HHsearch alignment for GI: 254780226 and conserved domain: cd03263

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=93.96  E-value=0.061  Score=32.83  Aligned_cols=32  Identities=31%  Similarity=0.540  Sum_probs=25.1

Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             86752888788899998740489873666867448833799768
Q gi|254780226|r    5 CGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVP   48 (367)
Q Consensus         5 iGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~   48 (367)
T Consensus        31 ~~llG~NGaGKSTLl~~i~Gl~------------~p~~G~I~i~   62 (220)
T cd03263          31 FGLLGHNGAGKTTTLKMLTGEL------------RPTSGTAYIN   62 (220)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC------------CCCCCCEEEC
T ss_conf             9999899973999999996698------------7889977999