>pfam00735 Septin Septin. Members of this family include CDC3, CDC10, CDC11 and CDC12/Septin. Members of this family bind GTP. As regards the septins, these are polypeptides of 30-65kDa with three characteristic GTPase motifs (G-1, G-3 and G-4) that are similar to those of the Ras family. The G-4 motif is strictly conserved with a unique septin consensus of AKAD. Most septins are thought to have at least one coiled-coil region, which in some cases is necessary for intermolecular interactions that allow septins to polymerize to form rod-shaped complexes. In turn, these are arranged into tandem arrays to form filaments. They are multifunctional proteins, with roles in cytokinesis, sporulation, germ cell development, exocytosis and apoptosis.

Probab=95.53 E-value=0.064 Score=32.70 Aligned_cols=67 Identities=25% Similarity=0.334 Sum_probs=34.8 Q ss_pred CEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHH-CCCCEEEEEEEEEEECCCC Q ss_conf 24867528887888999987404898736668674488337997685558777642-1865023357999851223 Q gi|254780226|r 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEI-AESKDLVPTRMSFVDIAGL 77 (367) Q Consensus 3 ~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~-~~~~~~~p~~i~~iDvaGL 77 (367) T Consensus 5 fnimvvG~sGlGKTTfiNtL~~~~~~~~~~~~~~~-~~~~~t~~i~~~----~~~iee~---g~~l~LtiiDTpGf 72 (280) T pfam00735 5 FTLMVVGESGLGKTTLINTLFLTDLYPERGIPGPS-EKIKKTVEIKAT----TVEIEED---GVKLNLTVIDTPGF 72 (280) T ss_pred EEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCC-CCCCCCCCEEEE----EEEEEEC---CEEEEEEEEECCCC T ss_conf 89999779999789999998578577866788843-355677534889----9999889---98999999989984

HHsearch alignment for GI: 254780226 and conserved domain: pfam00735