 17.5 -0.4 80 17-102 51-137 (402) No 1 >KOG4603 consensus Probab=65.12 E-value=12 Score=18.90 Aligned_cols=40 Identities=30% Similarity=0.429 Sum_probs=30.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHH Q ss_conf 7788999999999999999999999999998643743422 Q gi|254780219|r 58 KINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEID 97 (117) Q Consensus 58 kintvqtalrnlhnaiskmeselkellsdillkrhpdeid 97 (117) +|-..+.-++.|...+|-||+|+|+|-|..-+..-..+|. T Consensus 87 ~i~~l~ek~q~l~~t~s~veaEik~L~s~Lt~eemQe~i~ 126 (201) T KOG4603 87 KIVALTEKVQSLQQTCSYVEAEIKELSSALTTEEMQEEIQ 126 (201) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH T ss_conf 9999999999999898889999999998637499999999 No 2 >PRK12699 flgH flagellar basal body L-ring protein; Reviewed Probab=55.67 E-value=7 Score=20.32 Aligned_cols=25 Identities=36% Similarity=0.587 Sum_probs=21.0 Q ss_pred HHHHHHHHHHHHHCCCCCCCCHHHH Q ss_conf 9999999999961054785166689 Q gi|254780219|r 5 IKRFLFPLLALLGSCDDNPKDPIVQ 29 (117) Q Consensus 5 ikrflfpllallgscddnpkdpivq 29 (117) ++-.|+.++++|+.|--.|.+|+|+ T Consensus 19 ~~~~~~~~~~~l~gC~~~~~~p~~~ 43 (246) T PRK12699 19 LGPVLIVMLALVGGCSLPTPAPKVQ 43 (246) T ss_pred HHHHHHHHHHHHCCCCCCCCCCCCC T ss_conf 8889999999860446899987678 No 3 >TIGR02706 P_butyryltrans phosphate butyryltransferase; InterPro: IPR014079 Members of this family are phosphate butyryltransferase enzymes, also called phosphotransbutyrylase. In general, this enzyme is found in butyrate-producing anaerobic bacteria, encoded next to the gene for butyrate kinase. Together, these two enzymes represent what may be the less common of two pathways for butyrate production from butyryl-CoA. The alternative is transfer of the CoA group to acetate by butyryl-CoA:acetate CoA transferase. This entry does not include the homologue from Thermotoga maritima, whose activity on butyryl-CoA is only 30 0f its activity with acetyl-CoA.. Probab=39.61 E-value=23 Score=17.35 Aligned_cols=28 Identities=36% Similarity=0.668 Sum_probs=23.5 Q ss_pred HHHHHHHHHCCHHHHHHHHHHHHHHHHH Q ss_conf 7888888747135777788999999999 Q gi|254780219|r 43 SLSDALFKTYPDTMDKINTVQTALRNLH 70 (117) Q Consensus 43 slsdalfktypdtmdkintvqtalrnlh 70 (117) -|+|+-|.||||--+|+.-++-|..--| T Consensus 134 ~lTDaAfN~yP~Lk~K~~ii~NaV~VAh 161 (295) T TIGR02706 134 FLTDAAFNIYPELKDKVQIINNAVKVAH 161 (295) T ss_pred HHHHHHHCCCCCHHHHHHHHHHHHHHHH T ss_conf 2312665028787899999764755023 No 4 >pfam10392 COG5 Golgi transport complex subunit 5. The COG complex, the peripheral membrane oligomeric protein complex involved in intra-Golgi protein trafficking, consists of eight subunits arranged in two lobes bridged by Cog1. Cog5 is in the smaller, B lobe, bound in with Cog6-8, and is itself bound to Cog1 as well as, strongly, to Cog7. Probab=36.23 E-value=39 Score=16.01 Aligned_cols=60 Identities=22% Similarity=0.336 Sum_probs=51.6 Q ss_pred CHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH Q ss_conf 227999999999996105478516668999843355777777888888747135777788 Q gi|254780219|r 2 HFKIKRFLFPLLALLGSCDDNPKDPIVQFKQMKYESQESKKSLSDALFKTYPDTMDKINT 61 (117) Q Consensus 2 hfkikrflfpllallgscddnpkdpivqfkqmkyesqeskkslsdalfktypdtmdkint 61 (117) -|.