RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] (117 letters) >gnl|CDD|181932 PRK09529, PRK09529, bifunctional acetyl-CoA decarbonylase/synthase complex subunit alpha/beta; Reviewed. Length = 711 Score = 29.1 bits (66), Expect = 0.28 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Query: 76 MESELKELLSDILLKR-----HPDEIDKI 99 M ELKE L D L R PD DKI Sbjct: 653 MPKELKEELKDRLNARAKEEGLPDFYDKI 681 >gnl|CDD|182706 PRK10760, PRK10760, murein hydrolase B; Provisional. Length = 359 Score = 28.9 bits (65), Expect = 0.33 Identities = 8/21 (38%), Positives = 9/21 (42%) Query: 9 LFPLLALLGSCDDNPKDPIVQ 29 L PL LL +C PK Sbjct: 9 LLPLFVLLAACSSKPKPTETA 29 >gnl|CDD|162980 TIGR02706, P_butyryltrans, phosphate butyryltransferase. Members of this family are phosphate butyryltransferase, also called phosphotransbutyrylase. In general, this enzyme is found in butyrate-producing anaerobic bacteria, encoded next to the gene for butyrate kinase. Together, these two enzymes represent what may be the less common of two pathways for butyrate production from butyryl-CoA. The alternative is transfer of the CoA group to acetate by butyryl-CoA:acetate CoA transferase. Cutoffs for this model are set such that the homolog from Thermotoga maritima, whose activity on butyryl-CoA is only 30 % of its activity with acetyl-CoA, scores in the zone between trusted and noice cutoffs. Length = 294 Score = 27.0 bits (60), Expect = 1.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 44 LSDALFKTYPDTMDKINTVQTALRNLH 70 L+DA F TYP+ DK+ + A++ H Sbjct: 135 LTDAAFNTYPELKDKVQIINNAVKVAH 161 >gnl|CDD|178756 PLN03217, PLN03217, transcription factor ATBS1; Provisional. Length = 93 Score = 27.1 bits (59), Expect = 1.2 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 7/67 (10%) Query: 20 DDNPKDPIVQFKQMKYESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESE 79 +D D I++ +Q+ E ++S++S + + DT + I RNLH + + Sbjct: 19 EDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYI-------RNLHREVDDLSER 71 Query: 80 LKELLSD 86 L ELL++ Sbjct: 72 LSELLAN 78 >gnl|CDD|180035 PRK05354, PRK05354, arginine decarboxylase; Provisional. Length = 634 Score = 26.6 bits (60), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Query: 68 NLHNAISKMESELKELLSDILLKRHPDEIDKIN 100 L+ AI + ++++LL RHP E+D++ Sbjct: 426 QLYWAICR---KIQKLLDP--KNRHPPELDELQ 453 >gnl|CDD|184892 PRK14898, PRK14898, DNA-directed RNA polymerase subunit A''; Provisional. Length = 858 Score = 26.4 bits (58), Expect = 1.6 Identities = 9/40 (22%), Positives = 22/40 (55%) Query: 72 AISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISK 111 ++ + EL++L + + PD ID I I ++ ++++ Sbjct: 410 SVGERGDELEDLATSLDSDGTPDSIDMIPSIGDALTKLAE 449 >gnl|CDD|149105 pfam07851, TMPIT, TMPIT-like protein. A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this. Length = 330 Score = 26.2 bits (58), Expect = 1.7 Identities = 8/52 (15%), Positives = 19/52 (36%) Query: 29 QFKQMKYESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESEL 80 + + ++ SL P+ + + ++ ++ N MES L Sbjct: 40 AIARQRKRLKQLIVSLKKLKKSLTPEDSELVEQLEEQIKERKNQFFDMESFL 91 >gnl|CDD|183689 PRK12697, flgH, flagellar basal body L-ring protein; Reviewed. Length = 226 Score = 26.4 bits (58), Expect = 1.9 Identities = 7/18 (38%), Positives = 9/18 (50%) Query: 12 LLALLGSCDDNPKDPIVQ 29 A L C P++PI Q Sbjct: 16 AAAALAGCAQIPREPITQ 33 >gnl|CDD|180565 PRK06450, PRK06450, threonine synthase; Validated. Length = 338 Score = 26.2 bits (58), Expect = 2.1 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 29 QFKQMKYESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESELKE 82 +FK + Y + S++DAL T P +D + L I ++E+ E Sbjct: 245 KFKGISYTPPDKVTSIADALVSTRPFLLDYMVKA---LSEYGECIVVSDNEIVE 295 >gnl|CDD|178561 PLN02980, PLN02980, 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding. Length = 1655 Score = 26.0 bits (57), Expect = 2.4 Identities = 11/46 (23%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query: 33 MKYESQESKKSLSDALFKTYPDTMDKINTVQTALR---NLHNAISK 75 +++ +K L DALF + + MD + V++++ H+ + K Sbjct: 857 VRHLHVGTKSELEDALFTSQVEQMDCVVEVESSIDANAAFHSTLRK 902 >gnl|CDD|182409 PRK10361, PRK10361, DNA recombination protein RmuC; Provisional. Length = 475 Score = 25.7 bits (56), Expect = 2.9 Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 57 DKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKLKEDL 116 + + +R+L + + +E++L+E+ + + + + DKI + NS +S+ E+L Sbjct: 60 AECELLNNEVRSLQSINTSLEADLREVTTRMEAAQQHAD-DKIRQMINSEQRLSEQFENL 118 Query: 117 S 117 + Sbjct: 119 A 119 >gnl|CDD|163583 TIGR03871, ABC_peri_MoxJ_2, quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein. This protein family, a sister family to TIGR03870, is found more broadly. It occurs a range of PQQ-biosynthesizing species, not just in known methanotrophs. Interpretation of evidence by homology and by direct experimental work suggest two different roles. By homology, this family appears to be the periplasmic substrate-binding protein of an ABC transport family. However, mutational studies and direct characterization for some sequences related to this family suggests this family may act as a maturation chaperone or additional subunit of a methanol dehydrogenase-like enzyme. Length = 232 Score = 25.7 bits (57), Expect = 3.1 Identities = 9/28 (32%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 72 AISKMESELKELLSDILLKRHPDEIDKI 99 + K + K+ L+ +L +R EID I Sbjct: 197 GVRKGDKAWKDELNAVLDRRQA-EIDAI 223 >gnl|CDD|180267 PRK05805, PRK05805, phosphate butyryltransferase; Validated. Length = 301 Score = 25.4 bits (56), Expect = 3.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 44 LSDALFKTYPDTMDKINTVQTA 65 L+DA F PD +KI+ + A Sbjct: 139 LTDAAFNIAPDLKEKIDIINNA 160 >gnl|CDD|178059 PLN02440, PLN02440, amidophosphoribosyltransferase. Length = 479 Score = 25.4 bits (56), Expect = 3.8 Identities = 10/35 (28%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Query: 71 NAISKMESELKELLSDILLKRHPDEIDKINPIKNS 105 S ES L+ +IL P + D + P+ +S Sbjct: 253 FGRSVYESRLE--FGEILATEIPVDCDVVIPVPDS 285 >gnl|CDD|184948 PRK14986, PRK14986, glycogen phosphorylase; Provisional. Length = 815 Score = 25.2 bits (55), Expect = 4.4 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 10/62 (16%) Query: 47 ALFKTYPDTMDKINTV-----QTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINP 101 A +++Y D DK++ + + + + N I+ M SD +K + DEI I+P Sbjct: 758 ADYRSYVDCQDKVDELYRNQEEWTRKAMLN-IANM----GYFSSDRTIKEYADEIWHIDP 812 Query: 102 IK 103 ++ Sbjct: 813 VR 814 >gnl|CDD|181903 PRK09490, metH, B12-dependent methionine synthase; Provisional. Length = 1229 Score = 24.8 bits (55), Expect = 5.