>cd04130 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus,

Probab=96.85 E-value=0.011 Score=37.96 Aligned_cols=82 Identities=21% Similarity=0.340 Sum_probs=50.6 Q ss_pred CEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCC Q ss_conf 24867528887888999987404898736668674488337997685558777642186502335799985122354322 Q gi|254780226|r 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGAS 82 (367) Q Consensus 3 ~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~i~~iDvaGLv~gA~ 82 (367) T Consensus 1 iKvvlvGd~~VGKTsli~r~~~~-~-F~~~y~-----pT~~~~~~~~------i-~~~~---~~v~l~iwDtaG~e---- 59 (173) T cd04130 1 LKCVLVGDGAVGKTSLIVSYTTN-G-YPTEYV-----PTAFDNFSVV------V-LVDG---KPVRLQLCDTAGQD---- 59 (173) T ss_pred CEEEEECCCCCCHHHHHHHHHHC-C-CCCCCC-----CCEEEEEEEE------E-EECC---EEEEEEEEECCCCC---- T ss_conf 98999998997889999999619-9-999857-----8358999999------9-9999---99999999899873---- Q ss_pred CCCCCHHHHHHHHHCCCEEEEEECCC Q ss_conf 24663289999873037478850123 Q gi|254780226|r 83 KGEGLGNQFLAHIREVDAIIHVLRCF 108 (367) Q Consensus 83 ~G~GlGN~FL~~ir~aDalihVVdaf 108 (367) T Consensus 60 ~~~~l~~~~---~~~a~~~ilvydv~ 82 (173) T cd04130 60 EFDKLRPLC---YPDTDVFLLCFSVV 82 (173) T ss_pred CCCHHHHHH---HCCCCEEEEEEECC T ss_conf 443456766---13787899999659

HHsearch alignment for GI: 254780226 and conserved domain: cd04130