>cd04126 Rab20 Rab20 subfamily. Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells. It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells. Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron. It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo

Probab=96.81 E-value=0.01 Score=38.03 Aligned_cols=79 Identities=25% Similarity=0.357 Sum_probs=54.2 Q ss_pred CEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCC Q ss_conf 24867528887888999987404898736668674488337997685558777642186502335799985122354322 Q gi|254780226|r 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGAS 82 (367) Q Consensus 3 ~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~i~~iDvaGLv~gA~ 82 (367) T Consensus 1 lKivllGd~~VGKTsl~~rf~~~~------F~--~~~~Tig~~~~-------------~k~~~~~~l~IwDTaG----qE 55 (220) T cd04126 1 LKVVLLGDMNVGKTSLLHRYMERR------FK--DTVSTVGGAFY-------------LKQWGPYNISIWDTAG----RE 55 (220) T ss_pred CEEEEECCCCCCHHHHHHHHHHCC------CC--CCCCCCCEEEE-------------EEECCEEEEEEEECCC----CC T ss_conf 989999999988999999997298------99--98887136899-------------9876478899994798----62 Q ss_pred CCCCCHHHHHHHHHCCCEEEEEECCCC Q ss_conf 246632899998730374788501234 Q gi|254780226|r 83 KGEGLGNQFLAHIREVDAIIHVLRCFK 109 (367) Q Consensus 83 ~G~GlGN~FL~~ir~aDalihVVdaf~ 109 (367) T Consensus 56 ~f~sl~~~y---~r~a~~~ilvyDit~ 79 (220) T cd04126 56 QFHGLGSMY---CRGAAAVILTYDVSN 79 (220) T ss_pred CCCCCHHHH---HCCCCEEEEEEECCC T ss_conf 243326888---567988999997989

HHsearch alignment for GI: 254780226 and conserved domain: cd04126