RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780223|ref|YP_003064636.1| ABC transporter permease [Candidatus Liberibacter asiaticus str. psy62] (360 letters) >3gzr_A Uncharacterized protein with A NTF2-like fold; NP_421374.1, domain of unknown function with A NTF2-like fold, structural genomics; HET: MSE GOL; 1.40A {Caulobacter vibrioides} (A:) Length = 146 Score = 29.3 bits (65), Expect = 0.79 Identities = 8/69 (11%), Positives = 16/69 (23%), Gaps = 7/69 (10%) Query: 196 FPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLA-------GVPSHVALGVIT 248 + + K + + + I G L + G A +T Sbjct: 51 IVFAHTAFLKTIFKDCKQELVTIEARTIAPGSALAVVTLIQDAYVTPDGRQXPRAHDRLT 110 Query: 249 AIMAMIPGG 257 + G Sbjct: 111 LLAVEREGV 119 >3hjz_A Transaldolase B; parachlorococcus, marine, cyanobacteria; HET: MSE; 1.90A {Prochlorococcus marinus str} (A:) Length = 334 Score = 27.0 bits (59), Expect = 4.1 Identities = 25/126 (19%), Positives = 44/126 (34%), Gaps = 15/126 (11%) Query: 162 DYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGM--- 218 DY I I + +GFS + + + + + K+I +I+ + ST + Sbjct: 48 DYVKLIDKAIESSENTLPNGFSEIELIKETVDQVSVFFGKEILKIISGRV-STEVDARLS 106 Query: 219 --TIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIF 276 T + + L + Y G+ ++ I A G L +G Sbjct: 107 FDTEATVKKARKLINLYKNFGIEKER---ILIKIAATWEGIKAAE------ILEKEGIKC 157 Query: 277 NATCLF 282 N T LF Sbjct: 158 NLTLLF 163 >2j2z_B PAPH, PAP fimbrial minor pilin protein; chaperone/surface active protein, periplasmic, pilus termination, immunoglobulin domain, PAPD; 2.3A {Escherichia coli} (B:) Length = 173 Score = 26.4 bits (57), Expect = 5.6 Identities = 4/36 (11%), Positives = 6/36 (16%) Query: 245 GVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATC 280 G +P G + C Sbjct: 1 GPFPPPGMSLPEYWGEEHVWWDGRAAFHGEVVRPAC 36 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.331 0.145 0.454 Gapped Lambda K H 0.267 0.0596 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,744,005 Number of extensions: 122130 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's gapped: 394 Number of HSP's successfully gapped: 38 Length of query: 360 Length of database: 4,956,049 Length adjustment: 90 Effective length of query: 270 Effective length of database: 1,913,599 Effective search space: 516671730 Effective search space used: 516671730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 55 (25.3 bits)