RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780223|ref|YP_003064636.1| ABC transporter permease [Candidatus Liberibacter asiaticus str. psy62] (360 letters) >gnl|CDD|30973 COG0628, PerM, Predicted permease [General function prediction only]. Length = 355 Score = 103 bits (259), Expect = 6e-23 Identities = 66/346 (19%), Positives = 142/346 (41%), Gaps = 13/346 (3%) Query: 14 WMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCL 73 +++ ++L LYF + P+L AL++ + P+ + LAV+ + ++ L Sbjct: 20 LLLLLLLLAILYFFQPILLPLLLALVLAYLLNPLVRRLEKRG--IPRLLAVLLVLLLILL 77 Query: 74 FIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSL 133 IV L L L+ ++ ++ + + + + + L + L Sbjct: 78 LIVLLGLLVI------PSLIEQIQNLIKNLPGLDLLQARLAKLLESLPLLGERLPVSVDA 131 Query: 134 KILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGE 193 + + + + + + S + + S++ +++ LFF DG + ++L L Sbjct: 132 LLSALLSILQSILGSLLSLLSSLLSLIV----SLLLVLVLLFFLLLDGERLRRKLIKLLP 187 Query: 194 HLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAM 253 ++I V + G ++A+ G++ G + GVP + LG++ ++++ Sbjct: 188 RKLRKRARRILSEVNATLSGYLRGQVLVALIVGILTGIGLLILGVPYALLLGLLAGLLSL 247 Query: 254 IP-GGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPT 312 IP G I I L++G + A + + + I LRP L+G + L L Sbjct: 248 IPYIGPVIGLIPAVIIALLQGGPWGALLVLIVFLVIQQIEGNILRPKLMGKRLGLHPLVI 307 Query: 313 FFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISS 358 L+GG G +GL + P L A++ V+ + + + Sbjct: 308 LLSLLGGGSLFGFVGLILAPPLAAVLKVLLRAWLEEELLAELLGDE 353 >gnl|CDD|110588 pfam01594, UPF0118, Domain of unknown function DUF20. This transmembrane region is found in putative permeases and predicted transmembrane proteins it has no known function. It is not clear what source suggested that these proteins may be permeases and this information should be treated with caution. Length = 327 Score = 85.7 bits (213), Expect = 2e-17 Identities = 72/329 (21%), Positives = 139/329 (42%), Gaps = 14/329 (4%) Query: 15 MIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLF 74 + + +IL ++F+ P+L AL++ + P+ + +A + V+ LF Sbjct: 6 IFLLLILAFIWFINDLLVPLLIALVLAYLLNPVVRFLKRRG-----IPRSLAILLVLLLF 60 Query: 75 IVPLLFLFYYGMLEMKELVSKVV-LANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSL 133 +V L+ L + + +++++ Q+ + WL+++P + E Sbjct: 61 LVALVLLGLLLIPLLIIQLTQLIKSLPQYIDSLLNWLNELPELLPELENV-------IQQ 113 Query: 134 KILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGE 193 S + + +N + I L +I +++ FFF DG + Q + S Sbjct: 114 LNSSLSDILSNILSSILNSLLSLLASLPGLLLQLILVLVLTFFFLLDGERLRQGIISFLP 173 Query: 194 HLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAM 253 + I R + + LG I+A+ G++ + GVP + L ++ + + Sbjct: 174 KRYRERVDAILREINDTLGGYLLGQVIVALIIGVLTFIGLLILGVPYALLLALLVGLANL 233 Query: 254 IP-GGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPT 312 IP G I ++IY L+ G I+ + + + I D LRP L+G + L L Sbjct: 234 IPYIGPVIILIPIAIYALLTGGIWAGLIVLIGVLLIQQIEDNILRPKLMGKRLGLHPLVI 293 Query: 313 FFGLVGGVRTMGLLGLFIGPVLMALIAVI 341 L+GG GL+GL + P L A++ I Sbjct: 294 LLSLIGGGSLFGLVGLILAPPLTAVLKAI 322 >gnl|CDD|34841 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning]. Length = 669 Score = 29.7 bits (66), Expect = 1.2 Identities = 10/39 (25%), Positives = 16/39 (41%) Query: 106 VPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTN 144 + +++ P MW SE + S Q FL+ N Sbjct: 358 LQCFVNIAPISMWLSEFLQRKFSSKQETAFSICQFLEDN 396 >gnl|CDD|185759 cd09220, GH64-GluB-like, glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. Length = 369 Score = 28.0 bits (63), Expect = 3.9 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 16/76 (21%) Query: 230 GSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIEL 289 GS Y+ PS V + A A IP GAP S T V+I +L G I W Sbjct: 35 GSTYYPPSSPSAV-PSPLGADCA-IPLGAPGSTTTVTIPILAGGRI--------W----- 79 Query: 290 FIVDKTLRPFL-VGGP 304 F VD L L GGP Sbjct: 80 FSVDDKLTFLLNPGGP 95 >gnl|CDD|34401 COG4791, EscT, Type III secretory