Query         gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 97
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Mon May 23 18:07:31 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780221.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1yzma1 a.2.19.1 (A:456-501) F  12.9      42  0.0031   13.3   2.4   27   18-51     17-43  (46)
  2 d1xr4a2 c.124.1.2 (A:237-505)    5.4      30  0.0021   14.1  -1.7   39   15-53    200-238 (269)
  3 d2vy4a1 g.37.1.7 (A:53-87) U11   4.8      62  0.0045   12.3  -0.4   21   58-78     12-32  (35)
  4 d2ooca1 a.24.10.6 (A:8-111) Hi   4.3 1.1E+02  0.0078   11.0   1.7   48   11-62      6-53  (104)
  5 g1avo.1 a.24.8.1 (A:,B:) Prote   3.8 1.2E+02  0.0086   10.8   7.3   57    7-63     16-89  (200)
  6 d1qsma_ d.108.1.1 (A:) Histone   3.0      81  0.0059   11.7  -1.1   19   38-56      1-19  (150)
  7 d2bcgg2 c.3.1.3 (G:400-446) Gu   2.8 1.5E+02   0.011   10.2   1.8   17   63-79     20-38  (47)
  8 d1k78a2 a.4.1.5 (A:82-142) Pax   2.4 1.7E+02   0.012    9.9   1.3   20   23-42      9-28  (61)
  9 d2h80a1 a.60.1.3 (A:11-81) Del   2.3 1.8E+02   0.013    9.7  -0.0   22   58-79     42-63  (71)
 10 d1unfx1 a.2.11.1 (X:14-104) Fe   2.1   2E+02   0.014    9.6   1.7   27   25-51     39-65  (91)

No 1  
>d1yzma1 a.2.19.1 (A:456-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
Probab=12.87  E-value=42  Score=13.27  Aligned_cols=27  Identities=44%  Similarity=0.571  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHH
Q ss_conf             2011224788999999875612039999998717
Q gi|254780221|r   18 GSCADDRITELNTLLAEYKEENLKIRELQKELYP   51 (97)
Q Consensus        18 gscaddritelntllaeykeenlkirelqkelyp   51 (97)
                      -.-++.|..|..+|     |+||  ||||.|++-
T Consensus        17 QAk~a~R~dEV~~L-----e~NL--reLq~e~~~   43 (46)
T d1yzma1          17 QAKAAGRMDEVRTL-----QENL--RQLQDEYDQ   43 (46)
T ss_dssp             HHHHTTCHHHHHHH-----HHHH--HHHHHHHHH
T ss_pred             HHHHHCCHHHHHHH-----HHHH--HHHHHHHHH
T ss_conf             99982451899999-----9999--999999986


No 2  
>d1xr4a2 c.124.1.2 (A:237-505) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]}
Probab=5.43  E-value=30  Score=14.10  Aligned_cols=39  Identities=18%  Similarity=0.072  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHH
Q ss_conf             995201122478899999987561203999999871789
Q gi|254780221|r   15 TLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAI   53 (97)
Q Consensus        15 tllgscaddritelntllaeykeenlkirelqkelypai   53 (97)
                      |-.|.+-...-..+.-...||.-.+|++++++..-+--|
T Consensus       200 TE~G~av~~~r~d~~~~vte~gi~~l~~~~l~era~~li  238 (269)
T d1xr4a2         200 TDHGIAVNPARQDLLDNLRAAGVALMTIEQLQQRAEQLT  238 (269)
T ss_dssp             ETTEEEECTTCHHHHHHHHHTTCCCBCHHHHHHHHHHHH
T ss_pred             CCCCEEECCCCCCHHHHEEECCCCEEECCCHHHHHHHHH
T ss_conf             668548757854033200225855343455999999986


No 3  
>d2vy4a1 g.37.1.7 (A:53-87) U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K {Human (Homo sapiens) [TaxId: 9606]}
Probab=4.76  E-value=62  Score=12.32  Aligned_cols=21  Identities=29%  Similarity=0.358  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             998863311223668998405
Q gi|254780221|r   58 HRMDKLHFESDALDPILRRMD   78 (97)
Q Consensus        58 hrmdklhfesdaldpilrrmd   78 (97)
                      |||.|-..+..+..--||+|+
T Consensus        12 H~mPksSL~kH~asCrLRklg   32 (35)
T d2vy4a1          12 HHMPKSSLAKHMASCRLRKMG   32 (35)
T ss_dssp             CEECGGGHHHHHHHHHHHHCS
T ss_pred             CCCCHHHHHHHHHHHHHHHCC
T ss_conf             747578899998876576405


No 4  
>d2ooca1 a.24.10.6 (A:8-111) Histidine phosphotransferase ShpA {Caulobacter crescentus [TaxId: 155892]}
Probab=4.31  E-value=1.1e+02  Score=11.03  Aligned_cols=48  Identities=17%  Similarity=0.239  Sum_probs=26.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999995201122478899999987561203999999871789999999886
Q gi|254780221|r   11 AVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDK   62 (97)
Q Consensus        11 avlvtllgscaddritelntllaeykeenlkirelqkelypaistlahrmdk   62 (97)
                      .+|..+.|.   | -.-++.++..|.++.-..-+....-++++...+|++.-
T Consensus         6 ~~L~~~~gg---d-~~l~~~ll~~F~e~~~~~~~~l~~d~~~~~~~aH~LKG   53 (104)
T d2ooca1           6 AYLEGFAAG---D-FAVVDEVLALFREQAALWAPMLDPTHPGWKDAVHTVKG   53 (104)
T ss_dssp             HHHHHHTTT---C-HHHHHHHHHHHHHHHHHHGGGCSTTSTTHHHHHHHHHH
T ss_pred             HHHHHHHCC---C-HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             999988698---8-99999999999987888999870489999999899776


