RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >gnl|CDD|36569 KOG1355, KOG1355, KOG1355, Adenylosuccinate synthase [Nucleotide transport and metabolism]. Length = 455 Score = 27.7 bits (61), Expect = 0.79 Identities = 11/39 (28%), Positives = 19/39 (48%) Query: 24 DAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQI 62 D +F+ YKS P+ + DIE L+ K + ++ Sbjct: 189 DEFSERFKVLAEQYKSRFPTLEIDIEGELARYKGYAEKL 227 >gnl|CDD|147635 pfam05565, Sipho_Gp157, Siphovirus Gp157. This family contains both viral and bacterial proteins which are related to the Gp157 protein of the Streptococcus thermophilus SFi bacteriophages. It is thought that bacteria possessing the gene coding for this protein have an increased resistance to the bacteriophage. Length = 162 Score = 27.2 bits (61), Expect = 0.93 Identities = 15/67 (22%), Positives = 34/67 (50%) Query: 24 DAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQILAISNKLEKGQKPKYLHLKEA 83 ++I +FE+++ + + + DIE +EIK + +I NK+++ + ++ Sbjct: 32 ESIEEEFEDKVENIAKVIKNLEADIEAIKAEIKRLAERKKSIENKVKRLKDYLEEAMEAT 91 Query: 84 IQKIVKT 90 K +KT Sbjct: 92 GIKKIKT 98 >gnl|CDD|48079 cd01979, Pchlide_reductase_N, Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase. Pchlide reductase catalyzes the reductive formation of chlorophyllide (chlide) from protochlorophyllide (pchlide) during biosynthesis of chlorophylls and bacteriochlorophylls. This group contains both the light-independent Pchlide reductase (DPOR) and light-dependent Pchlide reductase (LPOR). Angiosperms contain only LPOR, cyanobacteria, algae and gymnosperms contain both DPOR and LPOR, primitive anoxygenic photosynthetic bacteria contain only DPOR. NB is structurally similar to the FeMo protein of nitrogenase, forming an N2B2 heterotetramer. N and B are homologous to the FeMo alpha and beta subunits respectively. Also in common with nitrogenase in vitro DPOR activity requires ATP hydrolysis and dithoionite or ferredoxin as electron donor. The NB protein complex may serve as a catalytic site for Pchlide reduction similar to MoFe for nitrogen reduction.. Length = 396 Score = 26.0 bits (57), Expect = 2.6 Identities = 17/79 (21%), Positives = 26/79 (32%), Gaps = 9/79 (11%) Query: 1 MKKTQLLLPLLTLLSSCSDYVYEDAI----RSQFENEIRYYKSMHPST-QDDIEYNLSEI 55 M L +PL L+ C V E + E+ M + D L I Sbjct: 282 MGDNLLEIPLARFLTRCGMIVVEVGTPYLDKRFQAAELELLPPMVRIVEKPDNYRQLDRI 341 Query: 56 KSFENQI----LAISNKLE 70 + + L ++N LE Sbjct: 342 RELRPDLVVTGLGLANPLE 360 >gnl|CDD|35241 KOG0018, KOG0018, KOG0018, Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]. Length = 1141 Score = 25.6 bits (56), Expect = 3.3 Identities = 17/97 (17%), Positives = 37/97 (38%), Gaps = 8/97 (8%) Query: 1 MKKTQLLLPLLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFEN 60 KK +LL L + + ++ E ++Y K + +E N E++ E+ Sbjct: 659 EKKERLLEELKEIQKRRKEVSSVESKIHGLEMRLKYSKLDLEQLKRSLEQNELELQRTES 718 Query: 61 QILAISNKLEKGQKPKYLHLKEAIQKIVKTIEQNEKE 97 +I P+ +K +Q +++ E+ Sbjct: 719 EIDEF--------GPEISEIKRKLQNREGEMKELEER 747 >gnl|CDD|38442 KOG3232, KOG3232, KOG3232, Vacuolar assembly/sorting protein DID2 [Intracellular trafficking, secretion, and vesicular transport]. Length = 203 Score = 25.0 bits (54), Expect = 4.1 Identities = 15/41 (36%), Positives = 24/41 (58%) Query: 46 DDIEYNLSEIKSFENQILAISNKLEKGQKPKYLHLKEAIQK 86 D +E +L ++K Q+ + K EK +K + LK+AIQK Sbjct: 5 DKLENHLFDLKFTSKQLQRQAKKCEKEEKAEKAKLKKAIQK 45 >gnl|CDD|39264 KOG4061, KOG4061, KOG4061, DMQ mono-oxygenase/Ubiquinone biosynthesis protein COQ7/CLK-1/CAT5 [General function prediction only]. Length = 217 Score = 25.0 bits (54), Expect = 4.7 Identities = 14/75 (18%), Positives = 31/75 (41%), Gaps = 1/75 (1%) Query: 16 SCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQILAISNKLEKGQKP 75 +C++ V E I + +++R P ++ +++ + E + + + + P Sbjct: 136 ACTEAV-ETVIGGHYNDQLRELAEDDPEEHKELLSTITKFRDEELEHHDTGVEHDAEKAP 194 Query: 76 KYLHLKEAIQKIVKT 90 Y L E IQ K Sbjct: 195 AYAALTEIIQTGCKV 209 >gnl|CDD|36021 KOG0803, KOG0803, KOG0803, Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]. Length = 1312 Score = 24.5 bits (53), Expect = 6.6 Identities = 13/58 (22%), Positives = 18/58 (31%), Gaps = 6/58 (10%) Query: 15 SSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQILAISNKLEKG 72 S Y D S F N + Y + D+ I Q KL++G Sbjct: 1153 SYELLKAYCDVWDSFFSNAVNYLMLLQEFEVRDV------IIGCRIQERKQERKLKEG 1204 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.312 0.129 0.343 Gapped Lambda K H 0.267 0.0755 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,074,085 Number of extensions: 47224 Number of successful extensions: 136 Number of sequences better than 10.0: 1 Number of HSP's gapped: 136 Number of HSP's successfully gapped: 27 Length of query: 97 Length of database: 6,263,737 Length adjustment: 65 Effective length of query: 32 Effective length of database: 4,859,152 Effective search space: 155492864 Effective search space used: 155492864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (23.4 bits)