RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] (117 letters) >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Score = 27.7 bits (61), Expect = 0.31 Identities = 15/125 (12%), Positives = 40/125 (32%), Gaps = 8/125 (6%) Query: 1 MHFKIKRFLFPLLALLGSCDDNPK----DPIVQFKQMKY----ESQESKKSLSDALFKTY 52 + R G + +P + K + ++S K+ + L + Sbjct: 120 TLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHH 179 Query: 53 PDTMDKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKL 112 P+ + V+ A + ++ A + + EL + + K I Sbjct: 180 PEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFA 239 Query: 113 KEDLS 117 +++++ Sbjct: 240 QKEIN 244 >d1oaoc_ e.26.1.3 (C:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica [TaxId: 1525]} Length = 729 Score = 25.1 bits (55), Expect = 1.7 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Query: 76 MESELKELLSDILLKR------HPDEIDKI 99 M LK+ L D ++R D IDKI Sbjct: 670 MPKSLKDFLHDEFVRRSVEEGLGEDFIDKI 699 >d1t9ma_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas aeruginosa [TaxId: 287]} Length = 204 Score = 24.0 bits (51), Expect = 3.4 Identities = 2/13 (15%), Positives = 6/13 (46%) Query: 20 DDNPKDPIVQFKQ 32 + P +P+ + Sbjct: 13 EAPPANPMEVLRN 25 >d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Length = 62 Score = 23.9 bits (52), Expect = 3.6 Identities = 6/33 (18%), Positives = 14/33 (42%) Query: 26 PIVQFKQMKYESQESKKSLSDALFKTYPDTMDK 58 P++ + E K++LS L + + + Sbjct: 1 PMISCDMRYGRTDEQKRALSAGLLRVISEATGE 33 >d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Length = 395 Score = 23.5 bits (49), Expect = 5.1 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Query: 59 INTVQTALRNLHNAISKM---ESELKELLSDIL 88 I + A RN ++ IS E L E +++ L Sbjct: 2 IKGLTQASRNANDGISIAQTTEGALNE-INNNL 33 >d1kxla_ b.40.4.3 (A:) CDC13 ssDNA-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 187 Score = 23.3 bits (50), Expect = 5.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 24 KDPIVQFKQMKYESQESK 41 KDP ++F Q+ ++ E+K Sbjct: 5 KDPTIEFCQLGLDTFETK 22 >d1cbya_ d.103.1.1 (A:) Mosquitocidal delta-endotoxin CytB {Bacillus thuringiensis, strain Kyushuensis [TaxId: 1428]} Length = 227 Score = 23.2 bits (50), Expect = 5.4 Identities = 8/39 (20%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query: 50 KTYPDTMDKINTVQTALRNLHNAISKMESELKELLSDIL 88 P++ + T+ ++ IS M +LK+++ ++L Sbjct: 67 NGIPNSAI-VKTLNQSVIQQTVEISVMVEQLKKIIQEVL 104 >d1de4c3 c.56.5.5 (C:122-189,C:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Score = 23.3 bits (49), Expect = 5.6 Identities = 6/36 (16%), Positives = 14/36 (38%) Query: 51 TYPDTMDKINTVQTALRNLHNAISKMESELKELLSD 86 T DT ++ L + A +++ + L+ Sbjct: 254 TTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTH 289 >d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Length = 129 Score = 23.3 bits (50), Expect = 5.8 Identities = 8/32 (25%), Positives = 12/32 (37%) Query: 26 PIVQFKQMKYESQESKKSLSDALFKTYPDTMD 57 P+++F + KSL DA D Sbjct: 1 PLLKFDLFYGRTDAQIKSLLDAAHGAMVDAFG 32 >d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Length = 59 Score = 23.1 bits (50), Expect = 7.1 Identities = 7/33 (21%), Positives = 17/33 (51%) Query: 26 PIVQFKQMKYESQESKKSLSDALFKTYPDTMDK 58 PI Q ++ + E K++L + + +++D Sbjct: 1 PIAQLYIIEGRTDEQKETLIRQVSEAMANSLDA 33 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.132 0.361 Gapped Lambda K H 0.267 0.0641 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 416,097 Number of extensions: 16927 Number of successful extensions: 49 Number of sequences better than 10.0: 1 Number of HSP's gapped: 49 Number of HSP's successfully gapped: 21 Length of query: 117 Length of database: 2,407,596 Length adjustment: 74 Effective length of query: 43 Effective length of database: 1,391,576 Effective search space: 59837768 Effective search space used: 59837768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.1 bits)