RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >gnl|CDD|182706 PRK10760, PRK10760, murein hydrolase B; Provisional. Length = 359 Score = 29.3 bits (66), Expect = 0.25 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 1 MKKTQLLLPLLTLLSSCS 18 M++ LLPL LL++CS Sbjct: 3 MRRYVALLPLFVLLAACS 20 >gnl|CDD|177284 PHA00452, PHA00452, T3/T7-like RNA polymerase. Length = 807 Score = 27.3 bits (61), Expect = 0.79 Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 2 KKTQLLLPLLTLLSSCSDYVYEDAIRSQFENE 33 K+ + LP + SC DY+ ED ++ + Sbjct: 576 KRPVMTLPYGSTRFSCRDYILEDLLQPGIDEG 607 >gnl|CDD|182526 PRK10533, PRK10533, putative lipoprotein; Provisional. Length = 171 Score = 25.8 bits (57), Expect = 2.3 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 4/28 (14%) Query: 1 MKKTQL--LLPLLTLLSSCS--DYVYED 24 M+ ++L L+P LLS+C+ Y+D Sbjct: 1 MRYSKLALLIPCALLLSACTTVTPAYKD 28 >gnl|CDD|162740 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. Length = 1164 Score = 25.4 bits (56), Expect = 3.2 Identities = 13/71 (18%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 27 RSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQILAISNKLEKGQKPKYLHLKEAIQK 86 + I ++ +++ E EIK E ++ ++ L K ++ + LKE + Sbjct: 422 LADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKYEQ-ELYDLKEEYDR 480 Query: 87 IVKTIEQNEKE 97 + K + + ++E Sbjct: 481 VEKELSKLQRE 491 >gnl|CDD|184467 PRK14034, PRK14034, citrate synthase; Provisional. Length = 372 Score = 25.5 bits (56), Expect = 3.4 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 13/51 (25%) Query: 52 LSEIKSFENQILAISNKLEKGQK-------------PKYLHLKEAIQKIVK 89 L+EI EN I NKL+ +K P+ HL+E +++ Sbjct: 229 LTEIGEEENVESYIHNKLQNKEKIMGFGHRVYRQGDPRAKHLREMSKRLTV 279 >gnl|CDD|165505 PHA03246, PHA03246, large tegument protein UL36; Provisional. Length = 3095 Score = 24.2 bits (52), Expect = 6.9 Identities = 11/46 (23%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Query: 26 IRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQILAISNKLEK 71 I E R + + +EY +S + N I++I++ L+K Sbjct: 1584 ISDALETLARTHSP--EGARRALEYGVSIVIPSANTIMSIADALQK 1627 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.312 0.129 0.343 Gapped Lambda K H 0.267 0.0700 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,472,807 Number of extensions: 79825 Number of successful extensions: 211 Number of sequences better than 10.0: 1 Number of HSP's gapped: 211 Number of HSP's successfully gapped: 38 Length of query: 97 Length of database: 5,994,473 Length adjustment: 65 Effective length of query: 32 Effective length of database: 4,589,953 Effective search space: 146878496 Effective search space used: 146878496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.1 bits)