HHsearch alignment for GI: 254780227 and conserved domain: PRK02645

>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional.
Probab=94.70  E-value=0.088  Score=30.95  Aligned_cols=126  Identities=17%  Similarity=0.195  Sum_probs=68.3

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEECCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             76337999836877514899999999999985699789998383660107991304626988887464078740033678
Q gi|254780227|r   27 MVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRV  106 (426)
Q Consensus        27 ~~~krI~IltsGG~aPG~N~~I~~iv~~a~~~~~~~~v~G~~~G~~GL~~~~~~~l~~l~~~~v~~~~~~GGt~LgtsR~  106 (426)
T Consensus         1 m~lk~VlIV~k~~~-~~A~~~a~~l~~~L~~--rGi~v~~~~~~~~~---------~~-----------~~~~-~~----   52 (304)
T PRK02645          1 MQLKLVIIAYKAGS-PQAKEAAERCAKQLEA--RGIKVLMGPSGPKD---------NP-----------YPVF-LA----   52 (304)
T ss_pred             CCCCEEEEEECCCC-HHHHHHHHHHHHHHHH--CCCEEEECCCCCCC---------CC-----------CCCC-CC----
T ss_conf             97459999985899-9999999999999998--88999984443444---------77-----------7620-01----


Q ss_pred             CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             88653011101234567456999999998639988999488257899999999998518996288522223477222114
Q gi|254780227|r  107 KLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQ  186 (426)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~Id~Li~IGGdgS~~~a~~L~e~~~~~~~~i~vigiPKTIDNDi~~td~  186 (426)
T Consensus        53 ---------------------------~~~~~~Dlvi~lGGDGT~L~aar~~~-----~~~iPilGiN~------~---G   91 (304)
T PRK02645         53 ---------------------------SAEELPDLAIVLGGDGTVLAAARHLA-----PHDIPILSFNV------G---G   91 (304)
T ss_pred             ---------------------------CCCCCCCEEEEECCCHHHHHHHHHHC-----CCCCCEEEEEC------C---C
T ss_conf             ---------------------------44668889999786889999999854-----26998899824------8---6


Q ss_pred             CCCHHHH---HHHHHHHHHHHHHHHHHCCCCEEE-EEEC
Q ss_conf             6335659---999999999999877516661699-9976
Q gi|254780227|r  187 SLGALTA---AQVSACFFDNISNERSATPRSLII-HEVM  221 (426)
Q Consensus       187 tiGfdTA---~~~~a~~i~~l~~~A~s~~~~~~i-VEvM  221 (426)
T Consensus        92 ~lGFLte~~~~~~~~~~l~~l~~g~~~ie~R~~L~~~v~  130 (304)
T PRK02645         92 HLGFLTHPRDLLQDESVWDRLLEDRYAIERRMMLQARVF  130 (304)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHCCCEEEEEEEEEEEEEE
T ss_conf             469716764221178999999769928998778999999