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 77 ESELKELLSDILLKRHPD 94 EL+E + D++L R PD Sbjct: 612 PPELREAVEDVVLNRRPD 629 >gnl|CDD|179223 PRK01109, PRK01109, ATP-dependent DNA ligase; Provisional. Length = 590 Score = 24.5 bits (54), Expect = 5.8 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Query: 67 RNLHNAISKMES-----ELKELLSDILLKRHPDEIDKI 99 L ++E +L +LL+D+L K P+ IDK+ Sbjct: 4 SELAEYFERLEKTTSRTQLTKLLADLLKKTPPEIIDKV 41 >gnl|CDD|162917 TIGR02550, flagell_flgL, flagellar hook-associated protein 3. This protein family consists of flagellar hook-associated proteins designated FlgL (or HAP3) encoded in bacterial flagellar operons. A N-terminal region of about 150 residues and a C-terminal region of about 85 residues are conserved. Members show considerable length heterogeneity between these two well-conserved terminal regions; members of the family vary between 287 to over 500 residues in length. This model distinguishes FlgL from the flagellin gene product FliC. Length = 306 Score = 24.6 bits (54), Expect = 6.1 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 7/58 (12%) Query: 37 SQESKKSLSDALFKTYPDTMDKINTVQT-------ALRNLHNAISKMESELKELLSDI 87 S ++ A +D + + + L NL N +S+ + +L E+LSD+ Sbjct: 211 SSGDAQAALSASLNELDKALDNVLSARAEVGARLNRLENLENRLSEQKLQLTEVLSDL 268 >gnl|CDD|117853 pfam09311, Rab5-bind, Rab5 binding. Members of this family are predominantly found in Rabaptin and allow for binding to the GTPase Rab5. This interaction is necessary and sufficient for Rab5-dependent recruitment of Rabaptin5 to early endosomal membranes. Length = 180 Score = 24.3 bits (53), Expect = 8.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 64 TALRNLHNAISKMESELKELLSDILLK 90 LR LHN + + ES+ + ++ L K Sbjct: 137 ARLRTLHNLVIQYESQGRYEVAVPLCK 163 >gnl|CDD|181571 PRK08870, flgL, flagellar hook-associated protein FlgL; Reviewed. Length = 404 Score = 24.1 bits (53), Expect = 9.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 59 INTVQTALRNLHNAISKM 76 N + ALRNL NA++ + Sbjct: 314 QNALAQALRNLDNALNNV 331 >gnl|CDD|152058 pfam11622, DUF3251, Protein of unknown function (DUF3251). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. Some members if this family are annotated as putative lipoprotein YajI however this cannot be confirmed. Length = 156 Score = 24.0 bits (52), Expect = 9.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 63 QTALRNLHNAISKMESELKEL 83 Q+ + LH ++S + EL L Sbjct: 3 QSEVPQLHQSVSTLNQELTTL 23 >gnl|CDD|180531 PRK06330, PRK06330, transcript cleavage factor/unknown domain fusion protein; Validated. Length = 718 Score = 23.9 bits (52), Expect = 9.4 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 28/119 (23%) Query: 21 DNPKDP-IVQFKQMKYESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMES- 78 D+ KDP +++ K + +ESQ ++SLS + D KI T+ T +R+LH+ + E+ Sbjct: 267 DSLKDPYVLRPKGLSHESQ-LERSLSGST-----DVDKKIQTIYTFVRDLHSELKNEENR 320 Query: 79 ----------ELKELLSDILLKRH----------PDEIDKINPIKNSANEISKLKEDLS 117 +L+EL S +LL+R E+D N S ++I + ++ Sbjct: 321 KSLIKKLQDLDLEELNSALLLQRALLLSEFLGEKSSELDCENIASLSEDQIEDIVNNIE 379 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.132 0.361 Gapped Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,833,160 Number of extensions: 99220 Number of successful extensions: 243 Number of sequences better than 10.0: 1 Number of HSP's gapped: 242 Number of HSP's successfully gapped: 66 Length of query: 117 Length of database: 5,994,473 Length adjustment: 81 Effective length of query: 36 Effective length of database: 4,244,225 Effective search space: 152792100 Effective search space used: 152792100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.0 bits)