No 5  
>g1avo.1 a.24.8.1 (A:,B:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]}
Probab=3.81  E-value=1.2e+02  Score=10.80  Aligned_cols=57  Identities=28%  Similarity=0.358  Sum_probs=42.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------HHCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999952011224788999999875-----------------612039999998717899999998863
Q gi|254780221|r    7 QLILAVLVTLLGSCADDRITELNTLLAEYK-----------------EENLKIRELQKELYPAISTLAHRMDKL   63 (97)
Q Consensus         7 qlilavlvtllgscaddritelntllaeyk-----------------eenlkirelqkelypaistlahrmdkl   63 (97)
                      +-+..-...++...--.+|.|||.||++..                 .-|-+|-++-..+-|.|.+|.-...-+
T Consensus        16 ~~l~~~ae~ll~~~fP~KI~eLn~lL~~~~~~~~~ls~~~~~~~~~v~~N~~I~~l~~~vkpei~~L~e~~~~v   89 (200)
T g1avo.1          16 EDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIAVNCNEKIVVLLQRLKPEIKDVIEQLNLV   89 (200)
T ss_dssp             HHHHHHHHHHHHTHHHHHHHHHHHHHHSGGGCCSCTTSSCCCCCCCBCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999861747899999985774458544222479988766553999999999999999999999899


No 6  
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=2.95  E-value=81  Score=11.70  Aligned_cols=19  Identities=16%  Similarity=0.235  Sum_probs=8.8

Q ss_pred             HCHHHHHHHHHHHHHHHHH
Q ss_conf             1203999999871789999
Q gi|254780221|r   38 ENLKIRELQKELYPAISTL   56 (97)
Q Consensus        38 enlkirelqkelypaistl   56 (97)
                      ||+.||.++.+=++++..|
T Consensus         1 ~~i~IR~~~~~D~e~~~~L   19 (150)
T d1qsma_           1 DNITVRFVTENDKEGWQRL   19 (150)
T ss_dssp             CCEEEEECCGGGHHHHHHH
T ss_pred             CCEEEEECCHHHHHHHHHH
T ss_conf             9819997788999999999


No 7  
>d2bcgg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=2.78  E-value=1.5e+02  Score=10.20  Aligned_cols=17  Identities=47%  Similarity=0.550  Sum_probs=9.8

Q ss_pred             HHHHHHHHH--HHHHHCCC
Q ss_conf             331122366--89984056
Q gi|254780221|r   63 LHFESDALD--PILRRMDG   79 (97)
Q Consensus        63 lhfesdald--pilrrmdg   79 (97)
                      -|||+..-|  -|.+||-|
T Consensus        20 sHFEtt~~Dv~diY~ritG   38 (47)
T d2bcgg2          20 SHFESMTDDVKDIYFRVTG   38 (47)
T ss_dssp             SBSHHHHHHHHHHHHHHHS
T ss_pred             CHHHHHHHHHHHHHHHHHC
T ss_conf             1347778999999998438


No 8  
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.42  E-value=1.7e+02  Score=9.90  Aligned_cols=20  Identities=25%  Similarity=0.345  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHCHHH
Q ss_conf             24788999999875612039
Q gi|254780221|r   23 DRITELNTLLAEYKEENLKI   42 (97)
Q Consensus        23 dritelntllaeykeenlki   42 (97)
                      .-..+.-.-.++||.||-.|
T Consensus         9 vaTP~V~~kI~~yK~enP~i   28 (61)
T d1k78a2           9 VATPKVVEKIAEYKRQNPTM   28 (61)
T ss_dssp             SSCHHHHHHHHHHHHHCTTC
T ss_pred             CCCHHHHHHHHHHHHCCCCC
T ss_conf             57889999999998608861


No 9  
>d2h80a1 a.60.1.3 (A:11-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.26  E-value=1.8e+02  Score=9.73  Aligned_cols=22  Identities=27%  Similarity=0.540  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9988633112236689984056
Q gi|254780221|r   58 HRMDKLHFESDALDPILRRMDG   79 (97)
Q Consensus        58 hrmdklhfesdaldpilrrmdg   79 (97)
                      -+-|.-+.+.|++.+..||..-
T Consensus        42 VkkDh~fLd~D~l~sL~RRL~t   63 (71)
T d2h80a1          42 VKNDHDFLEKDLVEPLCRRLNT   63 (71)
T ss_dssp             HHTSCCSSCSTTHHHHHHHHHH
T ss_pred             HHCCCCCCCHHHHHHHHHHHHH
T ss_conf             7236553157779999999999


No 10 
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
Probab=2.14  E-value=2e+02  Score=9.56  Aligned_cols=27  Identities=11%  Similarity=0.218  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHCHHHHHHHHHHHH
Q ss_conf             788999999875612039999998717
Q gi|254780221|r   25 ITELNTLLAEYKEENLKIRELQKELYP   51 (97)
Q Consensus        25 itelntllaeykeenlkirelqkelyp   51 (97)
                      +..||.+++++..++..+.++.+..++
T Consensus        39 V~~lN~~l~~~~~~~~~l~~~~~~~~~   65 (91)
T d1unfx1          39 VENLKKQVVGTELDGKSLEEIIVTAYN   65 (91)
T ss_dssp             HHHHHHHC--CTTTTCCHHHHHHHHHG
T ss_pred             HHHHHHHHHHHHHHHCHHHHHHHHHHC
T ss_conf             999999998766400009999998611


Done!