pathway, component EscT [Intracellular trafficking and secretion]. Length = 259 Score = 27.9 bits (62), Expect = 4.9 Identities = 10/63 (15%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 19 IILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCL-FIVP 77 + ++F G +L L + SWP+ + + + + L + ++ L P Sbjct: 129 QFAIVIFFASGGILTLLGVLYESYESWPLGAFYPFELSQLVFLLNEWDQILLLALVLAAP 188 Query: 78 LLF 80 ++ Sbjct: 189 VII 191 >gnl|CDD|32267 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]. Length = 286 Score = 27.5 bits (61), Expect = 5.3 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Query: 209 KVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITA 249 K+ + L I A+ E L L AG+ V L VI+ Sbjct: 171 KLANNILLAGNIAALAEALALAEK---AGLDPDVVLEVISG 208 >gnl|CDD|37576 KOG2365, KOG2365, KOG2365, Uncharacterized membrane protein [Function unknown]. Length = 808 Score = 27.3 bits (60), Expect = 6.8 Identities = 40/191 (20%), Positives = 72/191 (37%), Gaps = 10/191 (5%) Query: 156 FGMIFLDYCLSIIFMIIALFFFY---RDGFSISQQLDSLGEHLFPAYWK-KISRIVPKVI 211 G L++ +I + L++ G + Q L A +I ++ I Sbjct: 580 GGAELLNFISQLIIFLTVLYYLLSSSSGGVTPLQWAQVLNMLPINASSSNRIVEVLELAI 639 Query: 212 RSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAP--ISFTAVSIYL 269 FL +A GL + L + V+ I A +P + A Sbjct: 640 SGVFLASAKMAFFYGLYTWLLHRLFNINIVFMPSVLAFISAALPIFPYYFAAIPAALQLW 699 Query: 270 LIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLF 329 L++G A L + + + D + + G P+L T ++GGV +GL+G Sbjct: 700 LVEGRGIVAVILSVTHLVPMEFGDSEIYDDIPGSH---PYL-TGLAIIGGVYLLGLVGAI 755 Query: 330 IGPVLMALIAV 340 IGP+++ + V Sbjct: 756 IGPIILCFVMV 766 >gnl|CDD|28760 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA isozyme V_like subgroup. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This vertebrate subgroup comprises isozyme V. CA V is the mitochondrial isozyme, which may play a role in gluconeogenesis and ureagenesis and possibly also in lipogenesis.. Length = 236 Score = 27.3 bits (60), Expect = 6.9 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Query: 278 ATCLFLWGAIELFIV---DKTLRPFLVGGPIKLPF 309 ATCL++W F V D T + + GGP++ + Sbjct: 30 ATCLYIWNNGYSFQVEFDDSTDKSGISGGPLENHY 64 >gnl|CDD|38075 KOG2864, KOG2864, KOG2864, Nuclear division RFT1 protein [Cell cycle control, cell division, chromosome partitioning]. Length = 530 Score = 27.2 bits (60), Expect = 7.9 Identities = 10/47 (21%), Positives = 24/47 (51%) Query: 208 PKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMI 254 + ++II G L+ + +WL+ + +H+A+GV+ + + Sbjct: 457 RSLFLPFGPTLSIIFAGSSLLCCTTWWLSYLAAHIAIGVVCLLATLG 503 >gnl|CDD|35096 COG5537, IRR1, Cohesin [Cell division and chromosome partitioning]. Length = 740 Score = 26.9 bits (59), Expect = 8.8 Identities = 10/36 (27%), Positives = 13/36 (36%) Query: 129 HPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYC 164 KIL + D I RF RF L++ Sbjct: 331 RLLVSKILLFLCSRIPHTDAIRRFVERFKDRILEFL 366 >gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 312 Score = 26.9 bits (60), Expect = 9.7 Identities = 15/72 (20%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Query: 209 KVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAP------ISF 262 +V G + A +G G P H G + A+ + G A +S Sbjct: 25 RVEGCGVCGSDLPAFNQGRPWFVYPAEPGGPGHEGWGRVVALGPGVRGLAVGDRVAGLSG 84 Query: 263 TAVSIYLLIKGN 274 A + Y L + Sbjct: 85 GAFAEYDLADAD 96 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.331 0.145 0.454 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,717,564 Number of extensions: 279494 Number of successful extensions: 1692 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1654 Number of HSP's successfully gapped: 225 Length of query: 360 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 265 Effective length of database: 4,210,882 Effective search space: 1115883730 Effective search space used: 1115883730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 58 (26.2 bits)