-++|---++.--+.-+|.|-|.-.+.|+..|.-||-.+.+....-.-|.+-++.... T Consensus 7 dF~~~~fan~ll~~tn~~~~~~ldl~t~l~kL~~~i~eld~~i~~~v~~~~~~LL~q~~~ 66 (132) T pfam10392 7 DFDPKSFANALLLATNNNDDTPLDLSTPLKRLLYDIQELDRRIRQLITSNHLPLLSHLSS 66 (132) T ss_pred CCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHH T ss_conf 889899999999863799997117886899998429999999999998488999999984 No 5 >cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX2 is a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi. The retromer consists of a cargo-recognition subcomplex and a subcomplex formed by a dimer of sorting nexins (SNX1 and/or SNX2), which ensures effcient cargo sorting by facilitating proper membrane localization Probab=35.78 E-value=40 Score=15.97 Aligned_cols=91 Identities=15% Similarity=0.290 Sum_probs=48.6 Q ss_pred HHHHHHCCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH----HHHHHHHHH-------HHHHHHHHHHHH Q ss_conf 999961054785--1666899984335577777788888874713577----778899999-------999999999999 Q gi|254780219|r 12 LLALLGSCDDNP--KDPIVQFKQMKYESQESKKSLSDALFKTYPDTMD----KINTVQTAL-------RNLHNAISKMES 78 (117) Q Consensus 12 llallgscddnp--kdpivqfkqmkyesqeskkslsdalfktypdtmd----kintvqtal-------rnlhnaiskmes 78 (117) -++.||+|++++ ..+.-++-+..-...+.-.-.++..+.|.-.|++ -|..|..++ .+.+++-+.+.+ T Consensus 65 s~~~L~~~E~~~~Ls~aLs~la~~~~ki~~~~~~qa~~d~~~l~etL~eYirli~SVk~~f~~R~k~~~~~q~a~~~L~k 144 (234) T cd07664 65 SAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQAFADFYLFSELLGDYIRLIAAVKGVFDQRMKCWQKWQDAQVTLQK 144 (234) T ss_pred HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99998722452788999999999999999999999999999999789999999999999999999999999999999999 Q ss_pred HHHHHHHHHHHHHCHHHHHCCCCCCCCH Q ss_conf 9999999998643743422137521135 Q gi|254780219|r 79 ELKELLSDILLKRHPDEIDKINPIKNSA 106 (117) Q Consensus 79 elkellsdillkrhpdeidkinpiknsa 106 (117) . ++.+.-.... .-.||++-.+... T Consensus 145 k-r~~~~Kl~~~---~~~dK~~~~~~Ei 168 (234) T cd07664 145 K-REAEAKLQYA---NKPDKLQQAKDEI 168 (234) T ss_pred H-HHHHHHHHCC---CCHHHHHHHHHHH T ss_conf 9-9879877437---9767799999999 No 6 >PRK12698 flgH flagellar basal body L-ring protein; Reviewed Probab=35.03 E-value=21 Score=17.53 Aligned_cols=24 Identities=42% Similarity=0.876 Sum_probs=17.9 Q ss_pred HHH-HHHHHHHHHCCCCCCCCHHHH Q ss_conf 999-999999961054785166689 Q gi|254780219|r 6 KRF-LFPLLALLGSCDDNPKDPIVQ 29 (117) Q Consensus 6 krf-lfpllallgscddnpkdpivq 29 (117) ||| ++.++.+|+.|.-.|.+|+.+ T Consensus 2 ~r~~l~~~~l~L~gCa~~~~~p~~~ 26 (224) T PRK12698 2 ARYILLALALLLAGCSSTPKKPIAD 26 (224) T ss_pred HHHHHHHHHHHHHCCCCCCCCCCCC T ss_conf 7799999999983656889888888 No 7 >TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF; InterPro: IPR001109 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesised as a precursor devoid of the metalloenzyme active site. This precursor then undergoes a complex post-translational maturation process that requires a number of accessory proteins. The hydrogenase expression/formation proteins (HUPF/HYPC) form a family of small proteins that are hydrogenase precursor-specific chaperones required for this maturation process . They are believed to keep the hydrogenase precursor in a conformation accessible for metal incorporation , . . Probab=33.40 E-value=6 Score=20.71 Aligned_cols=18 Identities=39% Similarity=0.815 Sum_probs=14.0 Q ss_pred HHHHH-CCCCCCCCHHHHH Q ss_conf 99961-0547851666899 Q gi|254780219|r 13 LALLG-SCDDNPKDPIVQF 30 (117) Q Consensus 13 lallg-scddnpkdpivqf 30 (117) |+|+| |||.