BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 197 bits (501), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM 60 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM Sbjct: 1 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM 60 Query: 61 DKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 DKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ Sbjct: 61 DKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 23.9 bits (50), Expect = 0.68, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 42 IRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPVKHVERRINSKTTTLE 96 + E QK L ++ AH D +H ++A + ++ R D K++ NS LE Sbjct: 656 LSESQKSLDNSLK--AHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLE 708 >gi|254780687|ref|YP_003065100.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 318 Score = 22.3 bits (46), Expect = 1.6, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 68 DALDPILRRMDGPVKHVERRINSKTTTLE 96 D +DP R+ +++ RIN K TTL+ Sbjct: 226 DLIDPFARKTYQLNVNIDTRINLKKTTLK 254 >gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Score = 22.3 bits (46), Expect = 1.8, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 45 LQKELYPAISTLAHRMDKLHFESDALDPILRRM 77 L +E + S+L H + K H DAL ++R + Sbjct: 253 LSEEHFVDSSSLRHVIKKKHLVRDALASVIRSI 285 >gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 170 Score = 21.9 bits (45), Expect = 2.2, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 4/25 (16%) Query: 71 DPILRRMDGPVKHVERRINSKTTTL 95 DPILRR+ P++ +INS L Sbjct: 11 DPILRRVSRPIE----KINSDIMNL 31 >gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 910 Score = 20.8 bits (42), Expect = 4.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 4 KTKQLILAVLVTLLGSCADDRITELNTLLAEYKE 37 +T+ ++ L L G DD ELN+L E KE Sbjct: 453 QTRAILELRLARLTGLGRDDIRNELNSLGIEIKE 486 >gi|254780608|ref|YP_003065021.1| ribosomal large subunit pseudouridine synthase C [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 20.8 bits (42), Expect = 4.7, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 25 ITELNTLLAEYKEENLKIRELQKELYPAIS 54 +T + ++ E EEN+++ K YP I+ Sbjct: 4 MTYVQYVVVENDEENMRLDRWFKNHYPHIN 33 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.135 0.367 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,739 Number of Sequences: 1233 Number of extensions: 1700 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 97 length of database: 328,796 effective HSP length: 61 effective length of query: 36 effective length of database: 253,583 effective search space: 9128988 effective search space used: 9128988 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)