RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >gnl|CDD|162735 TIGR02153, gatD_arch, glutamyl-tRNA(Gln) amidotransferase, subunit D. This peptide is found only in the Archaea. It is part of a heterodimer, with GatE (TIGR00134), that acts as an amidotransferase on misacylated Glu-tRNA(Gln) to produce Gln-tRNA(Gln). The analogous amidotransferase found in bacteria is the GatABC system, although GatABC homologs in the Archaea appear to act instead on Asp-tRNA(Asn). Length = 404 Score = 26.2 bits (58), Expect = 1.9 Identities = 11/53 (20%), Positives = 23/53 (43%), Gaps = 9/53 (16%) Query: 38 ENLK---IRELQKELYPAIS------TLAHRMDKLHFESDALDPILRRMDGPV 81 EN+K ++ + + A+ +AH D + + + AL + + PV Sbjct: 118 ENMKPEYWIKIAEAVAKALKEGADGVVVAHGTDTMAYTAAALSFMFETLPVPV 170 >gnl|CDD|151545 pfam11101, DUF2884, Protein of unknown function (DUF2884). Some members in this bacterial family of proteins are annotated as YggN which currently has no known function. Length = 229 Score = 25.8 bits (57), Expect = 2.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 68 DALDPILRRMDGPVKHVERRINSKTTTLEQ 97 + L +RMDG + +E + S++ LE Sbjct: 167 NNLTAFEQRMDGLGQQIEEEMESQSQALEA 196 >gnl|CDD|129323 TIGR00219, mreC, rod shape-determining protein MreC. MreC (murein formation C) is involved in the rod shape determination in E. coli, and more generally in cell shape determination of bacteria whether or not they are rod-shaped. Cells defective in MreC are round. Species with MreC include many of the Proteobacteria, Gram-positives, and spirochetes. Length = 283 Score = 25.6 bits (56), Expect = 2.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 22 DDRITELNTLLAEYKEENLKIREL 45 + +L L K+EN+++REL Sbjct: 83 LKKNQQLEILTQNLKQENVRLREL 106 >gnl|CDD|180830 PRK07085, PRK07085, diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional. Length = 555 Score = 25.3 bits (56), Expect = 3.8 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Query: 25 ITELNTLLAEYKEE--NLKIRELQKELYPAIS 54 I ELN+LLAE + E L ++ + +S Sbjct: 323 IKELNSLLAENESEFKGLDTEAQREYIISKLS 354 >gnl|CDD|183514 PRK12414, PRK12414, putative aminotransferase; Provisional. Length = 384 Score = 25.1 bits (55), Expect = 4.3 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Query: 49 LYPAISTLAHRMDK-LHFES--DALDPILR 75 LY AIS L H D+ ++FE D+ PI+R Sbjct: 103 LYAAISALVHPGDEVIYFEPSFDSYAPIVR 132 >gnl|CDD|128870 smart00607, FTP, eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain. Length = 151 Score = 24.8 bits (54), Expect = 4.4 Identities = 10/36 (27%), Positives = 14/36 (38%) Query: 4 KTKQLILAVLVTLLGSCADDRITELNTLLAEYKEEN 39 I +V +T G C +RIT L+ E Sbjct: 59 LQYMTIHSVTITNRGDCCGERITGARILIGNSLENG 94 >gnl|CDD|184367 PRK13883, PRK13883, conjugal transfer protein TrbH; Provisional. Length = 151 Score = 24.7 bits (54), Expect = 5.7 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Query: 1 MRFKTKQLILAVLVTLLGSCA 21 MR K ++LA+L LG CA Sbjct: 1 MR---KIVLLALLALALGGCA 18 >gnl|CDD|150719 pfam10077, DUF2314, Uncharacterized protein conserved in bacteria (DUF2314). This domain is found in various bacterial hypothetical proteins, as well as putative ankyrin repeat proteins. The exact function of the domains comprising this family has not, as yet, been determined. Length = 133 Score = 24.3 bits (53), Expect = 7.8 Identities = 10/35 (28%), Positives = 12/35 (34%) Query: 43 RELQKELYPAISTLAHRMDKLHFESDALDPILRRM 77 REL E I L K+ F P + M Sbjct: 20 RELSWERRRIIPALDFAAVKVPFTDPDGGPRVEHM 54 >gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic. Acetolactate synthase (EC 2.2.1.6) combines two molecules of pyruvate to yield 2-acetolactate with the release of CO2. This reaction may be involved in either valine biosynthesis (biosynthetic) or conversion of pyruvate to acetoin and possibly to 2,3-butanediol (catabolic). The biosynthetic type, described by TIGR00118, is also capable of forming acetohydroxybutyrate from pyruvate and 2-oxobutyrate for isoleucine biosynthesis. The family described here, part of the same larger family of thiamine pyrophosphate-dependent enzymes (pfam00205, pfam02776) is the catabolic form, generally found associated with in species with acetolactate decarboxylase and usually found in the same operon. The model may not encompass all catabolic acetolactate synthases, but rather one particular clade in the larger TPP-dependent enzyme family. Length = 539 Score = 24.3 bits (53), Expect = 8.0 Identities = 14/66 (21%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 22 DDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPV 81 D I ++ A+ EL ++ + LA R+ DAL IL + Sbjct: 286 DATIVHIDVEPAQIDNNYQPDLELVGDIASTLDLLAERIPGYELPPDALA-ILEDLKQQR 344 Query: 82 KHVERR 87 + ++R Sbjct: 345 EALDRV 350 >gnl|CDD|116609 pfam07999, RHSP, Retrotransposon hot spot protein. Members of this family are retrotransposon hot spot proteins. They are associated with polymorphic subtelomeric regions in Trypanosoma. Length = 597 Score = 24.2 bits (52), Expect = 8.3 Identities = 14/68 (20%), Positives = 25/68 (36%), Gaps = 8/68 (11%) Query: 16 LLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILR 75 + +LN L I + ++L A S+L+H + + A+ P + Sbjct: 484 IFEKFGIAAFVDLNLSLR--------IAKQLRKLKLAGSSLSHIVLGVLAGYLAVGPDVM 535 Query: 76 RMDGPVKH 83 D P H Sbjct: 536 GQDIPTSH 543 >gnl|CDD|162790 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family. Characterized members of this protein family include benzoate-CoA ligase, 4-hydroxybenzoate-CoA ligase, 2-aminobenzoate-CoA ligase, etc. Members are related to fatty acid and acetate CoA ligases. Length = 508 Score = 23.6 bits (51), Expect = 9.9 Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 56 LAHRMDKLHFESDALDPILRRMDGPVKHVERRI 88 L ++ F S L P+++ G H+E R+ Sbjct: 98 LEDSRARVVFVSGELLPVIKAALGKSPHLEHRV 130 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.135 0.367 Gapped Lambda K H 0.267 0.0627 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,516,380 Number of extensions: 83934 Number of successful extensions: 293 Number of sequences better than 10.0: 1 Number of HSP's gapped: 293 Number of HSP's successfully gapped: 38 Length of query: 97 Length of database: 5,994,473 Length adjustment: 65 Effective length of query: 32 Effective length of database: 4,589,953 Effective search space: 146878496 Effective search space used: 146878496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)