||..-+=++ T Consensus 32 l~Lv~ksC~~N~~~~~Gdy 50 (88) T TIGR00074 32 LDLVGKSCDENEEVKVGDY 50 (88) T ss_pred EEECCCCCCCCCCCCCCCE T ss_conf 4123554467859999877 No 8 >KOG1874 consensus Probab=28.75 E-value=52 Score=15.28 Aligned_cols=45 Identities=29% Similarity=0.324 Sum_probs=34.6 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 77777888888747135777788999999999999999999999999 Q gi|254780219|r 39 ESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESELKELLS 85 (117) Q Consensus 39 eskkslsdalfktypdtmdkintvqtalrnlhnaiskmeselkells 85 (117) ++-.++-.+|++-|| ||--+-.|-.++.|++.-+.--.-|+|+.- T Consensus 550 Q~Lasf~g~l~rkyP--mdl~gl~~Yv~nqLk~gk~~el~iLrEliq 594 (1477) T KOG1874 550 QRLASFEGELDRKYP--MDLRGLLQYVLNQLKRGKSIELLILRELIQ 594 (1477) T ss_pred HHHHHHHHHHHHCCC--HHHHHHHHHHHHHHHCCCHHHHHHHHHHHH T ss_conf 999999888764298--035479999999986263478999999999 No 9 >PRK12700 flgH flagellar basal body L-ring protein; Reviewed Probab=23.02 E-value=41 Score=15.87 Aligned_cols=28 Identities=32% Similarity=0.517 Sum_probs=19.1 Q ss_pred HHHHHHH--HHHHHHHCCCCCCCCHHHHHH Q ss_conf 7999999--999996105478516668999 Q gi|254780219|r 4 KIKRFLF--PLLALLGSCDDNPKDPIVQFK 31 (117) Q Consensus 4 kikrflf--pllallgscddnpkdpivqfk 31 (117) .+-|+.+ -+++||+.|.-.|..|+++.- T Consensus 5 t~~Rl~~~~~~~~ll~GCa~~~~~p~~~~P 34 (230) T PRK12700 5 TVLRLPVCAALLALAAGCAMIPPEPVVTGP 34 (230) T ss_pred HHHHHHHHHHHHHHHHCCCCCCCCCCCCCC T ss_conf 899999999999997444689999878898 No 10 >KOG2191 consensus Probab=21.99 E-value=22 Score=17.49 Aligned_cols=80 Identities=25% Similarity=0.349 Sum_probs=47.5 Q ss_pred HCCCCCCCCHHHHHHHHHH-HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHH Q ss_conf 1054785166689998433-5577777788888874713577778899999999999999999999999------99986 Q gi|254780219|r 17 GSCDDNPKDPIVQFKQMKY-ESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESELKELL------SDILL 89 (117) Q Consensus 17 gscddnpkdpivqfkqmky-esqeskkslsdalfktypdtmdkintvqtalrnlhnaiskmeselkell------sdill 89 (117) ||.-..--..|+||+.-.- .-|-||. -.+||.|-+.|--+|-.+.++.+.+.-.-..+.|.. +||+- T Consensus 51 GsIIGKGG~ti~~lqk~tgariklSks------~dfyPGTTeRvcli~Gt~eai~av~efI~dKire~p~~~~k~v~~~~ 124 (402) T KOG2191 51 GSIIGKGGQTIVQLQKETGARIKLSKS------KDFYPGTTERVCLIQGTVEALNAVHEFIADKIREKPQAVAKPVDILQ 124 (402) T ss_pred CCEECCCHHHHHHHHHCCCCEEEECCC------CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC T ss_conf 243326538899987504967884356------66689963258997252999999999999999876775158632347 Q ss_pred HHCHHHHHCCCCC Q ss_conf 4374342213752 Q gi|254780219|r 90 KRHPDEIDKINPI 102 (117) Q Consensus 90 krhpdeidkinpi 102 (117) ++.||.+..|.++ T Consensus 125 pqt~~r~kqikiv 137 (402) T KOG2191 125 PQTPDRIKQIKIV 137 (402) T ss_pred CCCCCCCCEEEEE T ss_conf 7775533304785 Done!