>TIGR00437 feoB ferrous iron transport protein B; InterPro: IPR003373 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent .; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.

Probab=99.60 E-value=4.2e-15 Score=121.58 Aligned_cols=82 Identities=33% Similarity=0.542 Sum_probs=64.4 Q ss_pred ECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEEEEEEECCCC---CCCCCCCC Q ss_conf 288878889999874048987366686744883379976855587776421865023357999851223---54322246 Q gi|254780226|r 9 GLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGL---VRGASKGE 85 (367) Q Consensus 9 G~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~i~~iDvaGL---v~gA~~G~ 85 (367) T Consensus 1 GNPNVGKStlFN~LTG-~~~~vGNwPG~TVek~eg~l~~~g-----------------~~i~ivDLPG~YSL~~~S~~dE 62 (733) T TIGR00437 1 GNPNVGKSTLFNALTG-ANQKVGNWPGVTVEKKEGKLKFQG-----------------EDIEIVDLPGIYSLTTFSGLDE 62 (733) T ss_pred CCCCCHHHHHHHHHHC-CCEEEEECCCCEEEEEEEEEEECC-----------------EEEEEEECCCCCCCCCCCCCHH T ss_conf 9998158999987415-870787358870787788975246-----------------2789984487300589987427 Q ss_pred CCHHHHHHHHHCCCEEEEEECCCC Q ss_conf 632899998730374788501234 Q gi|254780226|r 86 GLGNQFLAHIREVDAIIHVLRCFK 109 (367) Q Consensus 86 GlGN~FL~~ir~aDalihVVdaf~ 109 (367) T Consensus 63 ~v~~dyl~-~e~~DLv~nVVDA~n 85 (733) T TIGR00437 63 KVARDYLL-NEKPDLVVNVVDASN 85 (733) T ss_pred HHHHHHHH-CCCCCEEEEEECHHH T ss_conf 99989975-389967999725667

HHsearch alignment for GI: 254780226 and conserved domain: TIGR00437