>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=92.17 E-value=0.1 Score=31.32 Aligned_cols=33 Identities=42% Similarity=0.608 Sum_probs=25.3 Q ss_pred EEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECC Q ss_conf 486752888788899998740489873666867448833799768 Q gi|254780226|r 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVP 48 (367) Q Consensus 4 kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~ 48 (367) T Consensus 33 ~~~ivG~SGsGKSTllr~i~gL~~------------p~sG~I~~~ 65 (233) T cd03258 33 IFGIIGRSGAGKSTLIRCINGLER------------PTSGSVLVD 65 (233) T ss_pred EEEEECCCCCHHHHHHHHHHCCCC------------CCCCEEEEC T ss_conf 999988980589999999967999------------998089999

HHsearch alignment for GI: 254780226 and conserved domain: cd03258