>cd01874 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases. These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway. Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth. In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus. Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand. In addi

Probab=96.94 E-value=0.0082 Score=38.73 Aligned_cols=83 Identities=20% Similarity=0.288 Sum_probs=52.0 Q ss_pred CCEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCC Q ss_conf 82486752888788899998740489873666867448833799768555877764218650233579998512235432 Q gi|254780226|r 2 GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGA 81 (367) Q Consensus 2 ~~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~i~~iDvaGLv~gA 81 (367) T Consensus 1 svKvv~lGd~~VGKTsli~r~~~~-~-f~~~y~-pti~~~~~~~-----------~~~~~~---~v~l~iwDTaG~e~-- 61 (175) T cd01874 1 TIKCVVVGDGAVGKTCLLISYTTN-K-FPSEYV-PTVFDNYAVT-----------VMIGGE---PYTLGLFDTAGQED-- 61 (175) T ss_pred CEEEEEECCCCCCHHHHHHHHHHC-C-CCCCCC-CCEEEEEEEE-----------EEECCE---EEEEEEEECCCCCC-- T ss_conf 979999899995889999999649-8-999867-8634789999-----------999999---99999998999745-- Q ss_pred CCCCCCHHHHHHHHHCCCEEEEEECCC Q ss_conf 224663289999873037478850123 Q gi|254780226|r 82 SKGEGLGNQFLAHIREVDAIIHVLRCF 108 (367) Q Consensus 82 ~~G~GlGN~FL~~ir~aDalihVVdaf 108 (367) T Consensus 62 --~~~l~~---~~~~~~~~~ilvydv~ 83 (175) T cd01874 62 --YDRLRP---LSYPQTDVFLVCFSVV 83 (175) T ss_pred --CHHHHH---HHHHCCCEEEEEEECC T ss_conf --124658---8771388889996379

HHsearch alignment for GI: 254780226 and conserved domain: cd01874