RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >gnl|CDD|37681 KOG2470, KOG2470, KOG2470, Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism]. Length = 510 Score = 27.6 bits (61), Expect = 0.85 Identities = 12/50 (24%), Positives = 25/50 (50%) Query: 3 FKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPA 52 ++ Q L +L LL R ++L E+ +E ++R+ K+++ A Sbjct: 390 YRFSQTWLQILTGLLERMQAQRSEASQSVLDEWMKERQELRDTTKQMFNA 439 >gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like. Aldehyde dehydrogenase AlkH (locus name P12693, EC=1.2.1.3) of the alkBFGHJKL operon that allows Pseudomonas putida to metabolize alkanes and the aldehyde dehydrogenase AldX of Bacillus subtilis (locus P46329, EC=1.2.1.3), and similar sequences, are present in this CD. Length = 433 Score = 26.4 bits (59), Expect = 1.9 Identities = 14/62 (22%), Positives = 22/62 (35%), Gaps = 13/62 (20%) Query: 16 LLGSCADDRITELNTLLAEYKEENLKIRE-----LQK--------ELYPAISTLAHRMDK 62 L S A +RI +L L +I +K E+ P +S + H + Sbjct: 14 LRASTAAERIAKLKRLKKAILARREEIIAALAADFRKPAAEVDLTEILPVLSEINHAIKH 73 Query: 63 LH 64 L Sbjct: 74 LK 75 >gnl|CDD|146000 pfam03154, Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Length = 979 Score = 26.2 bits (57), Expect = 2.0 Identities = 13/44 (29%), Positives = 20/44 (45%) Query: 21 ADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLH 64 AD I E E +E ++ REL++ + P +D LH Sbjct: 711 ADPTIRERELREREMREREIRERELRERMKPGFEVKPPELDTLH 754 >gnl|CDD|37455 KOG2244, KOG2244, KOG2244, Highly conserved protein containing a thioredoxin domain [General function prediction only]. Length = 786 Score = 25.0 bits (54), Expect = 4.7 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Query: 15 TLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKL 63 T+L D ++ +TLL + I EL K L P +T +R +KL Sbjct: 210 TVLKKIKDAWNSKRDTLL---ETGTYAISELSKALSPEAATGDNRAEKL 255 >gnl|CDD|36175 KOG0957, KOG0957, KOG0957, PHD finger protein [General function prediction only]. Length = 707 Score = 24.0 bits (51), Expect = 9.1 Identities = 12/56 (21%), Positives = 18/56 (32%) Query: 42 IRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 I +E I L +L E A + KH+ R ++ L Q Sbjct: 443 ISSFMQERDSQIIPLEEEQLRLSREYLAETEANQEKKSSQKHLVERFSANEELLGQ 498 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.135 0.367 Gapped Lambda K H 0.267 0.0833 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,065,224 Number of extensions: 46984 Number of successful extensions: 161 Number of sequences better than 10.0: 1 Number of HSP's gapped: 161 Number of HSP's successfully gapped: 21 Length of query: 97 Length of database: 6,263,737 Length adjustment: 65 Effective length of query: 32 Effective length of database: 4,859,152 Effective search space: 155492864 Effective search space used: 155492864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.2 bits)